CLUSTAL format seed alignment for MF_01026

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LEUC_MYCLE       -----MGGAR-KPRTLAEKVWDDHVVVAGQGYHQDRGPDLIYIDLHLVHEVTSPQAFDGL
LEUC_MYCTU       -----MALQTGEPRTLAEKIWDDHIVVSGGG----CAPDLIYIDLHLVHEVTSPQAFDGL
LEUC_STRCO       -----------MGRTLAEKVWDDHVVRRAEG-----EPDLLFIDLHLLHEVTSPQAFDGL
LEUC_ACTTI       --MVGVTPQSGKPRTLAEKVWDDHVVRTAAE----GEPDLLFIDLHLLHEVTSPQAFDGL
LEUC_CORGL       MTSPVENSTSTEKLTLAEKVWRDHVVSKGEN----GEPDLLYIDLQLLHEVTSPQAFDGL
LEUC_BACSU       ----------MMPRTIIEKIWDQHIVKHGEG-----KPDLLYIDLHLIHEVTSPQAFEGL
LEUC_BACHD       ----------MAPKTIIEKIWDAHTVIGEEG-----KPSLLYIDLHMVHEVTSPQAFEGL
LEUC_LISIN       -----------MGKTLFDKLWNRHVIYGKEG-----EPQLLYVDLHLIHEVTSPQAFEGL
LEUC_LISMO       -----------MGKTLFDKLWNRHVIYGKEG-----EPQLLYVDLHLIHEVTSPQAFEGL
LEUC_STAAM       -----------MGQTLFDKVWNRHVLYGKLG-----EPQLLYIDLHLIHEVTSPQAFEGL
LEUC_STAAW       -----------MGQTLFDKVWNRHVLYGKLG-----EPQLLYIDLHLIHEVTSPQAFEGL
LEUC_LACLA       ----------MSGKTIFDKLWDQHVIAGNEG-----EPQLLYIDLHVIHEVTSPQAFQGL
LEUC_BUCRP       -----------MKKTLYEKIYDAHIVHEEKN-----NASILYIDLHLLHEVTSPQAFDSL
LEUC_BUCAP       -----------MKKTLYEKIYDAHIVHEEKN-----NISILYIDLHLLHEVTSPQAFDSL
LEUC_BUCDN       -----------MNKTLYEKIYDSHVVHSEKN-----GLSILYVDLHLLHEVTSPQAFESL
LEUC_BUCAI       -----------MKKTLYDKIYDSHIVYEEKN-----NTSLLYIDLHLLHEVTSPQAFDSL
LEUC_BUCPS       -----------MGKTLYHKLYNSHIVYEQNN-----VTSILYIDLHLIHEVTXPQAFNSL
LEUC_BUCTS       -----------MGQTLYEKLYNSHIIYEDKN-----TLPIIYIDLHLLHEVTSPQAFESL
LEUC_ECOLI       -----------MAKTLYEKLFDAHVVYEAEN-----ETPLLYIDRHLVHEVTSPQAFDGL
LEUC_ECO57       -----------MAKTLYEKLFDAHVVYEAEN-----ETPLLYIDRHLVHEVTSPQAFDGL
LEUC_SALTI       -----------MAKTLYEKLFDAHVVFEAPN-----ETPLLYIDRHLVHEVTSPQAFDGL
LEUC1_SALTY      -----------MAKTLYEKLFDAHVVFEAPN-----ETPLLYIDRHLVHEVTSPQAFDGL
LEUC_YERPE       -----MGTTSSQSKTLYQKLYDAHIVHEAPN-----ETPLLYIDRHLVHEVTSPQAFDGL
LEUC_VIBCH       ---------MSKAKTLYEKIYDAHVVVAAPG-----ETPILYIDRHLVHEVTSPQAFDGL
LEUC_PASMU       -----------MSKTLYEKLFDAHVVHEANG-----ETPLIYINRHLVHEVTSPQAFDGL
LEUC_HAEIN       -----------MAKTLYEKLFDSHIVYEAEG-----ETPILYINRHLIHEVTSPQAFDGL
LEUC_CAMJE       ---------MTMAKTLYEKVFDAHVVYEGKN-----ELPILYIDRHLIHEVTSPQAFSGL
LEUC_SYNY3       ----------MSARTLFDKVWDLHTISVLPS-----GQTQLFIGLHLIHEVTSPQAFAML
LEUC_NOSS1       ----------MSKGTLFDKVWDLHTVGTLPS-----GLTQLFIGLHLVHEVTSPQAFAML
LEUC_THET8       -----------MGKTLYEKVWEAHEVRKLKN-----GQSQLFIDLHLLHEVTSPQAFGML
LEUC_XANAC       ----------MTARTLYDKLWELHEVTRRD-----DGSSLIYIDRHILHEVTSPQAFEGL
LEUC_XANCP       ----------MTAKTLYDKLWEMHEVTRRD-----DGSSLIYIDRHILHEVTSPQAFEGL
LEUC_PSEAE       ----------MAGKTLYDKLWDMHLVKQRD-----DGSALIYIDRHILHEVTSPQAFEGL
LEUC_XYLFA       ----------MAGKTLYSKLWDIHEVARRD-----DGSSLIYIDRHILHEVTSPQAFEGL
LEUC_AZOVI       ----------MAGKTLYDKLWDMHEVKRRD-----DGSSLIYIDRQILHEVTSPQ-----
LEUC_RALSO       -----------MAKTLYDKLWDDHVVHTEE-----DGTTVLYIDRQLLHEVTSPQAFEGL
LEUC_NEIMA       ----------MTAQTLYDKLWNSHVVREEE-----DGTVLLYIDRHLVHEVTSPQAFEGL
LEUC_NEIMB       ----------MTAQTLYDKLWNSHVVREEE-----DGTVLLYIDRHLVHEVTSPQAFEGL
LEUC_BRUME       ---------MSAPRTLYDKIWDDHVVDQQE-----DGTCLLYIDRHLVHEVTSPQAFEGL
LEUC_RHIME       ---------MSAPRTLYDKIWDDHLVDSQD-----DGTCLLYIDRHLVHEVTSPQAFEGL
LEUC_RHILO       ---------MSAPRTLYDKIFDDHVVDRQD-----DGTCLLYIDRHLVHEVTSPQAFEGL
LEUC_AGRFC       ---------MSAPRTLYDKIWDDHVVNRDP-----DGTCLLYIDRHLVHEVTSPQAFEGL
LEUC_CAUVC       ----------MSGKTLYDKIWDAHVV-SEA-----GGEAILYIDLHLIHEVTTPQAFAGL
LEUC2_SALTY      ----------MSAKTLYEKLVESHTIRELDN----EGHVLLYIDRSILNEYTSPQAFSGL
                               *:  *:   * :              :::.  :::* * **     

LEUC_MYCLE       RLAGRWVRRPDLTVATEDHNVPTVDIDKP----------IADPVSRIQVETLRRNCAEFG
LEUC_MYCTU       RLAGRRVRRPELTLATEDHNVPTVDIDQP----------IADPVSRTQVETLRRNCAEFG
LEUC_STRCO       RKSGRPVRRLDLTIATEDHNTPTLDIDKP----------IADPVSRAQLETLRKNCADFG
LEUC_ACTTI       RMAGRRVRRTDLTLATEDHNTPTGYADPSFNTRRGELLTIADTVSRTQIETLRKNCAEFG
LEUC_CORGL       RMTGRKLRHPELHLATEDHNVPTEGIKTG------SLLEINDKISRLQVSTLRDNCEEFG
LEUC_BACSU       RQKGRKVRRPQNTFATMDHNIPTVNRFE-----------IKDEVAKRQVTALERNCEEFG
LEUC_BACHD       RLAGRPVRRPDLTFATMDHNVPTVDRFN-----------IQDQIARKQIETLEANCKEFG
LEUC_LISIN       RMENRPLRRPDKTFATMDHNVPTEDIFN-----------IQDLVAKKQIEALQTNCEEFG
LEUC_LISMO       RLENRPLRRPDKTFATMDHNVPTEDIFN-----------IQDLVAKKQIEALQTNCAEFG
LEUC_STAAM       RLQNRKLRRPDLTFATLDHNVPTIDIFN-----------IKDEIANKQITTLQKNAIDFG
LEUC_STAAW       RLQNRKLRRPDLTFATLDHNVPTIDIFN-----------IKDEIANKQITTLQKNAIDFG
LEUC_LACLA       REAGRRVRRKDLTYGTLDHNVPTQDIFN-----------IQDLISKKQIDTFTKNVKEFD
LEUC_BUCRP       RIKNRVVRQPKKTFATMDHNVSTESKDIN----------ASGSMAKIQMQQLIRNCNQFN
LEUC_BUCAP       RMRNRSVRQPKKTFATMDHNVSTESKDIN----------ASGSMAKIQMQQLIKNCEEFN
LEUC_BUCDN       RIKDRTVRQPKKTFATMDHNVSTESKDIN----------ASGSMAKIQMQQLIKNCKEFH
LEUC_BUCAI       RDKNRKVRQPKKTFATMDHNVSTTSQDIN----------ASGSMAKVQMQELIKNCSEFN
LEUC_BUCPS       RLKNRKIRQPKKTFATMDHNVPTHNRDIK----------NSEYMAKIQMEELSKNCKDFN
LEUC_BUCTS       KNKKRIVHAPIKTFATMDHNVSTKTNKIS----------ASGKAAQIQMQQLINNCKDFN
LEUC_ECOLI       RAHGRPVRQPGKTFATMDHNVSTQTKDIN----------ACGEMARIQMQELIKNCKEFG
LEUC_ECO57       RAHGRPVRQPGKTFATMDHNVSTQTKDIN----------ACGEMARIQMQELIKNCKEFG
LEUC_SALTI       RAHHRPVRQPGKTFATMDHNVSTQTKDIN----------ASGEMARIQMQELIKNCNEFG
LEUC1_SALTY      RAHHRPVRQPGKTFATMDHNVSTQTKDIN----------ASGEMARIQMQELIKNCNEFG
LEUC_YERPE       RAMGRPVRQPGKTFATMDHNVSTQTKDIN----------ASGEMARIQMQELIKNCAEFG
LEUC_VIBCH       REKGRPVRQVSKTFATMDHNVSTTTKDIN----------ASGEMARIQMQTLSKNCEEFG
LEUC_PASMU       RAMGRSVRQPSKTVATMDHNVPTDSRDLA----------GSGEMGRVQMVELAKNTEQFG
LEUC_HAEIN       RVANRQVRQVNKTFGTMDHSISTQVRDVN----------KLEGQAKIQVLELDKNTKATG
LEUC_CAMJE       KMAKRRMARADLTLATIDHDVSTKSMDLN----------ACSDMAKEQITTLMQNTKEFG
LEUC_SYNY3       KERGLRVMYPERTVATVDHIVPTENQQRP----------FQDSLAEEMMQALEVNTKAHN
LEUC_NOSS1       RERGLKVLFPERTVATVDHIVPTENQARP----------FVDRLAEEMIQALEQNCQENN
LEUC_THET8       KDLGLRVRYPHRTFATVDHIVPTHDRTEP----------FQDPLAQSMLEALRANTREHG
LEUC_XANAC       RLAGRKPWRIDANIATPDHNVPTTRAERQGG-----LESISDEVSRLQVQTLDENCDDFG
LEUC_XANCP       RLAGRKPWRIDANIATPDHNVPTTRAERQGG-----LESISDEVSRLQVQTLDENCDDFG
LEUC_PSEAE       RLAGRKPWRIDANIATPDHNVPTTRTERKGG-----IAAIADEVSRLQVQTLDENCDDFG
LEUC_XYLFA       RLAGRPLWRVNANIATPDHNVPTTKAERQGS-----LLSIADTVSRLQVQTLDENCDDFG
LEUC_AZOVI       -VRGAAPGRANVARGCQHRHPGPQRADHPGSP----VGGRRHRRRNLAHPGADPGRELRR
LEUC_RALSO       KLANRPVWRISANLAVSDHNVPTTDRSH--G--------IADPVSKLQVDTLDANCDSFG
LEUC_NEIMA       KMAGRKLWRIDSVVSTADHNTPTGDWDK----------GIQDPISKLQVDTLDKNIKEFG
LEUC_NEIMB       KMAGRKLWRIDSVVSTADHNTPTGDWDK----------GIQDPISKLQVDTLDKNIKEFG
LEUC_BRUME       HMAGRPVRHPEKTLAVVDHNVPTSPDRI---------NGIQNEESRIQVEALARNAADFG
LEUC_RHIME       RMAGRKVRAPEKTLAVVDHNVPTSPDRH---------LGIKNEESRIQVEALARNAADFG
LEUC_RHILO       RLSGRKVRHPEKTLAVVDHNVSTSPERK---------FGIKNEESRIQVEALAKNAKDFG
LEUC_AGRFC       RIAGRPVHSPTRTLAVVDHNVPTTADRL---------EGIKNEESRIQVEALAQNAKEFG
LEUC_CAUVC       RAAGRKVRRPDRTLAVADHNIPTEGQALG-------VDAVADEEARLQLKTLARNVADNG
LEUC2_SALTY      RERGRTVRHPDTFLLNIDHVNPTRSQRD---------DLMTDPGGQLQVDYFRENAADFG
                                  .:   .                      .        .     

LEUC_MYCLE       -VRLHPMGDIEQGIVHVVG--PQLGLTQPGMTIVCGDSHTSTHGAFGAIAMGIGTSEIEH
LEUC_MYCTU       -IRLHSMGDIEQGIVHVVG--PQLGLTQPGMTIVCGDSHTSTHGAFGALAMGIGTSEVEH
LEUC_STRCO       -VRLHPLGDVEQGVVHVVG--PQLGLTQPGTTVVCGDSHTSTHGAFGALAFGIGTSQVEH
LEUC_ACTTI       -VEIRPLGDVNQGIVHVIG--PQLGLTQPGMTIVCGDSHTATHGASGALAFGIGTSEVEH
LEUC_CORGL       -VRLHPMGDVRQGIVHTVG--PQLGATQPGMTIVCGDSHTSTHGAFGSMAFGIGTSEVEH
LEUC_BACSU       -VRLADLHSVDQGIVHVVG--PELGLTLPGKTIVCGDSHTSTHGAFGALAFGIGTSEVEH
LEUC_BACHD       -IEIAGLDSPNNGIVHVIG--PELGLTQPGKTIVCGDSHTSTHGAFGALAFGIGTSEVEH
LEUC_LISIN       -VTLADMGSDRQGIVHMVG--PETGLTQPGKVIVCGDSHTATHGAFGAIGFGIGSSEVEH
LEUC_LISMO       -VTLADMGSDRQGIVHMVG--PETGLTQPGKVIVCGDSHTATHGAFGAIGFGIGSSEVEH
LEUC_STAAM       -VHIFDMGSDEQGIVHMVG--PETGLTQPGKTIVCGDSHTATHGAFGAIAFGIGTSEVEH
LEUC_STAAW       -VHIFDMGSDEQGIVHMVG--PETGLTQPGKTIVCGDSHTATHGAFGAIAFGIGTSEVEH
LEUC_LACLA       -VPAETHGGKGQGIVHMVA--PESGRTQPGKTIVCGDSHTATNGAFGAIAFGIGTSEVEH
LEUC_BUCRP       -ISLYDLNNPKQGIVHVIG--PEQGMTLPGMTIVCGDSHTSTHGAFGALSFGIGTSEVEH
LEUC_BUCAP       -IALYDLNNPKQGIVHVIG--PEQGLTLPGSTIVCGDSHTSTHGAFGALSFGIGTSEVEH
LEUC_BUCDN       -ISLYDLNHPNQGIVHVIS--PEQGMTLPGMVIVCGDSHTSTHGAFGALSFGIGTSEVEH
LEUC_BUCAI       -ISLYDIKNPNQGIVHVIS--PEKGMTLPGMTIVCGDSHTSTHGAFGALSFGIGTSEVEH
LEUC_BUCPS       -IKLYDINHPHQGIVHVLG--PEKGMTLPGMVIVCGDSHTSTHGAFGALAFGIGTSEVEH
LEUC_BUCTS       -IKLYDLNHINQGIVHVMG--PEQGLTLPGMTIVCGDSHTSTHGAFGTLAFGIGTSEVEH
LEUC_ECOLI       -VELYDLNHPYQGIVHVMG--PEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEH
LEUC_ECO57       -VELYDLNHPYQGIVHVMG--PEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEH
LEUC_SALTI       -VELYDLNHPYQGIVHVMG--PEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEH
LEUC1_SALTY      -VELYDLNHPYQGIVHVMG--PEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEH
LEUC_YERPE       -VSLYDLNHPFQGIVHVIG--PEQGMTLPGMTIVCGDSHTATHGAFGSLAFGIGTSEVEH
LEUC_VIBCH       -VTLYDINHKYQGIVHVMG--PELGITLPGMTIVCGDSHTATHGAFGSLAFGIGTSEVEH
LEUC_PASMU       -ITLYDINHINQGIVHVMG--PEQGLTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEH
LEUC_HAEIN       -IKLFDITTKEQGIVHVMG--PEQGLTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEH
LEUC_CAMJE       -VRLLGLGDKNQGIVHIVG--PELGFTLPGVTLVCGDSHTATHGAFGALAFGIGTSEVEH
LEUC_SYNY3       -IRFHPIGSGNQGIVHVIA--PEQGLTQPGMTIACGDSHTSTHGAFGAIAFGIGTSQVRD
LEUC_NOSS1       -ITFYNIGSGNQGIVHVIA--PELGLTQPGMTIACGDSHTSSHGAFGAIAFGIGTSQVRD
LEUC_THET8       -ITFFDLGSGNQGIVHVIG--PQLGLTQPGMTIACGDSHTSTHGAFGAVAFGIGTSQVRD
LEUC_XANAC       -ILEFKMNDARQGIVHVVG--PEQGATLPGMTVVCGDSHTSTHGAFGALAHGIGTSEVEH
LEUC_XANCP       -ILEFKMNDTRQGIVHVVG--PEQGATLPGMTVVCGDSHTSTHGAFGALAHGIGTSEVEH
LEUC_PSEAE       -ITEFKMNDVRQGIVHVVG--PEQGATLPGMTVVCGDSHTSTHGAFGALAHGIGTSEVEH
LEUC_XYLFA       -IFEFKMNDVRQGIVHVIG--PEQGATLPGMTVVCGDSHTSTHGAFGALAHGIGTSEVEH
LEUC_AZOVI       -VRHRRVQDERPAPGHRPCGRPGAGRHLPGMTVVCGDSHTSTHWC-GALAHGIGTSEVEH
LEUC_RALSO       -ITQFKMTDKRQGIVHVIG--PEQGATLPGMTVVCGDSHTSTHGAFGALAHGIGTSEVEH
LEUC_NEIMA       ALAYFPFMDKGQGIVHVMG--PEQGATLPGMTVVCGDSHTSTHGAFGALAHGIGTSEVEH
LEUC_NEIMB       ALAYFPFMDKGQGIVHVMG--PEQGATLPGMTVVCGDSHTSTHGAFGALAHGIGTSEVEH
LEUC_BRUME       -VEYYSERDKRQGIVHIVG--PEQGFTLPGMTIVCGDSHTSTHGAFGALAHGIGTSEVEH
LEUC_RHIME       -VEYYSENDKRQGIVHIVG--PEQGFTLPGMTIVCGDSHTSTHGAFGALAHGIGTSEVEH
LEUC_RHILO       -VEYYSENDIRQGIVHIIG--PEQGFTLPGMTIVCGDSHTSTHGAFGALAHGIGTSEVEH
LEUC_AGRFC       -VEYYSERDKRQGIVHIVG--PEQGFTLPGMTIVCGDSHTSTHGAFGALAHGIGTSEVEH
LEUC_CAUVC       -IEFFPMGDIRNGIVHVVG--PEQGRTQPGMTIVCGDSHTSTHGAFGALAHGIGTSEVEH
LEUC2_SALTY      -ITLFDVLDPRQGIEHVVA--HEQGLVMPGMVIAAGDSHTTTYGAFGALGFGIGTSEIEH
                  :          .  *        *   ** .:..*****::  . *::. ***:*::..

LEUC_MYCLE       VLATQTLPLRPFKTMAVTVDGRLPAGVTAKDIILALIAKIGTGGGQGYVLEYRGSVIESM
LEUC_MYCTU       VLATQTLPLRPFKTMAVNVDGRLPDGVSAKDIILALIAKIGTGGGQGHVIEYRGSAIESL
LEUC_STRCO       VLATQTLPLARPKTMAITVDGELPEGVTAKDLILAIIARIGTGGGQGYILEYRGEAIEKL
LEUC_ACTTI       VLATQTLPQSKPKTMAVTVVGELRPGVSAKDLILTLITQTGTGGGNGHIVEYRGEAIRKL
LEUC_CORGL       VMATQTLPLKPFKTMAIEVTGELQPGVSSKDLILAIIAKIGTGGGQGYVLEYRGEAIRKM
LEUC_BACSU       VLSTQTLWQQRPKTLEVRVDGTLQKGVTAKDVILAVIGKYGVKFGTGYVIEYTGEVFRNM
LEUC_BACHD       VLATQTLWQSKPKTMEVRVTGELAPSVSAKDIILAVIAKYGVDFGTGHVIEFTGEAIRSL
LEUC_LISIN       VFATQTIWQQKPKSMGIEINGKLPKGVYAKDIILHLIATYGVAFGTGYAVEYYGETIRNM
LEUC_LISMO       VFATQTIWQQKPKSMGIEINGKLPKGVYAKDIILHLIATYGVAFGTGYAVEYYGETIRNM
LEUC_STAAM       VFATQTLWQTKPKNLKIDINGTLPTGVYAKDIILHLIKTYGVDFGTGYALEFTGETIKNL
LEUC_STAAW       VFATQTLWQTKPKNLKIDINGTLPTGVYAKDIILHLIKTYGVDFGTGYALEFTGETIKNL
LEUC_LACLA       VLATQTIWQVKPKRMKIEFQGHPQKGIYSKDFILALIAKYGVDAGVGYAVEYSGDAISDL
LEUC_BUCRP       VLVTQTLKQQRLKNMKIQIKGKIKNFVTAKDIILFIIGKLGTSGGSGYVIEFCGDVIKKM
LEUC_BUCAP       VLVTQTLKQQRFKNMKIKIVGKVKKFITAKDIILFIIGKLGTSSGSGYVIEFCGDVIKKM
LEUC_BUCDN       VLATQTLKQQRFKNMKIEVIGKIGNFITAKDVILYIIGKIGSSAGTGYIIEFCGNVIKKM
LEUC_BUCAI       VLATQTLKQQRFKNMKIEITGEIQKFVTAKDLILFIIGKLGSSGGAGYIIEFCGNVIEKM
LEUC_BUCPS       VLATQTLQQNRLKTMNIEITGNINPMVFAKDIILSIIRKLSTSGGIGYVIEFSGSVISQL
LEUC_BUCTS       VLATQTLKQARSKTMKIGINGILKPYITAKDVILYIIKKVGTAFGTGYVVEFSGETIENL
LEUC_ECOLI       VLATQTLKQGRAKTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDL
LEUC_ECO57       VLATQTLKQGRAKTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDL
LEUC_SALTI       VLATQTLKQGRAKTMKIEVTGNAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGDAIRAL
LEUC1_SALTY      VLATQTLKQGRAKTMKIEVTGNAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGDAIRAL
LEUC_YERPE       VLATQTLKQGRAKTMRIEVNGTVGAGITAKDIVLAIIGKTGSAGGTGHVVEFCGSAIEAL
LEUC_VIBCH       VLATQTLKQGRAKTMKIEVRGKVAPGITAKDIVLAIIGKTTAAGGTGYVVEFCGEAIRDL
LEUC_PASMU       VLATQTIKQARAKKMKIEVRGKVRDGISAKDIVLAIIGKTTMGGGTGHVVEFCGEAIRDL
LEUC_HAEIN       VLATQTLKQARAKSMKIEVRGKVASGITAKDIILAIIGKTTMAGGTGHVVEFCGEAIQDL
LEUC_CAMJE       VMATQTLKQAKLKTMKIECKGQFQKGVYTKDLILYLIAQYGTAKGTGYAIEFCGELIRNL
LEUC_SYNY3       VLAAQSLSLNKLKVRKIEVNGDLAPGVYAKDVILHIIRKLGVKGGVGYAYEYAGSTFVAM
LEUC_NOSS1       VLASQTLSLSKLKVRKIEVNGALNPGVYAKDVILHIIRTLGVKGGVGYAYEYAGTTFEQM
LEUC_THET8       VLATQTLAAQKLKVRRINVEGRLAPGVYAKDVILHIIRHLGVKGGLGYAYEYGGSAVEAM
LEUC_XANAC       VLATQCLIAKKMKNMQVRVEGTLPFGVTAKDIVLAVIGKIGTAGGNGHALEFAGSAIRTL
LEUC_XANCP       VLATQCLIAKKMKNLQVRVEGTLPFGVTAKDIVLAVIGKIGTAGGNGHALEFAGSAIRAL
LEUC_PSEAE       VLATQCLVAKKMKNMLVKVEGRLPAGVTAKDIVLAVIGRIGTAGGNGHAIEFAGSAIRDL
LEUC_XYLFA       VLATQCLVTQKMKNMQVRVEGTLPWGVTAKDIVLALIGKIGTAGGNGYAVEFSGSTIRAL
LEUC_AZOVI       VLATQCLVAKKMKNMQVRVEGELPLGVSAKDIVLAVIGRIGTAGGTGHALEFAGSAIRGL
LEUC_RALSO       VLATQTLLAKKSKNMLVKVEGTLPRGCTAKDIVLAIIGKIGTAGGTGYAMEFGGSAIRAL
LEUC_NEIMA       TMATQCITAKKSKSMLIAVDGKLKAGVTAKDVALYIIGQIGTAGGTGYAIEFGGEAIRSL
LEUC_NEIMB       TMATQCITAKKSKSMLISVDGKLKAGVTAKDVALYIIGQIGTAGGTGYAIEFGGEAIRSL
LEUC_BRUME       VLATQTLIQKKAKNMLVRVDGKLPAGVTAKDIVLAIIGEIGTAGGTGYVIEYAGEAIRSL
LEUC_RHIME       VLATQTLIQKKAKNMLVRVDGQLPPGVTAKDIILAIIGEIGTAGGTGHVIEFAGEAIRSL
LEUC_RHILO       VLATQTLIQRKAKNMLVRVDGQLPEGVTAKDIILAIIGEIGTAGGTGYVIEYAGEAIRSL
LEUC_AGRFC       VLATQTLIQKKAKNMLVRVDGKLPESVTAKDIILAIIGEIGTAGGTGHVIEFAGEAIRSL
LEUC_CAUVC       VLATQTLRQKKAKNMLVRVDGQLPPGVTGKDVALAVIGEIGTAGGTGYVIEFAGEAIAGL
LEUC2_SALTY      LLATQTLVYRKLKTMRVSVQGELPFACSAKDIVLELLERIGADGATGYAIEFVGEAISAL
                  : :* :     *   :   *        **. * ::       . *:  *: *  .  :

LEUC_MYCLE       SMEGRMTICNMSIEAGARAGMVAPDETTYEFLRDRPHAPTGKQWDAAVAYWQQLRTDDDA
LEUC_MYCTU       SMEGRMTICNMSIEAGARAGMVAPDETTYAFLRGRPHAPTGAQWDTALVYWQRLRTDVGA
LEUC_STRCO       SMEARMTICNMSIEAGARAGMIAPDETTFAYLQGRPHAPEGADWDAAVEYWKTLRTDDDA
LEUC_ACTTI       SMEGRMTICNMSIEWGAKAGMIAPDETTFDYLSGRKHARRGADWDAAVAYWKTLATDEGA
LEUC_CORGL       SMDARMTMCNMSIEAGARAGMIAPDQTTFDYVEGREMAPKGADWDEAVAYWKTLPTDEGA
LEUC_BACSU       TMDERMTVCNMSIEAGARAGLIAPDEVTFEYCKNRKYTPKGEEFDKAVEEWKALRTDPGA
LEUC_BACHD       SMEERMTICNMSIEAGAKAGLISPDSVTFEYLRGRPNAPKGEAFDVAIQQWEALATDAGA
LEUC_LISIN       SMEERMTICNMAIEGGAKMGMMAPDQTTFEYVRGREYAP--SDMEKAIRDWETLKTDPDA
LEUC_LISMO       SMEERMTICNMAIEGGAKMGMMAPDETTFEYVRGREYAP--TDMDKAISDWKTLQTDSDA
LEUC_STAAM       SMDGRMTICNMAIEGGAKYGIIQPDDITFEYVKGRPFA---DNFAKSVDKWRELYSDDDA
LEUC_STAAW       SMDGRMTICNMAIEGGAKYGIIQPDDITFEYVKGRPFA---DNFVKSVDKWRELYSDDDA
LEUC_LACLA       SMEERMTICNMSIEFGAKIGLMNPDEKTYDYVKGREHAP--KNFDEAVSKWEKLVSDSDA
LEUC_BUCRP       NMEERMTVCNMAIEMGAKSALIAPDETTFLYLKGRRYSPQGKFWEEAVKYWKTLITRSKA
LEUC_BUCAP       NMEERMTICNMAIEMGAKSALIAPDETTYLYLKNKRYSPKNKYWDSAIRYWKTLVTDENA
LEUC_BUCDN       SMEERMTVCNMAIELGAKSGLIAPDETTYLYLKNKTYSPHGRNWQKAIEYWKTLKTDHNA
LEUC_BUCAI       SMEERMTICNMAIEIGAKSGLIAPDEVTFSYLKNKMYAPRGVFWKKALNFWKNLKSDKNA
LEUC_BUCPS       SMESRMTICNMSIEMGAKSGLIAPDIITYNYLKNKSYSPKNKYWNNAINYWNTLKSDKNA
LEUC_BUCTS       TMEGRMTICNMVIEMGAKSGIIAPDATTYKYLKNLPYAPKKEKWKNALEYWKNLKTDNDA
LEUC_ECOLI       SMEGRMTLCNMAIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGA
LEUC_ECO57       SMEGRMTLCNMAIEMGAKAGLVAPDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGA
LEUC_SALTI       SMEGRMTLCNMAIEMGAKAGLVAPDETTFNYVKGRLHAPKGRDFDEAVEYWKTLKTDDGA
LEUC1_SALTY      SMEGRMTLCNMAIEMGAKAGLVAPDETTFNYVKGRLHAPKGRDFDEAVEYWKTLKTDDGA
LEUC_YERPE       SMEGRMTLCNMAIEMGAKAGLVAPDDTTFAYLKGRQFAPTGEQWEQGVAYWRTLKSDADA
LEUC_VIBCH       SMEGRMTVCNMAIELGAKAGLIAPDATTFNYIKGRKFAPQGSDWDAAVDYWQTLKTDEDA
LEUC_PASMU       SMEGRMTVCNMAIELGAKSGIIAPDETTFAYLKDKPYAPKGKDWDEAVAYWQTLHSDEGA
LEUC_HAEIN       SMEGRMTVCNMAIEMGAKAGLIAPDETTFAYLKDRPHAPKGKDWEDAVAYWKTLKSDDDA
LEUC_CAMJE       SMEARMTLCNMAIEFGAKVGMIAPDEITFEYIKGKEFAPKGEEFQKYCEYWKSLRSDEGA
LEUC_SYNY3       NMEERMTVCNMSIEGGARCGYINPDEVTFAYLKGREFAPQGEDWDKAVQWWRSIASEPDA
LEUC_NOSS1       NMEERMTVCNMAIEGGARCGYVNPDQVTYDYLQGRDFAPQGADWEKAVTWWESIKSDADA
LEUC_THET8       DMESRMTLCNMSIEGGARIGYVNPDETTFQYLEGRPYVPKGSEWEEAKRRWLAWRSDPDA
LEUC_XANAC       SMEGRMTICNMAIEAGARVGMVAVDEKTIAYVRGRPFAPKGAHWDAAVALWSTLVSDPDA
LEUC_XANCP       SMEGRMTICNMSIEAGARVGMVAVDEKTIAYVKGRPFAPKGADWDAAVALWRTLVSDADA
LEUC_PSEAE       SIEGRMTICNMSIEAGARVGLVAVDQKTIDYVKGRPFAPSAEQWDQAVACWQGLVSDADA
LEUC_XYLFA       SMEGRMTICNMAIEAGARVGMVAVDEKTIQYVHGRPFAPKGSDWDAAVAFWRGLVSDPDA
LEUC_AZOVI       SMEGRMTLCNMAIEAGARVGMVAVDEKTIDYVKGRPYAPQGADWDKAVAQWRELVSDADA
LEUC_RALSO       SMEGRMTVCNMAIEAGARAGMVGVDDITLEYIKGRPFAPQGVEWEQAVAYWRSLHSDEGA
LEUC_NEIMA       SMEGRMTLCNMAIEAGARSGMVAVDQTTIDYVKDKPFAPEGEAWDKAVEYWRTLVSDEGA
LEUC_NEIMB       SMESRMTLCNMAIEAGARSGMVAVDQTTIDYVKDKPFAPEGEAWDKAVEYWRTLVSDEGA
LEUC_BRUME       SMEGRMTICNMSIEGGARAGLIAPDETTFEYIKGRPRAPQGETLEQAINYWKTLHSDEGA
LEUC_RHIME       SMEGRMTVCNMTIEGGARAGLIAPDETTFEYIKDKPRAPKGEAWDRAVEYWKTLHTDEGA
LEUC_RHILO       SMEGRMTICNMSIEGGARAGLIAADETTFAYVKDKPRAPKGAAWDAALAYWKTLQSDEGA
LEUC_AGRFC       SMEGRMTVCNMTIEGGARAGLIAPDETTFDYIKDKPRAPKGETLEQAIAYWKTLKSDEGA
LEUC_CAUVC       SMEGRMTLCNLTIEGGAKAGLVAPDDKTFAYIQGKPAAPKGAAWDMALSHWKTFFTDEDA
LEUC2_SALTY      SVEGRMTLCNMAVEAGARGAIIAPDKKVFDYIYGKPQMPVGELWQQALLEWSQLSSDADA
                  :: ***:**: :* **: . :  *  .  :  .                *    :   *

LEUC_MYCLE       VFDTEVYLDATSLSPFVTWGTNPGQGVPLAASVPDPE-LMIDDVARQAAEKALAYMDLRP
LEUC_MYCTU       VFDTEVYLDAASLSPFVTWGTNPGQGVPLAAAVPDPQ-LMTDDAERQAAEKALAYMDLRP
LEUC_STRCO       EFDAEVVIEAAELAPFVTWGTNPGQGAPLSAAVPDPA-SYEDASERFAAEKALEYMGLEA
LEUC_ACTTI       EYDTEIILDASKISPFITWGTNPGQGAALDGVVPDPQ-DFLDEVERGAAERALAYMGLTP
LEUC_CORGL       TFDKVVEIDGSALTPFITWGTNPGQGLPLGESVPSPE-DFTNDNDKAAAEKALQYMDLVP
LEUC_BACSU       VYDKSIVLDGNKISPMVTWGINPGMVLPVDSEVPAPE-SFSAEDDKKEAIRAYEYMGLTP
LEUC_BACHD       VYDRVLTMNASEIEPMVTWGTNPAQGTGVSQVVPSPD-DAKDENERRAIKQSLAYMGLEP
LEUC_LISIN       EYDLHIEMDASILEPYVTWGTNPEMGVPFSKAFPEIK-DMNYE-------RAYEYMGLKP
LEUC_LISMO       EYDLHIKMDASILEPYVTWGTNPEMGVPFSKAFPEIK-DMNYE-------RAYEYMGLKP
LEUC_STAAM       IFDRVIELDVSTLEPQVTWGTNPEMGVNFSEPFPEIN-DINDQ-------RAYDYMGLEP
LEUC_STAAW       IFDRVIELDVSTLEPQVTWGTNPEMGVNFSEPFPEIS-DINDQ-------RAYDYMGLEP
LEUC_LACLA       QYDKILSLDVSQLKPMVTWGTNPGMGLEFGEKFPEINNDLNYE-------RAYQYMDLKP
LEUC_BUCRP       FFDKEFTFDVSNLSPQITWGTSPDQVLSINEKIPDFN-FFKDSVKKNLARSACDYMNLKP
LEUC_BUCAP       LFDKEFTFDISDISPQVTWGTSPDQVLSINEKIPDFN-SFKDSIKKDLARSACNYMDLKP
LEUC_BUCDN       IFDKVFTIDISNILPQVTWGTNPDQVIGINEKIPDFT-SFQNIVKKDLAKSACKYMDLKP
LEUC_BUCAI       FFDKVVNINISDLSPQITWGTNPDQVISIDQKIPDFS-SFDNLIKKDLAKSACKYMGLKI
LEUC_BUCPS       FFDKKISINISNLAPQITWGTKPDQVISIDEPIPNID-SLKMFLNKNQLKNPLLYMGLKP
LEUC_BUCTS       KFDKIVKFDVSQIEPQITWGTNPSQTINITESNPDPK-KINNIIDKQATEKALKYMNLKP
LEUC_ECOLI       TFDTVVTLQAEEISPQVTWGTNPGQVISVNDNIPDPA-SFADPVERASAEKALAYMGLKP
LEUC_ECO57       TFDTVVTLQAEEISPQVTWGTNPGQVISVNDNIPDPA-SFADPVERASAEKALAYMGLKP
LEUC_SALTI       TFDTVVTLRAEEIAPQVTWGTNPGQVISVTDIIPDPA-SFSDPVERASAEKALAYMGLQP
LEUC1_SALTY      TFDTVVALRAEEIAPQVTWGTNPGQVISVTDIIPDPA-SFSDPVERASAEKALAYMGLQP
LEUC_YERPE       QFDTIVTLDAADIAPQVTWGTNPGQVIAVNQIIPAPE-SFSDPVERASAEKALAYMDLRP
LEUC_VIBCH       QFDAVVTLEASEIKPQVTWGTNPGQVIAVDEPIPSPS-QFADPVERSSAEKALAYMGLEA
LEUC_PASMU       EFDTVVTLEASEIEPQVTWGTNPGQVIGINQPIPNPA-EMSDPIERQSAEKALAYMDLPH
LEUC_HAEIN       QFDTVVTLEAKDIAPQVTWGTNPGQVISVNETIPNPQ-EMADPVQRASAEKALHYIGLEA
LEUC_CAMJE       KYDASITLDVSKIKPQISYGTNPSQVIGIDEKIPKIS-DFKNQSEQKSLLDALYYVNLEQ
LEUC_SYNY3       VYDDVVSFRAEDIEPTVTWGITPGQGIGISEPVPTLD-SLNPD-DQAIASEAYKYMQFQP
LEUC_NOSS1       EYDDVIVFNAADIPPTVTWGITPGQGIGVNQLIPQPE-ELLEE-DRFVAEEAYRYMDLYP
LEUC_THET8       SYDDVVTFRAEEIAPTVTWGITPGQAIPIDGRIPLLE-ELPEE-ERPVAEEALAYMGFRP
LEUC_XANAC       HFDTVVELRAEDIKPQVSWGTSPEMVLAIDQHVPDPA-IEQDPTKRDSIERALKYMGLKA
LEUC_XANCP       SFDTVVELRAEDIKPQVSWGTSPEMVVAIDQQVPDPA-AEQDPTKRDSIQRALKYMGLRA
LEUC_PSEAE       RFDTVVELDAAQIKPQVSWGTSPEMVLAVDQNVPDPA-RESDPIKRGSIERALKYMGLRP
LEUC_XYLFA       HFDRVVELSAEEIKPQVTWGTSPEMVSAVDQSVPDPE-RETDPVKKESLIRALKYMGLQP
LEUC_AZOVI       GFDTVVELKAEEIRPQVTWGTSPEMVLPVDERVPDPA-SESDPVKRDSIVRALKYMGLAA
LEUC_RALSO       RFDHVVELRAEEIRPQVSWGTSPEMVVSIEDRVPDPD-KEKDPVKRNAMERALEYMALQP
LEUC_NEIMA       VFDKEYRFNAEDIEPQVTWGTSPEMVLDISSKVPNPA-EETDPVKRSGMERALEYMGLEA
LEUC_NEIMB       VFDKEYRFNAEDIEPQVTWGTSPEMVLDISSKVPNPA-EETDPVKRSGMERALEYMGLEA
LEUC_BRUME       HFDKIVTLDAGSLPPIVSWGSSPEDVVSVTGVVPNPD-DIADETKRASKWRALDYMGLKP
LEUC_RHIME       HYDRVVVLDAANLPPIVSWGSSPEDVVSVQGVVPNPD-DIQDETKRTSKWRALDYMGLKP
LEUC_RHILO       HFDKVIVLDAAKLPPIVSWGSSPEDVVSVQGVVPNPE-EITDENKRTSKIRALDYMGLTP
LEUC_AGRFC       HYDKVVILDAANLPPIVSWGSSPEDVTSVEGIVPNPD-DIEEENKRTSKWRALDYMGLKP
LEUC_CAUVC       VFDRTVVIDGSALVPMVTWGTSPEDVIPVTGNVPDPE-SFATPDKRAAAHRALDYMGLKA
LEUC2_SALTY      VFDKTVAINCHDLEPKVTWGISPDQTGSITGRVPFPE-QETNPLKRLALEKALHYMGLTA
                  :*    :    : * :::* .*     .    *                 .  *: :  

LEUC_MYCLE       GTPMRDIAVDAVFVGSCTNGRIEDLRLVADVLR-----GHKVADGVRM-LIVPGS--MRV
LEUC_MYCTU       GTAMRDIAVDAVFVGSCTNGRIEDLRVVAEVLR-----GRKVADGVRM-LIVPGS--MRV
LEUC_STRCO       GQPLRSIQVDTVFVGSCTNGRIEDLRAAAEIVR-----DRKVADGVRM-LVVPGS--ARV
LEUC_ACTTI       GTPFRDVPVDVVFVGSCTNGRLEDLRAAADVIR-----GRKVADGVRM-MIVPGS--YQV
LEUC_CORGL       GTPLRDIKIDTVFLGSCTNARIEDLQIAADILK-----GHKIADGMRM-MVVPSS--TWI
LEUC_BACSU       HQKIEDIKVEHVFIGSCTNSRMTDLRQAADMIK-----GKKVADSVRA-IVVPGS--QSV
LEUC_BACHD       GTPITEIAIQHVFIGSCTNSRLSDLRTAAELIK-----GRKVADGVRA-LVVPGS--QQV
LEUC_LISIN       GQTAEEIELGYVFIGSCTNARLSDLEEAARIVK-----GNKVKNNIRA-LVVPGS--RQV
LEUC_LISMO       GQTAEQIELGYVFIGSCTNARLSDLEEAARIVK-----GNKVKNNIRA-LVVPGS--RQV
LEUC_STAAM       GQKAEDIDLGYVFLGSCTNARLSDLIEASHIVK-----GNKVHPNITA-IVVPGS--RTV
LEUC_STAAW       GQKAEDIDLGYVFLGSCTNARLSDLIEASHIVK-----GNKVHPNITA-IVVPGS--RTV
LEUC_LACLA       GQTASAIDLGYIFIGSCTNARLGDLEEAAKIIG-----DRHIADGLTG-IVVPGS--RPV
LEUC_BUCRP       GSYLTDIKIDKVFIGSCTNSRIEDLRSAAKILK-----NKKISKNIKA-ILLPGSGTGTV
LEUC_BUCAP       GSYLKNIKIDKVFIGSCTNSRIEDLRSAATILK-----NKKISKNIKA-IVVPGS--GSV
LEUC_BUCDN       GTYLTDITIDKVFIGSCTNSRIEDLRSASKILK-----HNKISKNVKA-IVVPGS--GLV
LEUC_BUCAI       GTYLTNITVDKVFIGSCTNGRIEDLRAASKILK-----DKKIANNVKA-IVVPGS--GSV
LEUC_BUCPS       GEYLNNLVVDKVFIGSCTNSRTEDLRAAANIVQ-----NTHVAKNVHA-IVVPGS--GMV
LEUC_BUCTS       NQKMINLVVDKVFIGSCTNSRIEDLRIASKIIK-----NKKVAKTTKA-IVVPGS--KLV
LEUC_ECOLI       GIPLTEVAIDKVFIGSCTNSRIEDLRAAAEIAK-----GRKVAPGVQA-LVVPGS--GPV
LEUC_ECO57       GILLTEVAIDKVFIGSCTNSRIEDLRAAAEIAK-----GRKVAPGVQA-LVVPGS--GPV
LEUC_SALTI       GVPLTDVAIDKVFIGSCTNSRIEDLRAAAEVAK-----GRKVAPGVQA-LVVPGS--GPV
LEUC1_SALTY      GVPLTDVAIDKVFIGSCTNSRIEDLRAAAEVAK-----GRKVAPGVQA-LVVPGS--GPV
LEUC_YERPE       GIKLTEVAIDKVFIGSCTNSRIEDLRAAAAIAQ-----GRKVAKGVQA-IVVPGS--GPV
LEUC_VIBCH       GKMLSDYKVDKVFVGSCTNSRIEDMRAAAAVAK-----GKKVASHVQA-LIVPGS--EQV
LEUC_PASMU       SIKLTDVAIDKVFIGSCTNSRIEDLRAAAAIAK-----GRKVADGVQA-LVVPGS--GLV
LEUC_HAEIN       GTNLKDIKVDQVFIGSCTNSRIEDLRAAAAVMK-----GRKKADNVKRILVVPGS--GLV
LEUC_CAMJE       DQVIEGVKIDIVFIGSCTNGRLEDLKIAADILK-----GRKIHKNVKA-LIVPGS--MQV
LEUC_SYNY3       GQPLKGTKVDVCFIGSCTNGRLSDLEEAAKVAK-----GHQVAAGVKA-FVVPGS--EQV
LEUC_NOSS1       GQPIKGTKIDVCFIGSCTNGRLTDLQEAAKIAK-----GRRVAAGVKA-FVVPGS--ERV
LEUC_THET8       GQPIKGVPIQVAFIGSCTNARLSDLREVARYLK-----GHKVKKGVRA-LVVPGS--EWV
LEUC_XANAC       NQPITAIRLDRVFIGSCTNSRIEDLRAAAAVAK-----GRKVASTIKQALVVPGS--GLV
LEUC_XANCP       NQPITEIHLDRVFIGSCTNSRIEDLRAAAAVAK-----GRKVASTIKQALVVPGS--GLV
LEUC_PSEAE       NQAITDIQLDRVFIGSCTNSRIEDLRAAAEVAR-----GRKVAATIKQALVVPGS--GLV
LEUC_XYLFA       NDPITSIKLDRVFIGSCTNSRIEDLRAAAEVVK-----GRKVASTVKQAMVVPGS--GLV
LEUC_AZOVI       NQPIGEIKVDRVFIGSCTNSRIEDLRAAAEVAK-----GARSPRASSRRWWCRAP--GWS
LEUC_RALSO       NVAIGDIRIDKVFIGSCTNSRIEDMRAAAWVVQKL---GKRIASNVKLAMVVPGS--GLV
LEUC_NEIMA       GTPLNEIPVDIVFIGSCTNSRVEDLREAAAIAK-----DRKKAANVQRVLIVPGS--GLV
LEUC_NEIMB       GTPLNEIPVDIVFIGSCTNSRIEDLREAAAIAK-----DRKKAANVQRVLIVPGS--GLV
LEUC_BRUME       GTKITDIAVDRVFIGSCTNGRIEDLRAAAKVVE-----GKKVAPTVN-AMIVPGS--GLV
LEUC_RHIME       GTKITDIAIDRVFIGSCTNGRIEDLRAVAEVVE-----GRKVAPTVS-AMIVPGS--GLV
LEUC_RHILO       GTKITDIALDRVFIGSCTNGRIEDLRAAAKVIE-----GKTVNPRVN-AMIVPGS--GLV
LEUC_AGRFC       GTRITDIAIDRVFIGSCTNGRIEDLRAAAKIVD-----GRKVASTVS-AMIVPGS--GLV
LEUC_CAUVC       GQPISEARIDRVFIGSCTNSRIEDMRAAAAVVQEAFLHGRLVAPHVK-AMVVPGS--GLV
LEUC2_SALTY      GMLLKDIRISHAFIGSCTNGRIEDLRAVAKVLE-----GRKIASHVR-GIIVPGS--TMV
                         :   *:*****.*  *:  .:                        ..     

LEUC_MYCLE       RAQAEAEGLGEIFITAGAQWRQPGCSMCLGMNPDQLAPGERCAATSNRNFEGRQGK-GGR
LEUC_MYCTU       RAQAEAEGLGEIFTDAGAQWRQAGCSMCLGMNPDQLASGERCAATSNRNFEGRQGA-GGR
LEUC_STRCO       GLQAVSEGLDVVFKEAGAEWRHAGCSMCLGMNPDQLAPGERSASTSNRNFEGRQGK-GGR
LEUC_ACTTI       REQAEAEGLDKIFIDAGAEWRFAGCSMCLGMNPDTLSPGQRAASTSNRNFEGRQGK-GGR
LEUC_CORGL       KQEAEALGLDKIFTDAGAEWRTAGCSMCLGMNPDQLKPGERSASTSNRNFEGRQGP-GGR
LEUC_BACSU       KLQAEKEGLDQIFLEAGFEWRESGCSMCLSMNNDVVPEGERCASTSNRNFEGRQGK-GAR
LEUC_BACHD       KRAAEKEGLDEIFKEAGFEWRDSGCSMCLGMNPDTVPEGERCASTSNRNFEGRQGK-GAR
LEUC_LISIN       RNAAEAIGLDKIFKDAGFEWREPGCSMCLGMNPDQVPDGVHCASTSNRNFEGRQGK-GAR
LEUC_LISMO       RNAAESIGLDKIFIEAGFEWREPGCSMCLGMNPDQVPDGVHCASTSNRNFEGRQGK-GAR
LEUC_STAAM       KKEAEKLGLDTIFKNAGFEWREPGCSMCLGMNPDQVPEGVHCASTSNRNFEGRQGK-GAR
LEUC_STAAW       KKEAEKLGLDTIFKNAGFEWREPGCSMCLGMNPDQVPEGVHCASTSNRNFEGRQGK-GAR
LEUC_LACLA       KEAAEAQGLDKIFKEAGFEWREPGCSACLGMNPDQIPEYVHCASTSNRNFEGRQGH-NAR
LEUC_BUCRP       KKPAEKEGLDKIFIDAGFEWRLPGCSMCLGMNNDKLSDGERCASTSNRNFEGRQGR-GGR
LEUC_BUCAP       KNQAEKEGLDKIFIDAGFEWRLPGCSMCLGMNNDKLSDGERCASTSNRNFEGRQGR-GGR
LEUC_BUCDN       KRQAESEGLDKIFIEAGFEWRLPGCSMCLGMNNDRLSENERCASTSNRNFEGRQGR-NGR
LEUC_BUCAI       KREAENEGLDKIFISAGFEWRLPGCSMCLGMNKDRLNDGERCASTSNRNFEGRQGR-GGR
LEUC_BUCPS       KLQAEEEGLDKIFINAGFEWRLPGCSMCLGMNLDRLKPKERCASTSNRNFEGRQGR-DGR
LEUC_BUCTS       KIQAEKEGLDKIFINAGFEWRLPGCSMCLAMNDDKLNRGERCASTSNRNFEDRQGR-GGR
LEUC_ECOLI       KAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGR-GGR
LEUC_ECO57       KAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGR-GGR
LEUC_SALTI       KAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGR-GGR
LEUC1_SALTY      KAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGR-GGR
LEUC_YERPE       KAQAEAEGLDKIFIAAGFEWRLPGCSMCLAMNNDRLEPGERCASTSNRNFEGRQGR-GGR
LEUC_VIBCH       KAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLGPGERCASTSNRNFEGRQGR-DGR
LEUC_PASMU       REQAEKEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLAPGERCASTSNRNFEGRQGR-GGR
LEUC_HAEIN       KEQAEKEGLDKIFIAAGAEWRNPGCSMCLGMNDDRLGEWERCASTSNRNFEGRQGR-NGR
LEUC_CAMJE       RKEAENLGLDKIFIEAGCEWRYAGCSMCLGMNDDKANSGQRVASTSNRNFVGRQGK-GSI
LEUC_SYNY3       KQQAEAAGLDQIFQAAGFEWREAGCSMCLAMNPDKLQGDQLSASSSNRNFKGRQGSASGR
LEUC_NOSS1       KKAAEAEGLDKIFEAAGFEWREPGCSMCLAMNPDKLEGRQISASSSNRNFKGRQGSASGR
LEUC_THET8       ARKAEEEGIAEVFREAGFEWRMPGCSMCLAMNPDRLEGDELCASSSNRNYKGRMGSPRGR
LEUC_XANAC       KAQAEAEGLDKVFLDAGFEWREPGCSMCLAMNPDKLGSGEHCASTSNRNFEGRQGA-GGR
LEUC_XANCP       KAQAEAEGLDKIFLDAGFEWREPGCSMCLAMNPDKLGSGEHCASTSNRNFEGRQGA-GGR
LEUC_PSEAE       KEQAEKEGLDRIFIEAGFEWREPGCSMCLAMNPDRLESGEHCASTSNRNFEGRQGA-GGR
LEUC_XYLFA       KAQAEVEGLDKIFIEAGFEWREPGCSMCLAMNPDKLGSGEHCASTSNRNFEGRQGI-GGR
LEUC_AZOVI       RSRRRRRGWTGS-SSRPVSSGATGCSMCLAMNPDRLESGEHCASTSNRNFEGRQGA-GGR
LEUC_RALSO       KEQAEREGLDKIFKAAGFEWREPGCSMCLAMNADRLEPGERCASTSNRNFEGRQGA-GGR
LEUC_NEIMA       KEQAEKEGLDKIFIEAGFEWREPGCSMCLAMNADRLTPGQRCASTSNRNFEGRQGN-GGR
LEUC_NEIMB       KEQAEKEGLDKIFIEAGFEWREPGCSMCLAMNADRLTPGQRCASTSNRNFEGRQGN-GGR
LEUC_BRUME       KEQAEAEGLHKIFIEAGFDWREPGCSMCLAMNDDRLKPGERCASTSNRNFEGRQGF-KGR
LEUC_RHIME       KEQAEAEGLDKIFKEAGFDWREPGCSMCLAMNDDRLKPGERCASTSNRNFEGRQGF-KGR
LEUC_RHILO       KEQAEAEGLDKIFLAAGFDWREPGCSMCLAMNDDRLKPHERCASTSNRNFEGRQGF-KGR
LEUC_AGRFC       KEQAEKEGLDKIFLDAGFEWREPGCSMCLAMNDDRLKPGERCASTSNRNFEGRQGY-KSR
LEUC_CAUVC       KEQAEEEGLDAIFKAAGFDWREPGCSMCLAMNPDKLAPQERCASTSNRNFEGRQGR-AGR
LEUC2_SALTY      RRQAEEEGLAKIFIAAGFEWRQSGCSMCLAMNEDVLSPGDRCASGTNRNFPGRQGA-GAR
                        *          .   .*** **.** *        *: :***: .* *   . 

LEUC_MYCLE       THLVSPAVAAATAVRGTFSAPADLN----------
LEUC_MYCTU       THLVSPAVAAATAVRGTLSSPADLN----------
LEUC_STRCO       THLVSPQVAAATAVLGHLASPADLSAADVPTPAGV
LEUC_ACTTI       THLVSPQVAAATAVVGKLAAPADL-----------
LEUC_CORGL       THLVSPAVAAATAIRGTLSSPADI-----------
LEUC_BACSU       THLVSPAMAAMAAIHGHFVDVRKFYQEKTVV----
LEUC_BACHD       THLVSPQMAAAAAIAGHFVDVRTFQSEPQTV----
LEUC_LISIN       THLVSPAMAAAAAINGHFIDIRKEAVISGGN----
LEUC_LISMO       THLVSPAMAAAAAINGHFIDIRKVAVISGGN----
LEUC_STAAM       THLVSPAMAAAAAIHGKFVDVRKVVV---------
LEUC_STAAW       THLVSPAMAAAAAIHGKFVDVRKVVV---------
LEUC_LACLA       THLCSPAMAAAAAIAGKFVDVRTLVTD--------
LEUC_BUCRP       THLVSPIMAA-AAIYGRFIDVRNLDSETN------
LEUC_BUCAP       THLVSPIMAA-AAIYGHFVDVRNLNSETN------
LEUC_BUCDN       THLVSPIMAALAALYGKFSNPNKLN----------
LEUC_BUCAI       THLVSPIMAAAAAVYGKFVDVRKLYNGENN-----
LEUC_BUCPS       THLVSPAMAAAAAIFGHFVDIRKI-----------
LEUC_BUCTS       THLVSPITAAAAAIFGYFVDIKNIL----------
LEUC_ECOLI       THLVSPAMAAAAAVTGHFADIRNIK----------
LEUC_ECO57       THLVSPAMAAAAAVTGHFADIRNIK----------
LEUC_SALTI       THLVSPAMAAAAAVTGHFADIRSIK----------
LEUC1_SALTY      THLVSPAMAAAAAVTGHFADIRSIK----------
LEUC_YERPE       THLVSPAMAAAAAVSGHFADVRELSATTH------
LEUC_VIBCH       THLVSPAMAAAAAIAGHFVDIRQF-----------
LEUC_PASMU       THLVSPAMAAAAAVYGKFVDIRNLELH--------
LEUC_HAEIN       THLVSPAMAAAAGVFGKFVDIRDVTLN--------
LEUC_CAMJE       THLMSPASAAACAIEGVICDNRKYLGV--------
LEUC_SYNY3       TLLMSPAMVAAAAITGQVADVREVLG---------
LEUC_NOSS1       TLLMSPAMVATAAIQGEVADVRELL----------
LEUC_THET8       TVLMSPLMVAAAAVAGEIADAREVFGLAGVR----
LEUC_XANAC       THLVSPAMAAAAAVSGHFVDVRELQGIESRE----
LEUC_XANCP       THLVSPAMAAAAAVSGHFVDVRELQGIETRE----
LEUC_PSEAE       THLVSPAMAAAAAVNGRFIDVRELLA---------
LEUC_XYLFA       THLVSPAMAAAAAVAGHFVDVREMMR---------
LEUC_AZOVI       THLVSPAMAAAAAVAGRFVDVRQLLQA--------
LEUC_RALSO       THLVSPAMAAAAALEGHFVDVRKLG----------
LEUC_NEIMA       THLVSPAMAAAAAVTGRFTDIRMMA----------
LEUC_NEIMB       THLVSPAMAAAAAVTGRFTDIRMMA----------
LEUC_BRUME       THLVSPAMAAAAAIAGHFVDIRAWK----------
LEUC_RHIME       THLLSPAMAAAAAVAGHFVDIREWK----------
LEUC_RHILO       THLVSPAMAAAAAIAGHFVDIRDWK----------
LEUC_AGRFC       THLVSPAMAAAAAIAGHFVDVREWQ----------
LEUC_CAUVC       THLVSPAMAAAAAIAGHLVDVRTLFSETAQ-----
LEUC2_SALTY      THLMSPAMVAAAAVAGHLVDVRSLLQAGE------
                 * * **  .*  .: * .