CLUSTAL format seed alignment for MF_01030

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SDHD_BACSK       MDIAGKNREQWLAAYPLLQQIVLTKEVWWANPN-RQPASEGLARLSLK--EEDVKEAEQR
SDHD_CARHZ       -------------MSDLLTGIKNYQQMFWQNPN-KLSADEALARINFS--FDDIFEAQKR
SDHD_BACCZ       ----MKEIETLKEEYPLLNKLIATEEVFWVNPN-MEKYETAIKDSPLS--EENVKDAEER
SDHD_BACHK       ----MKEIEKLKEEYPLLNKLIATEEVFWVNPN-MEKYETAIKDSPLS--EENVKDAEER
SDHD_BACAH       ----MKEIEKLKEEYPLLNKLIETEEVLWVNPN-MEKYETAIKDSPLS--EENVKDAKER
SDHD_BACAN       ----MKEIEKLKEEYPLLNKLIEIEEVFWVNPN-MEKYETAIKDSPLS--EENVKDAEER
SDHD_BACC1       ----MKEIEKLKEEYPLLNKLIATEEVFWVNPN-MEKYETAIKDSPLN--EENVKDAEER
SDHD_BACCR       ----MKEIGALQAEYPLVNKLIATEEVFWINPN-IEKYETAIKDSPLN--EENVKDAEER
SDHD_BACHD       ----MNELEQWRKD-PLVIKLMATEEVFWLNPH-IDSFKSAVRKLSLH--EDDVKDAEKR
SDHD_GEOSE       -MMTKNEIQKWVKEFPLLKTIMAAEEVFWRNPK-YHAFAQAIRTIPLR--ERDVKEAEER
SDHD_BACSU       -MSVHSEVLHALLKDPFIQKLIDAEPVFWANS---GKKEGPLPRADEW--ATEIAEAEKR
SDHD_ECOLI       --MENAKMNSLIAQYPLVKDLVALKETTWFNPG-TTSLAEGLPYVGLT--EQDVQDAHAR
SDHD_SHISS       --MENAKMNSLIAQYPLVKDLVALKETTWFNPG-TTSLAEGLPYVGLT--EQDVQDAHAR
SDHD_SHIFL       --MENAKMNSLIAQYPLVKDLVALKETTWFNPS-TTSLAEGLPYVGLT--EQDVQDAHAR
SDHD_SHIF8       --MENAKMNSLIAQYPLVKDLVALKETTWFNPS-TTSLAEGLPYVGLT--EQDVQDAHAR
SDHD_SHIDS       --MENGKMNSLIAQYPLVKDLVALKETTWFNPG-TTSLAEGLPYVGLT--EQDVQDAHAR
SDHD2_ECOL5      --MENAKMNSLIAQYPLVKDLVALKETTWFNPG-TTSLAEGLPYVGLT--EQDVQDAHAR
SDHD2_ECOUT      --MENAKMNSLIAQYPLVKDLVALKETTWFNPG-TTSLAEGLPYVGLT--EQDVQDAHAR
SDHD_ECO57       --MENAKMNSLIAQYPLVKDLVALKETTWFNPG-TTSLAEGLPYVGLT--EQDVQDAHAR
SDHD_ECOK1       --MENAKMNSLIAQYPLVEDLVALKETTWFNPG-TTSLAEGLPYVGLT--EQDVQDAHAR
SDHD1_ECOUT      --MENAKMNSLIAQYPLVEDLVALKETTWFNPG-TTSLAEGLPYVGLT--EQDVQDAHAR
SDHD1_ECOL5      --MENAKMNSLIAQYPLVKDLVALQETTWFNPG-TTSLAEGLPYVGLT--EQDVQDAHAR
SDHD_ECOL6       --MENAKMNSLIAQYPLVEDLVALKETTWFNPG-TTSLAEGLPYVGLT--EQDVQDAHAR
SDHD_SALTY       --MEN--IQKLIARYPLVEDLVALKETTWFNPG-ATSLAQGLPYVGLT--EQDVNAAHDR
SDHD_SALCH       --MEN--IQKLIARYPLVEDLVALKETTWFNPG-ATSLAQGLPYVGLT--EQDVNAAHDR
SDHD_SALPA       --MEN--IQKLIARYPLVEDLVALKETTWFNPG-TTSLAQGLPYVGLT--EQDVNAAHDR
SDHD_SALTI       --MEN--ILKLIARYPLVEDLVALKETTWFNPG-ATSLAQGLPYVGLT--EQDVNAAHDR
SDHD_PHOLL       --MKRTEIQQLLNEYPLVKNLMELEEIFWFNPC-NTTLKEGLPFVGLG--ADDVEDAEAR
SDHD_YERE8       --MNRTKIDKLITDYPLVKNLINLEEVTWFNPQ-ATTLEKGLPYVGLS--QQDVADAEAR
SDHD_AERHH       --MKHIDVSQLTQQFPLLQSLIALEPVSWFNPK-ATTLVEGVPYVGLD--GSDVADASAR
SDHD_PHOPR       --MSTLNIQQLVTEFPLVEKLIALDDVSWFNPN-ITTLAEGLPYVGLD--KTDIKDASDR
SDHD_COLP3       --MNNDNIAQLIADFPLIEKMVELKEVSWFNPN-ITSLQEGLPYVGLD--NNNIQDASDR
SDHD_VIBCH       --MMTINIEQLTEQYPLVKELIELKEVSWFNPS-ITRLEEGLSYVGLG--SEDIQDASQR
SDHD_VIBPA       --MNKLNVEVLKKQFPLVEQLINLDEVCWFNPN-VTSLEEGLPHVGLN--AEDIHVASAR
SDHD_HAES1       -----MKIQHLMQD-PFIQKLMRFEEVMWFNPK-SAGVKTGLSYVGLD--VSDTQQAAER
SDHD_ACIAD       --MTTLNIQAIQQD-SLIKSLKNYEEIFWFQPE-PTPIEQGLKRTSLT--LADIQDAEAR
SDHD_PSEAE       -MILGTPKADWLAEFPRLADLIALRPSEWFNPA-IAPSAEALADVGLG--AADVADASAR
SDHD_PSEAB       -MILGTPKADWLAEFPRLADLIALRPSEWFNPA-IAPSAEALADVGLG--AADVADASAR
SDHD_CHRVO       -MIHGKTLAEWQQSHPEIRELTGLRECAWFNPA-AAPAAEALPDVGLG--AADIADASAR
SDHD_DESHY       ---MTGKSPEVIPHTPVVQDLRAAREIFWINPHYRATKEFKEAQFGIS--LSDIHDAEER
SDHD_FUSNN       -----MDIKNMIINNPLIKNMIDKKEVGWTNPK-EMNYTEYEKKLPLK--DQELKEAEER
SDHD_STAS1       ----MNDLATLKQDFPLIDSMQNYKPIFWENPN-----FRKPASLTFT--LKDMEDAAQR
SDHD_LACPL       -----MDTTVMIEEHPQIKELIAKRPIVWQNPD----YGKR-ADLPLT--RADIFDAVAR
SDHD_PEDPA       ----MIDVDALSKKYPAIKQMQAYEPIFWKNLN----YKKE-AELPVG--VEHIFDAEAR
SDHD_OENOB       -MTETLLKKKLNLNDQFLLNLKNYQEIFWKNPN----YGDELPDLDVN--RETIFQANRR
SDHD_BURPS       ----MPVGRSLSLDPNLLAQLQSHSPTLWLNPHQGMPLPDFAP------TAADLADADAR
SDHD_BURP1       ----MPVGRSLSLDPNLLAQLQSHSPTLWLNPHQGMPLPDFAP------TAADLADADAR
SDHD_BURTA       --MLMHDVRPLPLDPNLLAILQAGSPTLWLNPHQGEPLPDFAP------TAADLAEAGAR
SDHD_BURL3       --MRYRSMTVTLQPADLLARLQSRHPLLWLNPHAGSPLPHDAP------GPGAIATAEAR
SDHD_CUPPJ       -------MVTLSLTPELLAKLQSRQPLLWVNPRLGQPLPASAP------SLELIAAAEAR
SDHD_ACIAC       -MPGRTRPSCRLAITFTPRPDSATPRAGRAAPATGRRSNRSRSTLSATASPMPRRPHRIR
SDHD_ACISJ       -MPSVVSPQDHLQDDAPAAQLRRAEPCLWLNPHRQPIPAARQAVAGDHISLDDTEKAAAR
SDHD_POLNA       -MRSIQSPSSHAAEQESFFSLAALQVGLPLMWASPRPSPNLPDKEDSSIGSADVVRTGER
SDHD_HAHCH       -------MNPLSIAQDELKAIQSSQPIVWLNRNYQNPASAPATP-----NVDALYAAEAR
                                                                            *

SDHD_BACSK       LRRFAPYIASVFPETKGAGGLIESPLIDIPTMKHKLDQRFGQNVPGRLLLKGDHALPISG
SDHD_CARHZ       LQRFAPLIKKLFPETE--NGIIESPLAEIPRMKQEIEKLYGGKIHGRLFLKCDNYLKVAG
SDHD_BACCZ       LKRFASYIAKVFPETKETKGIIESPLLKIPSMKQALEKNYEQPILGELLLKCDSHLPISG
SDHD_BACHK       LKRFASYIAKVFPETKETKGIIESPLLKIPSMKQALEKNYEQPILGELLLKCDSHLPISG
SDHD_BACAH       LKRFASYIAKVFPETKETKGIIESPLLKIPSMKQALEKNYEQPILGELLLKCDSHLPISG
SDHD_BACAN       LKRFASYIAKVFPETKDTGGIIESPLVKIPSMKQSLEKNYEQPILGELLLKCDSHLPISG
SDHD_BACC1       LKRFAPYIAKVFPETKETNGIIESPLVKIPSMKQALEKNYEQPILGELLLKCDSHLPISG
SDHD_BACCR       LKRFAPYIAKVFPETKGANGIIESPLVKIPSMKEALERKYEQPILGELLLKCDSHLPISG
SDHD_BACHD       LDRFAPYIAKVFPGTNQAHGMIESPLVQIPSMKQSLEQKYLQPITGNLLLKCDSHLPISG
SDHD_GEOSE       LRRFAPYIAKAFPETRTAHGIIESPLVRISNMKQRLEKMFQTNIEGELLLKCDSHLPISG
SDHD_BACSU       MQRFAPYIAEVFPETKGAKGIIESPLFEVQHMKGKLEAAYQQPFPGRWLLKCDHELPISG
SDHD_ECOLI       LSRFAPYLAKAFPETAATGGIIESELVAIPAMQKRLEKEYQQPISGQLLLKKDSHLPISG
SDHD_SHISS       LSRFAPYLAKAFAETAATGGIIESELVAIPAMQKRLEKEYQQPISGQLLLKKDSHLPISG
SDHD_SHIFL       LSRFAPYLAKAFAETAATGGIIESELVAIPAMQKRLEKEYQQPISGQLLLKKDSHLPISG
SDHD_SHIF8       LSRFAPYLAKAFAETAATGGIIESELVAIPAMQKRLEKEYQQPISGQLLLKKDSHLPISG
SDHD_SHIDS       LSRFAPYLAKAFPETAATGGIIESELVAIPAMQKRLEKEYQQPISGQLLLKKDSHLPISG
SDHD2_ECOL5      LSRFAPYLAKAFPETAATGGIIESELVAIPAMQKRLEKEYQQPISGQLLLKKDSHLPISG
SDHD2_ECOUT      LSRFAPYLAKAFPETAATGGIIESELVAIPAMQKRLEKEYQQPISGQLLLKKDSHLPISG
SDHD_ECO57       LSRFAPYLAKAFPETAATGGIIESELVAIPAMQKRLEKEYQQPISGQLLLKKDSHLPISG
SDHD_ECOK1       LSRFAPYLAKAFPETAAAGGIIESELVAIPAMQKRLEKEYHQPIAGQLLLKKDSHLPISG
SDHD1_ECOUT      LSRFAPYLAKAFPETAAAGGIIESELVAIPAMQKRLEKEYHQPIAGQLLLKKDSHLPISG
SDHD1_ECOL5      LSRFAPYLAKAFPETAATGGIIESELVAIPAMQKRLEKEYHQPIAGQLLLKKDSHLPISG
SDHD_ECOL6       LSRFAPYLAKAFPETAAAGGIIESELVAIPAMQKRLEKEYQQPIAGQLLLKKDSHLPISG
SDHD_SALTY       LARFAPYLAKAFPQTAAAGGMIESDVVAIPAMQKRLEKEYGQTINGEMLLKKDSHLAISG
SDHD_SALCH       LARFAPYLAKAFPQTAAAGGMIESDVVAIPAMQKRLEKEYGQTIDGEMLLKKDSHLAISG
SDHD_SALPA       LARFAPYLAKAFPQTAAAGGMIESDVVAIPAMQKRLEKEYGQTIDGEMLLKKDSHLAISG
SDHD_SALTI       LARFAPYLAKAFPQTAAAGGIIESDVVAIPAMQKRLEKEYGQTIDGEMLLKKDSHLAISG
SDHD_PHOLL       LDRFASYLCKAFPETAVTHGIIESEIVAIPTMQKTLEQHYGVGITGRILLKKDSHLPISG
SDHD_YERE8       LQRFAPYLCQAFPETQKTKGIIESDIVAIPTMQNALQQRYGVAITGRLLLKKDSHLPISG
SDHD_AERHH       LARFAPYLCEAFPETRASKGILESDIAAIPAMQATLNQRYGVEVTGRLLLKKDSHLPISG
SDHD_PHOPR       LKRFAPYLAKAFPETAKTNGIIESDVVAIPAMKTVLEQQYHIAIQGTLLLKKDSHLPISG
SDHD_COLP3       LARFAPYMVKAFPETAITNGIIESDVVEISAMKSQLEQQYEVEIQGKLLLKKDSHLPISG
SDHD_VIBCH       LKRFAPYLAKAFPETAKTNGIIESEVVPISEMQSVLEREYDTPIQGRLLLKKDSHLPISG
SDHD_VIBPA       LKRFAPYLMKAFPETKAASGLIESPVVDIPKMKAALETQYNVPIFGRLMLKLDSHLPISG
SDHD_HAES1       LQRFAPYFCRAFPETQKTKGILESELVSIDKMKSALIDHYHMPIQGRLLLKKDSHLPISG
SDHD_ACIAD       LTRFAPYLEKVFPELRSTQGKIESEIVSIPTMQHDCSKRFAIEPNGTWWLKKDSHLPISG
SDHD_PSEAE       LQRFAPLIARLFPETAASGGIIESDLVEVATFHDALRQHYAAELPGRLWLKRDSHLPISG
SDHD_PSEAB       LQRFAPLIARLFPETAASGGIIESDLVEVAAFHDALRQHYAAELPGRLWLKRDSHLPISG
SDHD_CHRVO       LRRFAPYISRAFPETAASGGIIESPLLPVPAFQQALARRRGRELPGRLWLKADSHLPISG
SDHD_DESHY       LRRFAPYLAKAFPETQPAQGLIESPIVPIKRMQSYLESRYGVQIPGDIWLKCDHQLPISG
SDHD_FUSNN       LKRFAPFIKKVFPETEETYGIIESPLEEIFNMQKELEKKYHTEILGKLYLKMDSHLPVAG
SDHD_STAS1       LERFSSYISTVFPETENNHGLIESPLKHIPFMQNTLTNIESLPIEGKLWLKCDSHLAISG
SDHD_LACPL       WERFAPFLAVAFPETAAMNGIIESPLLPLEQMKPAWEALNHQSLAGQLYLKADSQLPISG
SDHD_PEDPA       FQRFAPYFEVAFPETLPTHGILESPLLKMDKMKAVLNAEAQNQVKGDLYLKADNYLPISG
SDHD_OENOB       LERFAPYLESVFSDTKRSKGIIESPIQRMDSIKDLL------SVKGSLLIKRDDLMPVSG
SDHD_BURPS       LRRCAGLLAELFAELRPSGGLIASPLQPAEPLKRAA--RAGHAQAGAWYVKRDDALPVAG
SDHD_BURP1       LRRCAGLLAELFAELRPSGGLIASPLQPAEPLKRAA--RAGHAQAGAWYVKRDDALPVAG
SDHD_BURTA       LHRCAGLLAELFPELRPLGGRIASPLQPAEPLK-----RADHAQAGAWFVKRDDALPVAG
SDHD_BURL3       LARCEPLMAELFPELATSAGKIESPLMPADNLQRTL--SLPADTHGAWFIKRDDALPIAG
SDHD_CUPPJ       LARCAPLMAALFPELASSHGQVESQLMPATGLQYAL--GEGAE--GAWFIKRDDQLPTAG
SDHD_ACIAC       SLGLLDRRDN-YLDMLRTGGGIESPLIEAGALSDAM--GLEPGC-GRLWIKADHGLPVAG
SDHD_ACISJ       FARFAPLLEGVFPELQATGGVIESPLLPASSLHAAA--GLVAGQ-GALWIKADHRLPVAG
SDHD_POLNA       LARFAPLLAQLFPELEAAGGIIESDLLAAPRLQEAL--NMPADT-GTLLVKADHALPIAG
SDHD_HAHCH       LKRFAPLLQRLFPELEPSHGLIESSLIQADRLNNRI--NPVGGL---LFLKADHDLPVAG
                            :       * : * :     :                 :* *  :  :*

SDHD_BACSK       SIKARGGIYEVLKHAESLLVDQQILTKQ---DDYSLIATDAVQSFFSSYAIVVGSTGNLG
SDHD_CARHZ       SIKARGGIYEVLKHAETLLLENGLITLE---DDYSKIAEERFKKFFSNYKVAVGSTGNLG
SDHD_BACCZ       SIKARGGIYEVLKHAEQLALQHGMLTEE---DDYSILDSDTCREFFATYSIAVGSTGNLG
SDHD_BACHK       SIKARGGIYEVLKHAEQLALQHGMLTEE---DNYAILDSDTCREFFATYSIAVGSTGNLG
SDHD_BACAH       SIKARGGIYEVLKHAEQLALQHGMLTEE---DDYSILDSDTCREFFAKYSIAVGSTGNLG
SDHD_BACAN       SIKARGGIYEVLKHAEQLALQQGMLTEE---DDYSILDSDTCREFFATYSIAVGSTGNLG
SDHD_BACC1       SIKARGGIYEVLKHAEQLALQYGMLTEE---DDYSILDSDTCREFFATYSIAVGSTGNLG
SDHD_BACCR       SIKARGGIYEVLKHAEQLALQHGMVTEE---DNYSVLDSDTCREFFSKYSIAVGSTGNLG
SDHD_BACHD       SIKARGGIYEVLKHAEQLALQHGLLTVQ---DDYSILDSETCRDFFANYSIAVGSTGNLG
SDHD_GEOSE       SIKARGGIYEVLKHAEDLALANGMITIG---DDYAVMDSEKFRQFFSRYSLVVGSTGNLG
SDHD_BACSU       SIKARGGIYEVLKYAENLALQEGMLQET---DDYRILQEERFTGFFSRYSIAVGSTGNLG
SDHD_ECOLI       SIKARGGIYEVLAHAEKLALEAGLLTLD---DDYSKLLSPEFKQFFSQYSIAVGSTGNLG
SDHD_SHISS       SIKARGGIYEVLAHAEKLALEAGLLTLD---DDYSKLLSPEFKQFFSQYSIAVGSTGNLG
SDHD_SHIFL       SIKARGGIYEVLAHAEKLALEAGLLTLD---DDYSKLLSPEFKQFFSQYSIAVGSTGNLG
SDHD_SHIF8       SIKARGGIYEVLAHAEKLALEAGLLTLD---DDYSKLLSPEFKQFFSQYSIAVGSTGNLG
SDHD_SHIDS       SIKARGGIYEVLAHAEKLALEAGLLTLD---ADYSKLLSPEFKQFFSQYSIAVGSTGNLG
SDHD2_ECOL5      SIKARGGIYEVLAHAEKLALEAGLLTLE---DDYSKLLSPEFKQFFSQYSIAVGSTGNLG
SDHD2_ECOUT      SIKARGGIYEVLAHAEKLALEAGLLTLE---DDYSKLLSPEFKQFFSQYSIAVGSTGNLG
SDHD_ECO57       SIKARGGIYEVLAHAEKLALEAGLLTLE---DDYSKLLSPEFKQFFSQYSIAVGSTGNLG
SDHD_ECOK1       SIKARGGIYEVLAHAEKLALEAGLLTLE---DDYSKLLSPEFKQFFSQYSIAVGSTGNLG
SDHD1_ECOUT      SIKARGGIYEVLAHAEKLALEAGLLTLE---DDYSKLLSPEFKQFFSQYSIAVGSTGNLG
SDHD1_ECOL5      SIKARGGIYEVLAHAEKLALEAGLLTLE---DDYSKLLSPEFKQFFSQYSIAVGSTGNLG
SDHD_ECOL6       SIKARGGIYEVLAHAEKLALEAGLLTLE---DDYSKLLSPEFKQFFSQYSIAVGSTGNLG
SDHD_SALTY       SIKARGGIYEVLTHAEKLALEAGLLTTD---DDYSVLLSPEFKQFFSQYSIAVGSTGNLG
SDHD_SALCH       SIKARGGIYEVLTHAEKLALEAGLLTTD---DDYSVLLSPEFKQFFSQYSIAVGSTGNLG
SDHD_SALPA       SIKARGGIYEVLTHAEKLALEAGLLTTD---DDYSVLLSPEFKQFFSQHSIAVGSTGNLG
SDHD_SALTI       SIKARGGIYEVLTHAEKLALEAGLLTTD---DDYSVLLSPEFKQFFSQYSIAVGSTGNLG
SDHD_PHOLL       SIKARGGIYEVLTHAEKLALQAGLLAEN---DDYSKLFSEELRRFFNQYSIAVGSTGNLG
SDHD_YERE8       SIKARGGIYEVLTHAEKLALQAGLLQET---DDYSKLFSDDFRQFFRQYRIAVGSTGNLG
SDHD_AERHH       SIKARGGIYEVLAHAEQLAIKAGLLCEE---DDYRKLFTDEFRHFFGQYSIAVGSTGNLG
SDHD_PHOPR       SIKARGGIYEVLTHAEKLAIQAGLLSES---DDYSKLFTDEFRAFFKQFSIAVGSTGNLG
SDHD_COLP3       SIKARGGIYEVLTHAEQLAIKAEVLELS---DDYSKLFTEEFKSFFSQYSIAVGSTGNLG
SDHD_VIBCH       SIKARGGIYEVLTHAEKLAIEAGLLTES---DDYSKLLNEEFRDFFKRFSIAVGSTGNLG
SDHD_VIBPA       SIKARGGIYEVLVHAEKLAIATGLLSES---DDYSKLLSGEFRQFFQQYSIAVGSTGNLG
SDHD_HAES1       SIKARGGIYEVLAYAEKLALEHHLITEN---DDYSQLCDEKIKDFFSRYSIAVGSTGNLG
SDHD_ACIAD       SIKARGGIYEVLAHAEKLALKAGLVTLQ---DNYSQLDSDQARQFFSNYQIAVGSTGNLG
SDHD_PSEAE       SIKARGGIYEVLAHAERLALEHGLVGLD---DDYSRLAEADCRAFFARHRIAVGSTGNLG
SDHD_PSEAB       SIKARGGIYEVLAHAERLALEHGLIGLD---DDYSRLAEADCRAFFARHRIAVGSTGNLG
SDHD_CHRVO       SIKARGGIYEVLKHAEDLALANGLLQPG---DDYARLASPEARSLFSRHGIAVGSTGNLG
SDHD_DESHY       SIKARGGIYEVLKHAEETLIKQGLLTRE---DDYARLKDSSFRDVLSHYKIAVGSTGNLG
SDHD_FUSNN       SIKARGGVYEVLKHAEELAMEAGLLKLE---DDYSILADKKFKDFFSKYKIQVGSTGNLG
SDHD_STAS1       SIKARGGIYEVLKLAETIAMQDGDLKET---ADYRVLAEQKYQDLFSKYNVAVGSTGNLG
SDHD_LACPL       SIKSRGGIYEVLKFAEQVAMAHTDLTYM---DDYSVLATAKYHELFAQYGVIVASTGNLA
SDHD_PEDPA       SIKSRGGIYEVLKFAEKVAMKHGEIVYG---DNYAKLNEPRFKDLFGQYGIVVGSTGNLG
SDHD_OENOB       SIKSRGGIYEVLCFAEKIAIENGFDLKK---DNYQDLRKDKYRKLFNQWRIEVASTGNLG
SDHD_BURPS       SIKARGGFHEVLALAESIAERHGLAGAD---TDRRALASGAARARFARHTVMVGSTGNLG
SDHD_BURP1       SIKARGGFHEVLALAESIAERHGLAGAD---TDRRALASGAARARFARHTVMVGSTGNLG
SDHD_BURTA       SIKARGGFHEVLALAESIAERHGLVSAG---ADRRALASGEAHALFARHTVMVGSTGNLG
SDHD_BURL3       SIKARGGFHEVLALAESIAIEHGLLEPA---GDRRILASAAARERFAAHTVIVGSTGNLG
SDHD_CUPPJ       SIKARGGFHEVLAIAESIAIEHGMLDPD---GDRRVLATEAARKLFSQYSVTVGSTGNLG
SDHD_ACIAC       SIKARGGIHEVLEFAETLAVREGLLSP---GQDCRVLAEPAAREVFGRHQVAVGSTGNLG
SDHD_ACISJ       SIKARGGIHEVLELAERLALQHGLLTPQSDADDYRALANPAARAVFARYTVAVGSTGNLG
SDHD_POLNA       SIKARGGIHEVLEHAETLALQHGLLASH--EADYRVLAEPTARALFSRHQIAVGSTGNLG
SDHD_HAHCH       SVKARGGIHEVLCFAESLALTHGVLKDV--DSDYCTLASQSARDLFSKHTITVGSTGNLG
                 *:*:***.:***  **                :   :        :    : *.*****.

SDHD_BACSK       LSIGIISAKLGFRVTVHMSDDAKQWKKDMLREKGVRVVEHSADYSKAVEEGRKESDADPN
SDHD_CARHZ       LSIGIMAAALGFKVDVHMSHDAKEWKKKILRDRGVNVIEYREDYSKAVEEGRKKAAAEKN
SDHD_BACCZ       LSIGIMSAKLGFNVTVHMSADAKQWKKDLLRSKGVNVIEYEADYSKAVEEGRRQADADPS
SDHD_BACHK       LSIGIMSAKLGFNVTVHMSADAKQWKKDLLRSKGVNVIEYEADYSKAVEEGRRQADADPS
SDHD_BACAH       LSIGIMSAKLGFNVTVHMSADAKQWKKDLLRSKGVNVIEYEADYSKAVEEGRRQADADPS
SDHD_BACAN       LSIGIMSAKLGFNVTVHMSADAKQWKKDLLRSKGVNVIEYEADYSKAVEEGRRQADADPS
SDHD_BACC1       LSIGIMSAKLGFNVTVHMSADAKQWKKDLLRSKGVNVIEYEADYSKAVEEGRRQADADPS
SDHD_BACCR       LSIGIMSANLGFNVTVHMSADAKEWKKDLLRSKGVNVIEYEDDYSKAVEEGRRQADADPS
SDHD_BACHD       LSIGIISAKLGFNVSVHMSADAKQWKKDLLRSKNVNVIEYEDDYSQAVEEGRREAEQDPT
SDHD_GEOSE       LSIGIIGAKLGFRVTVHMSADAKQWKKDLLRSKGVTVIEHLTDYNKVVEEARRQSAEDPT
SDHD_BACSU       LSIGIIGAALGFRVTVHMSADAKQWKKDLLRQKGVTVMEYETDYSEAVNEGRRQAEQDPF
SDHD_ECOLI       LSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPN
SDHD_SHISS       LSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPN
SDHD_SHIFL       LSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPN
SDHD_SHIF8       LSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPN
SDHD_SHIDS       LSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPN
SDHD2_ECOL5      LSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPN
SDHD2_ECOUT      LSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPN
SDHD_ECO57       LSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPN
SDHD_ECOK1       LSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPN
SDHD1_ECOUT      LSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPN
SDHD1_ECOL5      LSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPN
SDHD_ECOL6       LSIGIMSARIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEQDYGVAVEEGRKAAQSDPN
SDHD_SALTY       LSIGIMSACIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEDDYGVAVEQGRKAAQSDPN
SDHD_SALCH       LSIGIMSACIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEDDYGVAVEQGRKAAQSDPN
SDHD_SALPA       LSIGIMSACIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEDDYGVAVEQGRKAAQSDPN
SDHD_SALTI       LSIGIMSACIGFKVTVHMSADARAWKKAKLRSHGVTVVEYEDDYGVAVEQGRKAAQSDPN
SDHD_PHOLL       LSIGIASAKLGFNVSVHMSADAREWKKQKLRSHGVNVVEHELDYGVAVARGRKEAESAPN
SDHD_YERE8       MSIGIMSAKLGFSVSVHMSADAREWKKRKLREHGVNVVEYAQDYGVAVAQGRKQAESDPN
SDHD_AERHH       MSIGIMSARLGFRVTVHMSADAREWKKRKLRKHGAIVVEYAEDYGVAVEQGRKEAERDPN
SDHD_PHOPR       MSIGIMSAKIGFSVSVHMSADARQWKKDKLRSHGVIVVEYKEDYGVAVAQGRKEAEKDPT
SDHD_COLP3       MSIGIMSAKLGFSVSVHMSADARQWKKEKLRAHGVNVVEYNEDYSVAVEQGRQEAENDPK
SDHD_VIBCH       MSIGIMSAKLGFSVSVHMSADARAWKKNRLRALGVNVIEYAQDYGVAVAQGRKEAENDPT
SDHD_VIBPA       MSIGMMSAKLGFSVSVHMSADAREWKKNKLRSHGVNVVEYEQDYGVAVEQGRKQAESDPN
SDHD_HAES1       LSIGIMGAVLGFKVSVHMSADAREWKKQKLRSYGVNVVEYTQDYGVAVAQGRKAALSDPN
SDHD_ACIAD       LSIGIMSAKLGFRVSVHMSADARQWKKDKLRSLGVNVVEYASDYGVAVEQGRKAAESDPN
SDHD_PSEAE       LSIGIIGAALGFQASVHMSADARQWKKDKLRAHGVTVVEYASDYSVAVEQGRREAAGDPY
SDHD_PSEAB       LSIGIIGAALGFQASVHMSADARQWKKDKLRAHGVTVVEYASDYSVAVEQGRREAAGDPY
SDHD_CHRVO       LSIGIMAAKLGFQAAVHMSADARQWKKDKLRAHGVTVVEYQTDYSAAVARGREQAARDPD
SDHD_DESHY       LSIGVMGAELGFKVTVHMSADAKGWKKALLRSKGVEVIEYTSDYSKAVEEGRRQAEGDSR
SDHD_FUSNN       LSIGITSAALGFQVIVHMSADAKKWKKDMLRSKGVQVIEYESDYGKAVEEGRKNSDADPM
SDHD_STAS1       LSIGIMSAKLGFKVTVHMSTDARQWKKDLLRSRGVEVIEHQSDYQYAVAEGRKHAENDPT
SDHD_LACPL       LSVGIMAATFGFKTTVYMSHDARQWKKDKLRANGVTVEELNTDFSSVIPVARAAAAKDDH
SDHD_PEDPA       LSIGIVACKLGFRTSVHMSSDAAQWKKDMLREKGVNVVEYNDNFTHAITEARKSAEADPM
SDHD_OENOB       LSVGLMASTLGFKARIHMSHDATDWKINKLLQNGVEVKIYDDNFSNAVAAARVSSQRDPY
SDHD_BURPS       LSIGMLASALGFRTVVHMSADAKAWKKARLRTRGVEVVEHAGDYAKAVDAGRRQAAGMPC
SDHD_BURP1       LSIGMLASALGFRTVAHMSADAKAWKKARLRTRGVEVVEHAGDYAKAVDAGRRQAAGMPC
SDHD_BURTA       LSIGMLASALGFRTVVHMSADAKAWKRARLRTRGVDVVEHAGDYAKAVDAGRRQAAGMPR
SDHD_BURL3       LSIGVMASALGFESVVHMSTDAKPWKKARLRQRGVRVIEHDGDYAQAVAAGRAQARNQPR
SDHD_CUPPJ       LSIGVMAAALGFDAVVHMSADAKAWKKDRLRKRGVRVVEHEGDYAQAVAAGREQALGATR
SDHD_ACIAC       LSIGVAASALGFRAAVHMSADAKEWKKERLRRRGVEVVEHAGDYERAVAAGRSQAQADPF
SDHD_ACISJ       LSIGVAASALGFHAVVHMSADAKEWKKQRLRQRGVQVVEHAGDYEGAVAAGRAQAAQDPF
SDHD_POLNA       LAIGVMAAALGFQAVVHMSADAKEWKKERLRKRGVTVVEHAGDYAKAVAAGRAAAEADPR
SDHD_HAHCH       LSIGVIGSALGFKTVVHMSSDAKEWKMERLRKRGVRVVEHDADYGAALEAGRLETIADPC
                 :::*: .. :**    :** **  **   *   .. *     ::  .:  .*  :     

SDHD_BACSK       SYFIDDEHSIDLFVGYAVAAFRLKEQLQEKGIAVTKDQPLHVYLPCGVGGGPGGVAFGLK
SDHD_CARHZ       TYFIDDENSRDLFLGYSVAALRLKDQLTELGIEVNKENPLFVYLPCGVGGAPGGISFGLK
SDHD_BACCZ       CYFVDDENSHDLFLGYAVAASRLQKQLEELKIVVDEEHPLFVYLPCGVGGGPGGVAFGLK
SDHD_BACHK       CYFVDDENSHDLFLGYAVAASRLQKQLEELKIVVDEEHPLFVYLPCGVGGGPGGVAFGLK
SDHD_BACAH       CYFVDDENSHDLFLGYAVAASRLQKQLEELEIIVDEEHPLFVYLPCGVGGGPGGVAFGLK
SDHD_BACAN       CYFVDDENSHDLFLGYAVAASRLQKQLEELEIIVDEEHPLFVYLPCGVGGGPGGVAFGLK
SDHD_BACC1       CYFVDDENSHDLFLGYAVAASRLQKQLEELEIVVDEEHPLFVYLPCGVGGGPGGVAFGLK
SDHD_BACCR       CYFVDDENSHDLFLGYAVAASRLQKQLEELEVVVDENHPLFVYLPCGVGGGPGGVAFGLK
SDHD_BACHD       CYFVDDEQSQDLFLGYAVAAFRLKKQLAEQKITVDESHPLFVYLPCGVGGAPGGITFGLK
SDHD_GEOSE       SYFIDDENSIHLFLGYAVAAFRLKKQLEDMNITVDENHPLFVYLPCGVGGGPGGVTFGLK
SDHD_BACSU       CYFIDDEHSRQLFLGYAVAASRLKTQLDCMNIKPSLETPLFVYLPCGVGGGPGGVAFGLK
SDHD_ECOLI       CFFIDDENSRTLFLGYSVAGQRLKAQFAQQGRIVDADNPLFVYLPCGVGGGPGGVAFGLK
SDHD_SHISS       CFFIDDENSRTLFLGYSVAGQRLKAQFAQQGRIVDADNPLFVYLPCGVGGGPGGVAFGLK
SDHD_SHIFL       CFFIDDENSRTLFLGYSVAGQRLKAQFAQQGRIVDADNPLFVYLPCGVGGGPGGVAFGLK
SDHD_SHIF8       CFFIDDENSRTLFLGYSVAGQRLKAQFAQQGRIVDADNPLFVYLPCGVGGGPGGVAFGLK
SDHD_SHIDS       CFFIDDENSRTLFLGYSVAGQRLKAQFAQQGRIVDADNPLFVYLPCGVGGGPGGVAFGLK
SDHD2_ECOL5      CFFIDDENSRTLFLGYSVAGQRLKAQFAQQGRIVDADNPLFVYLPCGVGGGPGGVAFGLK
SDHD2_ECOUT      CFFIDDENSRTLFLGYSVAGQRLKAQFAQQGRIVDADNPLFVYLPCGVGGGPGGVAFGLK
SDHD_ECO57       CFFIDDENSRTLFLGYSVAGQRLKAQFAEQGRIVDADNPLFVYLPCGVGGGPGGVAFGLK
SDHD_ECOK1       CFFIDDENSRTLFLGYSVAGQRLKAQFAQQGRIVNADNPLFVYLPCGVGGGPGGVAFGLK
SDHD1_ECOUT      CFFIDDENSRTLFLGYSVAGQRLKAQFAQQGRIVNADNPLFVYLPCGVGGGPGGVAFGLK
SDHD1_ECOL5      CFFIDDENSRTLFLGYSVAGQRLKAQFAQQGRIVNADNPLFVYLPCGVGGGPGGVAFGLK
SDHD_ECOL6       CFFIDDENSRTLFLGYSVAGQRLKAQFAQQGRIVDADNPLFVYLPCGVGGGPGGVAFGLK
SDHD_SALTY       CFFIDDENSRTLFLGYAVAGQRLKAQFAQQGRVVDASHPLFVYLPCGVGGGPGGVAFGLK
SDHD_SALCH       CFFIDDENSRTLFLGYAVAGQRLKAQFAQQGRVVDASHPLFVYLPCGVGGGPGGVAFGLK
SDHD_SALPA       CFFIDDENSRTLFLGYAVAGQRLKAQFAQQGRVVDASHPLFVYLPCGVGGGPGGVAFGLK
SDHD_SALTI       CFFIDDENSRTLFLGYAVAGQRLKAQFAQQGRVVDASHPLFVYLPCGVGGGPGGVAFGLK
SDHD_PHOLL       CFFIDDENSQTLFLGYSVAGGRVKAQFEQMNIVVDEDHPLFVYLPCGVGGGPGGVAFGLK
SDHD_YERE8       CFFIDDENSPTLFLGYSVAGDRLKQQFAEQQIVVDENHPLFVYLPCGVGGGPGGVAFGLK
SDHD_AERHH       CFFIDDENSRTLFLGYAVAGERVKKQFDDMGIVVDADHPLFVYLPCGVGGGPGGVAFGLK
SDHD_PHOPR       CFFIDDENSPTLFLGYSVAGERLKSQFEAMNILVDELHPLFVYLPCGVGGGPGGVAFGLK
SDHD_COLP3       CFFIDDENSQTLFLGYSVAGERLKQQFDAMHIVVDENNPLFVYLPCGVGGGPGGVAFGLK
SDHD_VIBCH       CFFIDDENSQTLFLGYSVAGERLKKQFDEKGIVVDAQHPLFVYLPCGVGGGPGGVAFGLK
SDHD_VIBPA       CFFIDDENSQTLFLGYSVAGERLKQQFDDLGIVVDERHPLFVYLPCGVGGGPGGVAFGLK
SDHD_HAES1       CFFIDDENSTTLFLGYSVAGQRLKQQFLEQGIKVDENHPLFVYLPCGVGGGPGGVAFGLK
SDHD_ACIAD       CFFIDDENSTTLFLGYAVAGLRLKQQLIDQNIQVDAEHPLFVYLPCGVGGGPGGVSFGLK
SDHD_PSEAE       THFVDDENSRDLFLGYAVAAERLRGQLDAAGIRVDSEHPLFVHLPCGVGGGPGGVAFGLK
SDHD_PSEAB       THFVDDENSRDLFLGYAVAAERLRGQLDAAGIRVDSEHPLFVHLPCGVGGGPGGVAFGLK
SDHD_CHRVO       CHFVDDENSIHLFLGYAVAAERLKAQLAEAGVRVDADHPLFVYLPCGVGGGPGGVAFGLK
SDHD_DESHY       CHFIDDENSRDLFLGYAVAGLRLKEQLEKLNRKVDADHPLFVYLPCGVGGGPGGVTFGLK
SDHD_FUSNN       SYFVDDEKSMNLFLGYTVAASRIKKQFDKKGIVINKEHPLIVYIPCGVGGAPGGVAYGLK
SDHD_STAS1       CHFVDDEGSSDLFLGYTVAALRLKAQLAAENIQIDAEHPLFVYIPCGVGGGPGGVTFGLK
SDHD_LACPL       THFVDDEGSRDLFLGYAVAGVRLQHQLKVQGIKMDAAHPVVVYLPAGVGGSPSGVAFGLK
SDHD_PEDPA       AYFIDDEGSYDLFLGYSVAAVRLQAQLKAQNIKVDAEHPLFVYLPAGVGGSPSGVAFGLK
SDHD_OENOB       SYFIDDEGSKLLFAGYATAGERVKKQLSKMQIEVSKEHPLVVYLPAGVGGSPSGVAFGLK
SDHD_BURPS       CHFVDDEGSRMLFLGYATAAAELAAQLAQAGRPVDARHPLFVHLPCGVGGAPGGIVYGLK
SDHD_BURP1       CHFVDDEGSRMLFLGYATAAAELAAQLAQAGRPVDARHPLFVHLPCGVGGAPGGIVYGLK
SDHD_BURTA       CHFVDDEGSRMLFLGYATAAAELAAQLAQAGRPVDARHPLFVHLPCGVGGAPGGIAYGLK
SDHD_BURL3       SHFVDDEGSLMLFLGYAASARHLAAQLAEAGRRVDATHPLFVHIPCGVGGAPGGIAHGLK
SDHD_CUPPJ       CHFVDDERSALLFFGYAAAARHLARQLAEAGRVVDAAHPLFVYLPCGVGGAPGGITYGLK
SDHD_ACIAC       SHFVDDERSLSLLLGYSAAALHLRGQLAEQGIVVDAKHPLFVYLPCGVGGAPAGITFGLR
SDHD_ACISJ       SHFVDDERSLSLLLGYSAAALHLRQQLRDAGIVVDAQHPLFVYLPCGVGGAPAGITFGLR
SDHD_POLNA       CHFVDDERSLSLLLGYAAAAPRLARQLVAQGRRVDAEHPLFVYLPCGVGGAPGGIALGLS
SDHD_HAHCH       GYFVDDERSPNLFMGYAVAAKRLQAQLEALNIKVDADHPLFVYLPAGVGGAPGGITYGLK
                  .*:*** *  *: **:.:. .:  *:           *: *::*.****.*.*:  ** 

SDHD_BACSK       LVFGDAVRCFFAEPTHSPCMLIGMLTGK------HQHISVQDFGIDNQTAADGLAVGRPS
SDHD_CARHZ       TIFKDDVYCYFVEPTHSPCMLLGLVTQK------FSAIHVRDFGLDNITEADGLAVGSPS
SDHD_BACCZ       LLYKDNVHCFFAEPTHSPCMLIGLMTGL------HDKIAVQDIGIDNVTDADGLAVGRPS
SDHD_BACHK       LLYKDNVHCFFAEPTHSPCMLIGLMTGL------HDKIAVQDIGIDNVTDADGLAVGRPS
SDHD_BACAH       LLYKDNVHCFFAEPTHSPCMLIGLMTGL------HDKIAVQDIGIDNVTDADGLAVGRPS
SDHD_BACAN       LLYKDNVHCFFAEPTHSPCMLIGLMTGL------HDKIAVQDIGIDNVTDADGLAVGRPS
SDHD_BACC1       LLYKDNVHCFFAEPTHSPCMLLGLMTGL------HDKIAVQDIGIDNVTDADGLAVGRPS
SDHD_BACCR       LLYKDNVHCYFAEPTHSPCMLLGLMTGL------HDKISVQDIGIDNVTDADGLAVGRPS
SDHD_BACHD       LLFEDHVHCFFAEPTHSPSMLLGLLTGL------HERISVQEIGLDNRTEADGLAVGRPS
SDHD_GEOSE       LVYGDHVHCFFAEPTHSPCMLLGLMTGE------HDRVSVQDFGLDNKTEADGLAVGRPS
SDHD_BACSU       LLYGDDVHVFFAEPTHSPCMLLGLYSGL------HEKISVQDIGLDNQTAADGLAVGRPS
SDHD_ECOLI       LAFGDHVHCFFAEPTHSPCMLLGVHTGL------HDQISVQDIGIDNLTAADGLAVGRAS
SDHD_SHISS       LAFGDHVHCFFAEPTHSPCMLLGVHTGL------HDQISVQDIGIDNLTAADGLAVGRAS
SDHD_SHIFL       LAFGDHVHCFFAEPTHSPCMLLGVHTGL------HDQISVQDIGIDNLTAADGLAVGRAS
SDHD_SHIF8       LAFGDHVHCFFAEPTHSPCMLLGVHTGL------HDQISVQDIGIDNLTAADGLAVGRAS
SDHD_SHIDS       LAFGDHVHCFFAEPTHSPCMLLGVHTGL------HDQISVQDIGIDNLTAADGLAVGRAS
SDHD2_ECOL5      LAFGDHVHCFFAEPTHSPCMLLGVHTGL------HDQISVQDIGIDNLTAADGLAVGRAS
SDHD2_ECOUT      LAFGDHVHCFFAEPTHSPCMLLGVHTGL------HDQISVQDIGIDNLTAADGLAVGRAS
SDHD_ECO57       LAFGDHVHCFFAEPTHSPCMLLGVHTGL------HDQISVQDIGIDNLTAADGLAVGRAS
SDHD_ECOK1       LAFGDHVHCFFAEPTHSPCMLLGVHTGL------HDQISVQDIGIDNLTAADGLAVGRAS
SDHD1_ECOUT      LAFGDHVHCFFAEPTHSPCMLLGVHTGL------HDQISVQDIGIDNLTAADGLAVGRAS
SDHD1_ECOL5      LAFGDHVHCFFAEPTHSPCMLLGVHTGL------HDQISVQDIGIDNLTAADGLAVGRAS
SDHD_ECOL6       LAFGDHVHCFFAEPTHSPCMLLGVHTGL------HDQISVQDIGIDNLTAADGLAVGRAS
SDHD_SALTY       LAFGDNVHCFFAEPTHSPCMLLGVYTGL------HDAISVQDIGIDNLTAADGLAVGRAS
SDHD_SALCH       LAFGDNVHCFFAEPTHSPCMLLGVYTGL------HDAISVQDIGIDNLTAADGLAVGRAS
SDHD_SALPA       LAFGDNVHCFFAEPTHSPCMLLGVYTGL------HDAISVQDIGIDNLTAADGLAVGRAS
SDHD_SALTI       LAFGDNVHCFFAEPTHSPCMLLGVYTGL------HDAISVQDIGIDNLTAADGLAVGRAS
SDHD_PHOLL       LAFGDHVHCIFAEPTHSPSMLLGVYTGL------HDNICVQDIGIDNITAADGLAVGRAS
SDHD_YERE8       LAFGDHVHCIFAEPTHSPCMLLGVYTGL------HDGIAVQDIGIDNITAADGLAVGRAS
SDHD_AERHH       LAFGDNVHCLFAEPTHSPCMLLGVHTGL------HDAIAVQDLGIDNLTAADGLAVGRAS
SDHD_PHOPR       MAFGDNVHCIFAEPTHSPCMLLGIHTGL------HDEISVQDIGIDNITAADGLAVGRGS
SDHD_COLP3       MAFGDNVHCIFAEPTHSPCMLLGILTGL------HDGIAVQDIGIDNITAADGLAVGRAS
SDHD_VIBCH       MAFGDNVHCIFAEPTHSPCMMLGVHTGL------HDAISVQDIGIDNITAADGLAVGRAS
SDHD_VIBPA       VAFGDHVHCIFAEPTHSPCMLLGVHTGL------HDEIAVQDIGIDNLTAADGLAVGRPS
SDHD_HAES1       LAFGDYVHCIFAEPTHSPCMLLGVYTGL------HDKIAVQDLGIDNITAADGLAVGRAS
SDHD_ACIAD       HALGEHVHCIFAEPTHSPCMLLGVYTGL------HDQICVADIGLDNATAADGLAVGRAS
SDHD_PSEAE       LAFGDAVHCLFAEPTHSPCMFLGVYTGR------HEQVSVQDFGIDNRTAADGLAVGRPS
SDHD_PSEAB       LAFGDAVHCLFAEPTHSPCMFLGVYTGR------HEQVSVQDFGIDNRTAADGLAVGRPS
SDHD_CHRVO       QAFGDAVHCLFAEPTRSPCMLLGVLTGL------HDKVSVQDFGIDNRTVADGLAVGRPS
SDHD_DESHY       QVFQEHVHCFFAEPTHSPCMVLGLATGL------HDGIAVQDIGLDNKTEADGLAVGRAS
SDHD_FUSNN       RIFKENVYIFFVEPVLAPCMLLGMQTGL------HEKISVYDVGIHGITHADGLAVARPS
SDHD_STAS1       QVFGEHVYCIFTEPTHAPCMLLGMMTQL------HDKISVKDIGIDGNTDADGLAVARPS
SDHD_LACPL       MIMGANIYPVFCEPTHVPSVTLGMMTKL------NEKIAVQDIGLDGLTAADGLAVSRPS
SDHD_PEDPA       KIIGENVHPIFAEPTHIPSVSLGMMTGL------NDQISVYDAGIDGVTKADGLAVGRPS
SDHD_OENOB       LQFADAVIPIFVEPTHMPSVLLGMASGL------NHDISVYDIGIDGKTAADGLAVGRPS
SDHD_BURPS       ALYGEHVHAFVAEPTASPCVLVQLAGDA------AHPRSVYDIGLDNRTEADGLAVAQAS
SDHD_BURP1       ALYGEHVHAFVAEPTASPCVLVQLAGDA------AHPRSVYDIGLDNRTEADGLAVAQAS
SDHD_BURTA       ARYGEHVHVFVAEPTASPCVLVQLASGG------AHPVSVYDVGLDNRTEADGLAVAQAS
SDHD_BURL3       ALFGEHVHCFFAEPVASPCMLVQLAAGL------GKPVSVYDVGLDNRTEADGLAVAQAS
SDHD_CUPPJ       ALLGDHVHCFFAEPVASPCVLVQLASGS------DDPVSVYDIGLDNRTDADGLAVGQAS
SDHD_ACIAC       QLLGPHVHCFFAEPVQSPCFLVQMAAPA------GTHPSVYDLGLTNRTEADGLAVPRAS
SDHD_ACISJ       QVLGAHVHCFFAEPVQSPCFMVQMMAGQ------GAHPSVYDWGLTNRTEADGLAVPRAS
SDHD_POLNA       QIYGEHVHCFFAEPTRSPCFLVQMLAGTPELAHLGAHPSVYDLGLDNRTEADGLAVPRAS
SDHD_HAHCH       HIFNDHVHCFFAEPVQSPCMLLGMAGAPG-----AAPTSIYELDLKNRTDADGLAVGAAS
                       :   . **.  *.. : :               : : .: . * ******   *

SDHD_BACSK       GFVGRMMAPLLEGIYTIADPMLYTLLADLADAEGLYLEPSAVAGLYGPVQLE--------
SDHD_CARHZ       KLVAEIANILIDGIYTIEDEELFKLLALLKDSENIKVEPSAAASLKGPLLVN--------
SDHD_BACCZ       GFVGKTMEPFLSGNYTVSDEELYRLLKELADTENIYLEPSALAGMIGPVKVCKE---DAY
SDHD_BACHK       GFVGKTMEPFLSGNYTVSDEELYRLLKELADTENIYLEPSALAGMIGPVKVCKE---DAY
SDHD_BACAH       GFVGKTMEPFLSGDYTVSDEELYRLLKELADTENIYLEPSALAGMIGPVRVCKE---DAY
SDHD_BACAN       GFVGKTMEPFLSGNYTVSDEELYRLLKELADTENIYLEPSALAGMIGPVKVCKE---DAY
SDHD_BACC1       GFVGKTIEPFLSGNYTVSDEELYRLLKELADTEKIYLEPSALAGMIGPVKVCAE---DEY
SDHD_BACCR       GFVGKTMEPFLSGNYTVSDEELYRLLKELADTENIYLEPSALAGMIGPVKVCKE---DEY
SDHD_BACHD       RLVSRLMKPLLSGSFTIDDDKLFTLLKELADAEGLFLEPSALAGMLGPIKLVQEG--NHY
SDHD_GEOSE       RLVGNMLENVISGVYTVDDSTLYRLLAAMVETEEIYLEPSALAGVAGPVRLFRDLAGQTY
SDHD_BACSU       GFVGKLIEPLLSGCYTVEDNTLYTLLHMLAVSEDKYLEPSALAGMFGPVQLFSTEEGRRY
SDHD_ECOLI       GFVGRAMERLLDGFYTLSDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRVC---ASVSY
SDHD_SHISS       GFVGRAMERLLDGFYTLSDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRVC---ASVSY
SDHD_SHIFL       CFVGRAMERLLDGFYTLSDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRVC---ASVSY
SDHD_SHIF8       GFVGRAMERLLDGFYTLSDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRVC---ASVSY
SDHD_SHIDS       GFVGRAMERLLDGFYTLSDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRVC---ASVSY
SDHD2_ECOL5      GFVGRAMERLLDGFYTLSDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRVC---ASVSY
SDHD2_ECOUT      GFVGRAMERLLDGFYTLSDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRVC---ASVSY
SDHD_ECO57       GFVGRAMERLLDGFYTLSDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRVC---ASVSY
SDHD_ECOK1       GFVGRAMERLLDGFYTLSDQTMYDMLSWLAQEEGIRLEPSALAGMAGPQRVC---ASVSY
SDHD1_ECOUT      GFVGRAMERLLDGFYTLSDQTMYDMLSWLAQEEGIRLEPSALAGMAGPQRVC---ASVSY
SDHD1_ECOL5      GFVGRAMERLLDGFYTLSDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRVC---ASVSY
SDHD_ECOL6       GFVGRAMERLLDGFYTLSDQTMYDMLGWLAQEEGIRLEPSALAGMAGSQRVC---ASVSY
SDHD_SALTY       GFVGRAMERLLDGLYTLDDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRIC---ASVAY
SDHD_SALCH       GFVGRAMERLLDGLYTLDDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRIC---AAVAY
SDHD_SALPA       GFVGRAMERLLDGLYTLDDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRIC---AATEY
SDHD_SALTI       GFVGRAMERLLDGLYTLDDQTMYDMLGWLAQEEGIRLEPSALAGMAGPQRIC---ASVAY
SDHD_PHOLL       GFVGRAMERLLDGFYTVQDQEMYNLLGLLDRDEGIRLEPSALVGMAGPARVS---GNLDY
SDHD_YERE8       GFVGRAMEHLLDGFYTLSDAEMYDLLGLLNQYEGIRLEPSALAGMPGPARVS---SSLDY
SDHD_AERHH       GFVGRAMERLLAGFYTLSDQEMYDLLGLLARAEQIKLEPSALAGMAGPWRVA---ANLEW
SDHD_PHOPR       GFVGRAMERLLDGFYTISDERMYHHLGEMSKYEDIQLEPSALAGMLGPVVVS---DNEEY
SDHD_COLP3       GFVGRAMERLLDGFYTISDQRMYDLLGLLNKVEGIQLEPSALAGMLGPIVVT---NNDEY
SDHD_VIBCH       GFVGRAMERLLDGYLTISDERMYRLLGQLNEAENIQLEPSALAGMIGPIVVT---KSVEY
SDHD_VIBPA       GFVGRAMERLIDGYYTVTDERMYQLLGELSEREGINLEPSALAGMMGAVHVS---GSLHY
SDHD_HAES1       GFVGRAMEHLLDGFYTIEDQKLYDLLGLLHKTENIQLEPSALAGMIGPLHIN---HS-DY
SDHD_ACIAD       GFVGRAMQDLIDGYYTISDQHLFEFIRLMDQTQSIQLEPSAVAGVLGIYHVN---TNKSY
SDHD_PSEAE       GFVGRAMQRLLDGYYTVDDDELFRLLALLERSQGIRLEPSALAGATGIARVTR--EPQGY
SDHD_PSEAB       GFVGRAMQRLLDGYYTVDDDELFRLLALLERSQGIRLEPSALAGAPGIARVTR--EPQGY
SDHD_CHRVO       GFVGRAMQRLIDGYYTVDDDELFRLLAMLEQTEGLRLEPSALAGAPGIARVLE--ENQGY
SDHD_DESHY       RFVGKIMAGLLSGAFTVEDAELFRLLQALDHAEGIQCEPSALAGMAGPARLLLCKEGLQY
SDHD_FUSNN       GLVGRLMEPILSGIFTVDDYKLYDYLRILNETENKRIEPSSCAAFEGVVSLLKYEDSKKY
SDHD_STAS1       RLVGQIMNTLLYGIQTVSDSEMYRYLYLLSEKEDIFIEPSAASGFAGIKSAI--------
SDHD_LACPL       RLAGKVMRTLLLGTATFEDDDLYRYLTKLVDTEDVIVEPSAAAGFTAIAPIM--------
SDHD_PEDPA       RIAGKMMDTLLYGIQTFDDQKMMKNVAELHDSENVDVEPSAASGFTILDDVQ--------
SDHD_OENOB       MIAGKYMKDKLFGIATVSDSDMFAYQGMLKKLENIEVEPSAAVGIRGL--IQ--------
SDHD_BURPS       PLAAALLRAQAAGAFTVDDRQLFAHLLDARERLGIDLEPSAAAAFGGPAWIAGSDAGRAY
SDHD_BURP1       PLAAALLRAQAAGAFTVDDRQLFAHLLDARERLGIDLEPSAAAAFGGPAWIAGSDAGRAY
SDHD_BURTA       HLAGPLLRAQAAGVFTVDDRQLFAHLLDARERLGIDLEPSAAAAFGGPAWLAGSEAGRAY
SDHD_BURL3       HLVSPLMASLLSGVFTVSDAQLYAQLLAVQHATGVELEPSAAAAVGGPGWLTRSPAGRDY
SDHD_CUPPJ       HLVSPLMASQLAGVFTVPDDQLYVQLLALKTSMGVEVEPSAAAGIGGPGWLRDSPEGRAY
SDHD_ACIAC       LLAAGLMQPLLSGIFTVRDDTLFEHLVRVLDATGERIEPSAAAGFSGPALLTGSDGGRLW
SDHD_ACISJ       LPAAELMEPLLAGCFTVCDDTLFRQLVQVLDATGERIEPSAAAGLSGPGFLTGTETGRTW
SDHD_POLNA       VLAAEVVRPFLAGVYTVNDEALFRHLHLAATTEGFRIEPSAAACLPGPAMLMGTAEGRAY
SDHD_HAHCH       QWVCDATRNLLSGVYTATDEQLYQQLYLLKDLENIEVEPSAAIGCLGPAMLT-SEAGQKY
                   .         *  *  *  :               ***:                   

SDHD_BACSK       -----KRGLYTDAATHLVWATGGSMVPKEIMETDYQLGVNLRTEQ--------
SDHD_CARHZ       -----SR----ANAIHISWATGGIFIPEEIYREMYMRGKSYLKDVY-------
SDHD_BACCZ       LQKQQL-MEKVQKGTHIVWGTGGSMVPEDVMNGYYKTGEALTILEK-------
SDHD_BACHK       LQKQQL-MEKVQKGTHIVWGTGGSMVPEDVMNGYYKTGEALTILEK-------
SDHD_BACAH       LQKQQL-MEKVQKGTHIVWGTGGSMVPEDVMNGYYKTGEALTILEK-------
SDHD_BACAN       LQEQQL-MEKMKKGTHIVWGTGGSMVPEDVMNGYYKTGEALTILEK-------
SDHD_BACC1       LQKQQL-TEKMKKGTHIVWGTGGSMVPEDVMNGYYKKGLELIL----------
SDHD_BACCR       LQKLQL-TEKVKKGTHIVWGTGGSMVPNDTMDEYYRKGLELTI----------
SDHD_BACHD       LKANNL-AEKMNNATHIIWGTGGSMVPEEEMMAYYRRGGTIK-----------
SDHD_GEOSE       VEANGL-KEKMKNATHIGWATGGSMVPKDVMEAYYREGVRIETMTGNGFSEGR
SDHD_BACSU       AQKY-----KMEHAVHVVWGTGGSMVPKDEMAAYNRIGADLLKKRNEK-----
SDHD_ECOLI       QQMHGFSAEQLRNTTHLVWATGGGMVPEEEMNQYLAKGR--------------
SDHD_SHISS       QQMHGFSAEQLRNTTHLVWATGGGMVPEEEMNQYLAKGR--------------
SDHD_SHIFL       QQMHGFSAEQLRNATHLVWATGGGMVPEEEMNQYLAKGR--------------
SDHD_SHIF8       QQMHGFSAEQLRNATHLVWATGGGMVPEEEMNQYLAKGR--------------
SDHD_SHIDS       QQMHGFNAEQLHNATHLVWATGGGMVPEEEMNQYLAKGR--------------
SDHD2_ECOL5      QQMHGFSAEQLRNATHLVWATGGGMVPEEEMEQYLAKGH--------------
SDHD2_ECOUT      QQMHGFSAEQLRNATHLVWATGGGMVPEEEMEQYLAKGH--------------
SDHD_ECO57       QQMHGFSAEQLRNATHLVWATGGGMVPEEEMEQYLAKGR--------------
SDHD_ECOK1       QQMHGFSAEQLRNATHLVWATGGGMVPEEEMNQYLAKGR--------------
SDHD1_ECOUT      QQMHGFSAEQLRNATHLVWATGGGMVPEEEMNQYLAKGR--------------
SDHD1_ECOL5      QQLHGFSAEQLRNATHLVWATGGGMVPEEEMNQYLAKGR--------------
SDHD_ECOL6       QQMHGFSAEQLRNATHLVWATGGGMVPEEEMNQYLAKGR--------------
SDHD_SALTY       QQRHGFSQTQLGNATHLVWATGGGMVPEDEMEQYLAKGR--------------
SDHD_SALCH       QQRHGFSQTQLGNATHLVWATGGGMVPEDEMEQYLAKGR--------------
SDHD_SALPA       QQRHGFSQTQLGNATHLVWATGGGMVPEDEMEQYLAKGR--------------
SDHD_SALTI       QQRHGFSQTQLGNATHLIWATGGGMVPEDEMEQYLAKGR--------------
SDHD_PHOLL       LNNKNLSAEKMKQATHLVWATGGGMVPDDEMTKYLATAKI-------------
SDHD_YERE8       LEQNHFSVEKMRNATHLVWATGGGMVPVEEMEKYLATAKI-------------
SDHD_AERHH       QASQGLNAAKMVRATHLVWATGGGMVPAEEMENYLASAHR-------------
SDHD_PHOPR       LQRIQMDEQKLKNATHLVWATGGGMVPSEEMASYLAKSGI-------------
SDHD_COLP3       LKRINMSNEKLVNATHLIWATGGGMVPAIEMEKYLSKAGS-------------
SDHD_VIBCH       RARMQFDDTVMGNATHLVWATGGGMVPAEEMDSYLKNR---------------
SDHD_VIBPA       QTRLQLTDERLKNATHLVWATGGGMVPEAEMSADLAKSGR-------------
SDHD_HAES1       LRRYHITQEQLANATHIVWATGGGMVPDVEMQKYLSLGRF-------------
SDHD_ACIAD       QQAYHLNAIQLKNATHLIWATGGGMVPPNEMQKYLKQCE--------------
SDHD_PSEAE       RERMGLTSARLANATHLVWATGGGMVPETEMRAYLERGRSLLD----------
SDHD_PSEAB       RERMGLTSARLANATHLVWATGGGMVPETEMRAYLKRGRSLLD----------
SDHD_CHRVO       RQRMGLDADRLACATHLIWATGGSMVPEAEMDGYLRRGRALLG----------
SDHD_DESHY       IREHRL-EEGLKRGTHLIWATGGSLVPVEVMKDYLSRGK--------------
SDHD_FUSNN       IENR--IGKNINNVYHVCWATGGKMVPQEDMEIFLNTYLK-------------
SDHD_STAS1       -TLAKQQGIQMNQANHIVWATGGNMVPKEEMLKYVNHGKSCL-----------
SDHD_LACPL       --AQF-PTLAGKDVTHIVWATGGDMMPESERQLDYELGQKLLTKINNR-----
SDHD_PEDPA       --AQLEQDYPMENASHIVWATGGSMVPKND--MDQYVAEGHQVK---------
SDHD_OENOB       --SKE-ISEIPDSATHMVWATGGSMVPKNTMHKYEDKAVRIFNTWKSE-----
SDHD_BURPS       LRGR---GIDPDAATHVIWATGGSLVPAQEHRRFQAHARAQRQVGGAGA----
SDHD_BURP1       LRGR---GIDPDAATHVIWATGGSLVPAQEHRRFQAHARAQRQVGGAGA----
SDHD_BURTA       LRGR---GIVPEAATHVIWATGGSLVPAEEHRRFQARACAQRRESGAGA----
SDHD_BURL3       VHRH---AIDLRQSTHVIWATGGSLVPPEEHRRFQSHAKALAGAAAGT-----
SDHD_CUPPJ       VRDH---GLDMRDATHVIWATGGSLVPREELHRFQAYATALAHVPGAMHKAA-
SDHD_ACIAC       LRAQGL-DVQLPQATHLVWTTGGLFVPEAEHQRFEARGRSLLEAAA-------
SDHD_ACISJ       LHAQGL-WPHLAQATHLVWTTGGLYVPPEAYARFEERGRALG-----------
SDHD_POLNA       LQREQL-EHHMARSTHIAWTTGGLFVPDDEYARFRVRGALTS-----------
SDHD_HAHCH       LDSHRL-SHRMENSVHIPWLTGGSFVPDEEYQRYLAKAVNVST----------
                                *: * ***  :*