CLUSTAL format seed alignment for MF_01031

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LEUD_LACLA       ---MEKFTIYKGTSVPVMNDNIDTDQIIPKQFLKAIDKKGFGKNLFYEWRYLKD------
LEUD_STRGN       ---MEKFTIYTGTTVPLMNDNIDTDQILPKQFLKLIDKKGFGKYLMYAWRYLDNQ-----
LEUD_LISMO       ---MEEIKVHIGKTVALMNDNIDTDQIIPKSFLKRIERTGFGEFLFDSWRYLPN------
LEUD_STAAW       MAAIKPITTYKGKIVPLFNDNIDTDQIIPKVHLKRISKSGFGPFAFDEWRYLPD------
LEUD_BACSU       ---MEPLKSHTGKAAVLNRINVDTDQIIPKQFLKRIERTGYGRFAFFDWRYDAN------
LEUD_BACHD       ---MEPLKTHTGTIAVLDRVNVDTDQIIPKQFLKRVERTGFGQFLFFDWRFLPN------
LEUD_AZOVI       ---MKAFTQHTGLVAPLDRANVDTDQIIPKQFLKSIKRTGFGPNLFDEWRYLDVGQPGQD
LEUD_PSEAE       ---MKPYTQTTGLVAPLDRANVDTDQIIPKQFLKSIKRTGFGPNLFDEWRYLDVGQPGQD
LEUD_XANCP       ---MTPFTQHTGLVAPLDRANVDTDQIIPKQFLKSIKRTGFGPNLFDEWRYLDIGEPGRD
LEUD_XYLFA       ---MKPFTQHTGLVCPLDRVNVDTDQIIPKQFLKSIKRTGFGPNLFDEWRYLDAGQPGQD
LEUD_NEIMB       ---MKAFTKITAIVAPLDRSNVDTDAIIPKQFLKSIKRSGFGPNAFDEWRYLDHGEPGMD
LEUD_RALSO       ---MEQFTIHTGLVAPLDRENVDTDAIIPKQFLKSIKRTGFGPNLFDEWRYKDVGEPGQD
LEUD_BUCAP       ---MFKFIEHTGVVVPLNISNIDTDAIIPKQFLKKVNKIGFGKYLFHDWRFLDK------
LEUD_BUCRP       ---MFKFTEHNGVVAPLNISNIDTDAIIPKQFLQKVNKIGFGKYLFHDWRFIDK------
LEUD_BUCAI       ---MFKFTGHAGIVVPLDISNIDTDIIIPKQFLKRVNKIGFGKYLFHDWRFIDA------
LEUD_BUCDN       ---MLKFIEHTGVVAPLDISNVDTDAIIPKQFLKGINKKGFGKFLFHDWRYLDS------
LEUD_BUCPP       ---MFKFTQHNGIVMPLDIANIDTDIIIPKQFLQKVNKLGFGKYLFHNWRFIDE------
LEUD_BUCPS       ---MTLLNQYTGIVIPINISNIDTDVIIPKQFLKKINKKGFGKYLFYNWRFNDN------
LEUD_BUCTS       ---MNIPPIYTGSIVPLDISNIDTDAIIPKEFLQKVTKTGFGKHLFNNWRYTDH------
LEUD_CAMJE       ---MQKFIIHKGIACPLEYANIDTDQIIPKQFLLAVSKQGFGKHLFHDLRYLDD------
LEUD_ECOLI       --MAEKFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDE------
LEUD1_SALTY      --MAEKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLDE------
LEUD_YERPE       ---MAKFIQHIGLVAPLDAANVDTDAIIPKQFLQKVTRTGFGQHLFNDWRFLDD------
LEUD_PASMU       --MPKEFKQHTGIAVPLDASNVDTDAIIPKQFLQKVTRIGFGQHLFHEWRFLDD------
LEUD_VIBCH       ---MSGFQQHTGLVVPLDAANVDTDAIIPKQFLQKVNRTGFGKHLFHDWRFLDD------
LEUD_HAEIN       ---MAGFKQLSGLVVPLDAANVDTDAIIPKQFLQAITRIGFGKHLFHEWRYLDV------
LEUD_AGRFC       ---MEKFTKLTGVAAPMPVVNIDTDMIIPKDYLKTIKRTGLGKGLFAESRYLED------
LEUD_RHIME       ---MDKFVKLTGVAAPLPVVNIDTDMIIPKDYLKTIKRTGLGTGLFAEARYNED------
LEUD_BRUME       ---MDKFTKLTGVAAPLPIVNIDTDMIIPKDYLKTIKRTGLGKGLFAEMRFNED------
LEUD_RHILO       ---MEKFTKLTGVAAPMPIVNVDTDMIIPKDYLKTIKRTGLGTGLFAEMRYNDD------
LEUD_METEA       ---MEKFTTLEGVAAPMRIINIDTDRIIPKQYLKTIKRTGLGQGLFSEMRYNDD------
LEUD_CAUVC       ---MKAFTRLDGRAAPLELANIDTDQIIPKQFLKTVEREGLAKGLFYDFRFDAD------
LEUD_MYCLE       ---MQAFRVHTGIGVPLRRSNVDTDQIIPAVFLKRVTRNGFEDGLFATWR-VDP------
LEUD_MYCTU       ---MEAFHTHSGIGVPLRRSNVDTDQIIPAVFLKRVTRTGFEDGLFAGWR-SDP------
LEUD_CORGL       ---MEKFTTYTGVGVPLQRSNVDTDQIIPAVYLKRVTRTGFEDGLFSNWRQNDP------
LEUD_STRCO       ---MEAFTKHTGRAVPLRRSNVDTDQIIPAHWLKKVTRDGFEDGLFEAWR-KDP------
LEUD_CUPNE       ---MEPFTMHRGVAAPLLRINIDTDAIIPSREMKRVSRHGLAEGLFAGWRYLAGTD----
LEUD2_SALTY      ---MDTFKQISGRIAPMLEPNIDTDVIMPKQFLKGIDRQGLDKGVFFDRRFMAG------
LEUD_SYNY3       ---MSQVKQIQGKALPLVGDDIDTDRIIPARFLRCVTFDGLGEHVFADDRQQQG------
LEUD_NOSS1       --MVSEVREVTGRAIPLVGNDIDTDRIIPARYLKAITFDGLREGAFIDDRTALK------
LEUD_THET8       --MLEKFTVIRGKAVPLRGEDIDTDRILPARFMKVLTFEGLGQYLFYDERFDEK------
                            .    :   ::*** *:*   :  :   *     :   *          

LEUD_LACLA       ---YDENPDFILNAPKYKKASLLISGDNFGSGSSREHAAWALSDYGFRAIIAGSYSDIFY
LEUD_STRGN       ---YTEDPDFVFNRPEYRKATILITGDNFGAGSSREHAAWALADYGFKVVIAGSFGDIHY
LEUD_LISMO       ---RKPNPDFPLNALDRQEATILITGENFGCGSSREHAAWALLDYRFRVIIAGSYSDIFY
LEUD_STAAW       ---GSDNPDFNPNKPQYKGASILITGDNFGCGSSREHAAWALKDYGFHIIIAGSFSDIFY
LEUD_BACSU       ---GEPNPEFELNQPVYQGASILIAGENFGCGSSREHAPWALDDYGFKIIIAPSFADIFH
LEUD_BACHD       ---GEDNPDFELNQPHAKQGTILVAGHNFGCGSSREHAPWAIKDYGFRVVIAPSFADIFY
LEUD_AZOVI       CSARPLNTGFVLNLPRYQGASVLLARENFGCGSSREHAPWALDEYGFRTVIAPSFADIFF
LEUD_PSEAE       NSKRPLNPDFVLNQPRYQGASVLLARENFGCGSSREHAPWALDEYGFRTVIAPSYADIFF
LEUD_XANCP       NSTRPLNQEFVLNFPRYQGASVLLARENFGCGSSREHAPWALDEYGFRAVIAPSFADIFY
LEUD_XYLFA       NSKRPINSDFVLNFPRYRGASVLLARDNFGCGSSREHAAWALDEYGFRTVIAPSFADIFF
LEUD_NEIMB       NSKRPLNPDFSLNQPRYQGAQILLTRKNFGCGSSREHAPWALDDYGFRAVIAPSFADIFF
LEUD_RALSO       NSKRPLNPDFVLNQPRYQGASVLLARKNFGCGSSREHAPWALQQYGFRAIIAPSFADIFF
LEUD_BUCAP       -NQLKINPNFILNKSTYKNASILLTRENFGCGSSREHAVWSLLDYGFKVIIASSFSDIFY
LEUD_BUCRP       -NQLKINPNFILNNYVYKNASILLTRENFGCGSSREHAVWSLLDYGFKVIISSSFSDIFF
LEUD_BUCAI       -NQLVKNEDFILNKKIYKNASILLTRENFGCGSSREHAVWSLVDYGFKVIIAPSFADIFY
LEUD_BUCDN       -NQLKINNKFILNKKIYENASILLTKKNFGCGSSREHAVWSLLDYGFKVIVASSFSDIFY
LEUD_BUCPP       -NQSQINPNFILNIEKYKKSSILLTRDNFGCGSSREHAVWALLDYGFKVIIAPSFSDIFY
LEUD_BUCPS       -EGKNINKNFILNDLRYKKSSILLTRDNFGCGSSREHAVWALMDYGFKVIIASSFGDIFY
LEUD_BUCTS       -NNKILNPDFNLNKPCYRESTILLTRDNFGCGSSREHAVWALLDYGIKIIISSSFSDIFY
LEUD_CAMJE       -KESVLNMDFNLNKKEYQNSSILVSFENFGSGSSREHAPWALVDYGIRAIIAPSFADIFK
LEUD_ECOLI       -KGQQPNPDFVLNFPQYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFY
LEUD1_SALTY      -KGQQPNPEFVLNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFY
LEUD_YERPE       -AGKVPNPDFVLNLPRYQGATILLARENFGCGSSREHAPWALTDFGFKVVIAPSFADIFY
LEUD_PASMU       -EGKQPNPDFVLNYPRYQGASILLARENFGCGSSREHAPWALDDYGIRVIIAPSFADIFY
LEUD_VIBCH       -AGEKANPEFVMNQPRYQDASILLARENFGCGSSREHAPWALADYGIRVMIAPSFADIFY
LEUD_HAEIN       -EGTKPNPEFVLNYPQYQGATILLARKNLGCGSSREHAPWALADYGFKVMIAPSFADIFY
LEUD_AGRFC       ---GSPNPDFVLNKPAYQNAQILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFADIFY
LEUD_RHIME       ---GTPNPDFVLNKPAYQNAKILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFADIFY
LEUD_BRUME       ---GSENPDFVLNKPGYRKAQILVAGDNFGCGSSREHAPWALLDYGIRCVISTSFADIFY
LEUD_RHILO       ---GSENPDFVLNKPAYRKAQILVAGDNFGCGSSREHAPWALLDFGIRCVISTSFADIFY
LEUD_METEA       ---GSEYPDFVLNQPAYRHAKTLVVGDNFGCGSSREHAPWALADFGIRCVISTSFADIFF
LEUD_CAUVC       ---GNEISDFVLNKPEYKSASVLIAGDNFGCGSSREHAPWALMDFGIMCVISTSFADIFN
LEUD_MYCLE       --------SFVLNLSPFDRGSVLVVGPDFGIGSSREHAVWALMDYGFRVVISSRFGDIFH
LEUD_MYCTU       --------AFVLNLSPFDRGSVLVAGPDFGTGSSREHAVWALMDYGFRVVISSRFGDIFR
LEUD_CORGL       --------NFVLNTDTYKNGSVLVAGPDFGTGSSREHAVWALMDYGFRAVFSSRFADIFR
LEUD_STRCO       --------EFVLNRPEREGATVLVAGPDFGTGSSREHAVWALQNYGFKTVVSSRFADIFR
LEUD_CUPNE       ---RSPDPLFVLNQPEYTGASILLAGSNFGCGSSREHAVWALKEFGIRAIVAPGFGAIFH
LEUD2_SALTY      ---GQPNPDFILNMPGWQSATFLLVGPNFGCGSSREHAVWGLKQLGVRGLIGSTFAGIFD
LEUD_SYNY3       ---GN----HPFDLSQYQDATVLVVNRNFGCGSSREHAPQAIIKWGIKAIIGESFAEIFL
LEUD_NOSS1       ---GA----HPFDQPQYQDANILIVNRNFGCGSSREHAPQALSKWGIQAVIGESFAEIFF
LEUD_THET8       ---GNPK-PHPLNDPRYRGATILLVESGFGSGSSREHAPQAIKRAGFKAIIGESFAEIFF
                          .  :      .  *:   .:* *******  .:    .  :..  :. *. 

LEUD_LACLA       NNALKNGLLPIKQPREVLNQLTKLSS-QE---EITIDLPHQLIITSLG-DFHFEIDPIWK
LEUD_STRGN       NNELNNGMLPIVQPLEVRQALANLKP-TD---QVTVDLEQQKIFSPVG-EFSFDIDGEWK
LEUD_LISMO       MNCTKNGVLPIVLPREAREKLAKIAA-EE---NVTIDLPNQQVISSVG-TYPFEIDATWK
LEUD_STAAW       MNCTKNAMLPIVLEKNAREHLAKYV-------EIEVDLPNQTVSSPDK-RFHFEIDETWK
LEUD_BACSU       QNCFKNGMLPIRMPYDNWKQLVGQYE-NQSL-QMTVDLENQLIHDSEGNQISFEVDPHWK
LEUD_BACHD       NNCFKNGILPVKLKQEEVTALMEKGK-DTAY-SLTVNLEAQTVTSEDGFEATFEIDGYWK
LEUD_AZOVI       NNSFKNGLLPIILPEAEVDELFRQCESTEGY-RLTVDLAAQTVTRPDGKALSFEIDPFRK
LEUD_PSEAE       NNSFKNGLLPIILPEAEVDELFRQVEANEGY-QLSIDLAAQTVTRPDGKVLGFEVDPFRK
LEUD_XANCP       NNSFKNGLLPIVLAEAEMDALFEQCLGNEGY-QLTVDLAAQRVRRPDGVEYAFEIDAFRK
LEUD_XYLFA       NNSFKNGLLPLVLNKVEVDALFAQCQVTEGY-TLTVDLAAQQVITQDGTTYAFQIDTFRK
LEUD_NEIMB       NNCYKNGLLPIVLTEERVDRLFKEVEANEGY-QLSIDLAEQTLTTPSGETFTFDITEHRK
LEUD_RALSO       NNCFKNGLLPIVLTESQVDHLFNETQAFTGY-QLTVDLDKQVVVTPGGTAYPFDVTAFRK
LEUD_BUCAP       SNSFNNKLLLIVLENEDIDYLFDLVNTKIGL-SFNVSLIHKKITVDN-LDIPFQIDDFQR
LEUD_BUCRP       NNSFNNKLLLVVLEKKHIDYLFNLVDTKIGI-SFNVSLINKKITAGD-LDIPFQIDDFQR
LEUD_BUCAI       NNSFNNKLLLITLSSSEITFLFDIVKNNIGI-TFDVSLVEKTVTVNK-EVFSFELDDFHY
LEUD_BUCDN       NNSFNNKLLLITLDEKKIDSIFDIVKKNLGI-NISINLLTNKVIINQ-KTFFFKLDEFRR
LEUD_BUCPP       NNSFNNKLLLITLPNNQIDKFFNIINQNPGI-YFNIDLLKNEIKVEK-KIYSFQIDKFRR
LEUD_BUCPS       NNCLNNHLIPIILSENKINTLFDITSNYIDV-SFTIDLKNNTILAKN-YAYYFKIDALHK
LEUD_BUCTS       TNSFNNQLLLITLDKTTIDLFFNLIKKNKIN-EITVDLIENYVFFEK-KRYYFYLSNFHR
LEUD_CAMJE       NNALGNGLLTIELAKDEVLEIVDELKKSQDK-NIEISLLEKRVFFKD-KIFSFDLDDFHR
LEUD_ECOLI       GNSFNNQLLPVKLSDAEVDELFALVKANPGI-HFDVDLEAQEVKAGE-KTYRFTIDAFRR
LEUD1_SALTY      GNSFNNQLLPVTLSDAQVDELFALVKANPGI-KFEVDLEAQVVKAGD-KTYSFKIDDFRR
LEUD_YERPE       GNAFNNQLLPVTLSEADIDTLFQLVKENEGI-EFVVDLEQQTVNAGG-KSYAFEIDPFRR
LEUD_PASMU       GNSLNNQMLPIRLSDEEVEELFQFVNANEGA-TITVDLETQRVSANN-KVYSFEIDPFRR
LEUD_VIBCH       GNSINNQMVPVRLTEQEVDELFTYVHDTEGA-TITVDLEALSVTANG-KTYHFEIDDFRR
LEUD_HAEIN       NNSLNNHMLPIRLSEEEVEEIFQWVWANEGK-QIHVDLEAMTVTVGD-KVYTFELDEFRR
LEUD_AGRFC       NNCFKNGILPVVVSPENLEKLLDDASRGSNA-VLSIDLERQEISGPDGGTITFEIDEFKR
LEUD_RHIME       NNCFKNGILPIVVSQEDLDKLMDDASRGSNA-ILTVDLEAQEITGPDGGSIKFEVDAFKR
LEUD_BRUME       NNCFKNGILPIKVAQEDLDKLMDDASRGANA-TLTIDLETKQIHGPDGGTISFDLDDFKR
LEUD_RHILO       NNCFKNGVLPITVSPEDLEKLMDDASRGSNA-TLSVDLEAKEIRGPDGGVVKFDLDDFKR
LEUD_METEA       NNCAKNGILAIVVSPEDLEKLFQDAERGANA-TLTIDLAAQTIKGPDGGTLHFDIDEGRK
LEUD_CAUVC       NNCFNNGLLPVVVSPEDLALLMDEAK-GGNH-MVSVDLEAQTVISPSGKTIGFDIDPVRK
LEUD_MYCLE       GNAGKAGLLAAQVAQDDVEFLWKLIEQKPGL-EITVNLQDRNINAAT-VVLPFKIDDYTA
LEUD_MYCTU       GNAGKAGLLAAEVAQDDVELLWKLIEQSPGL-EITANLQDRIITAAT-VVLPFKIDDHSA
LEUD_CORGL       GNSGKAGMLTGIMEQSDIELLWKLMEQTPGL-ELTVNLEKQIVTAGD-VVISFEVDPYIR
LEUD_STRCO       GNSLKNGLLTVVLDQKTVDALWELVERDPQA-EITVDLEAREVRAEG-VTASFELDENSR
LEUD_CUPNE       NNCVRNGLLPVVLPMATVQALADDCAAAPATRQVTVDLRQLEVVSPAGARYGFTLGSEQR
LEUD2_SALTY      DNCQRNGILTVSLDEPALARLAQLAASADTN-SITVSLDRCEITTAE-ETISFVISELKR
LEUD_SYNY3       GNCLANGVPCVTAPHGQIADLQQAITADPN-LAVNLDLTTAAVTYGD-RSFPVILSDGAQ
LEUD_NOSS1       GNCVAIGVPCVTADEAIVKQLQELVAANPQ-ANVSINLETLQVQVGD-FIAPISIGEGTR
LEUD_THET8       GNATAIGLPCVSLAPEDLGVLFRSVEENPE-LEVEIDLVNKEVRFGD-RTAPLFIREEAR
                  *     :            :            .  .*    :         . :     

LEUD_LACLA       DKLINGLDDIGITLQ-YEEAISAYE---QKNQ------------
LEUD_STRGN       HKLLNGLDDIGITLL-YEDLIAEYE---KNRPSYWQ--------
LEUD_LISMO       NKFINGLDDIAITFE-HIDAIKAYE---QKVDSI----------
LEUD_STAAW       NKLVNGLDDIAITLQ-YESLIEKYE---KSL-------------
LEUD_BACSU       EMLINGYDEISLTLL-LEDEIKQFE---SQRSSWLQA-------
LEUD_BACHD       EMLINGWDEIGLTLR-YEEQIKQFE---ASRV------------
LEUD_AZOVI       HCLLNGLDDIGLTLR-DADAIRVFEEKHRQASPWLFGAIK----
LEUD_PSEAE       HCLLNGLDDIGLTLQ-DADAIRAFEDGYRQQQPWLFR-------
LEUD_XANCP       HCLLNGLDDIGLTLQ-DADAIGRFEQGHRAQQPWLFGALQ----
LEUD_XYLFA       HCLLNGLDDIGLTLQ-HAEAIRVFEAAHRIRQPWLFAPLH----
LEUD_NEIMB       HCLLNGLDEIGLTLQ-HADEIHAFEEKRRQSQPWLFNG------
LEUD_RALSO       YCLLNGFDDIGLTLR-YADQIKAYEAQRLAKMPWLAHKLVG---
LEUD_BUCAP       LCLVNNWDNNDLTMK-IDHKIKLYE---KNIFSFLLKREKFTS-
LEUD_BUCRP       LCLLNNWDNIDLTMK-INHKIKSYE---DNISSFLLERQEFTS-
LEUD_BUCAI       FCLLNDLDNIDLTMK-HLSEIKSYE---SRISDFLLERRDFQS-
LEUD_BUCDN       VCFLNDIDHIDLTMN-SLKKINVYE---NNIPFFLLNRKEFKSH
LEUD_BUCPP       FCLLNGLDDIDLTLK-NIEKIDSYE---KKICNFLIKRKKFVS-
LEUD_BUCPS       FCIMHQLDQIDLTMK-NEKKITKYE---KKIFDFFIKK------
LEUD_BUCTS       MCILNGLDEIDFTLQ-HYKKIKKYG---NQIPNFFVYNSIS---
LEUD_CAMJE       ICLLEGLDNIALTLK-HEAQIKAYE---KNSKSFLV--------
LEUD_ECOLI       HCMMNGLDSIGLTLQ-HDDAIAAYE---AKQPAFMN--------
LEUD1_SALTY      HCMLNGLDSIGLTLQ-HEDAIAAYE---NKQPAFMR--------
LEUD_YERPE       HCMINGLDSIGLTLQ-HEHNISAYE---KQQPEFLR--------
LEUD_PASMU       HCLLNGLDNIGLTLQ-HEAKIAEYE---SNIPAFLR--------
LEUD_VIBCH       HCLLNGLDNIGLTLQ-HEAKIAEYE---AKIPSFLK--------
LEUD_HAEIN       HCLLNGLDNIGLTLQ-HEDKISAYE---KNIPAFLR--------
LEUD_AGRFC       HCMLNGLDDIGLTLE-HAGAIDTFEKANASVRPWA---------
LEUD_RHIME       HCLLNGLDDIGLTLE-KGGSIDNYEKATAASRPWA---------
LEUD_BRUME       HCLLNGLDDIGLTME-KAKSIDTFEAKNAEERPWA---------
LEUD_RHILO       HCMLNGLDDIGLTME-KAGAIASFEKKNAEQRPWA---------
LEUD_METEA       HNLLNGLDEIGLTLDQKAPAIDAYEAKLA-QREWA---------
LEUD_CAUVC       EKMLKGLDAIGETMM-HGGDIDLFESKRAISQPWLEA-------
LEUD_MYCLE       WRLLEGLDDIALNLR-KLDEIEAFE---SARPAWKPRTLPTT--
LEUD_MYCTU       WRLLEGLDDIALTLR-KLDEIEAFE---GACAYWKPRTLPAP--
LEUD_CORGL       WRLMEGLDDAGLTLR-KLDEIEDYE---AKRPAFKPRTNA----
LEUD_STRCO       WRLLNGLDDISITLQ-NEADIAAYE---AKRPSFKPQTVQV---
LEUD_CUPNE       QMLLEGLDPIALTLK-LASSIDAFQGADRLRRPWIHFDG-----
LEUD2_SALTY      AMLAAGEDAIAWTLQ-YLPEIENFEVAHYSRRPWLKRPASPRG-
LEUD_SYNY3       QMLLDGQWDTCGQLVQNQGKIAATA----EKLPYLHWQTSAA--
LEUD_NOSS1       STFITGAWDACGQLVANTEQVRVTA----AKLPYVSWGKLAAS-
LEUD_THET8       EALVEGLWDPIGELLEAGELLDQFD----RKLPYPRRTE-----
                   :          :      :