CLUSTAL format seed alignment for MF_01034

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A0A0T9XIN0_SALET      ---------MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQVGFDSQKLHRLDGWIQNQI
YFEW_SALTI            ---------MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQVGFDSQKLHRLDGWIQNQI
G5LRY9_SALET          ---------MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQVGFDSQKLHRLDGWIQNQI
YFEW_SALTY            ---------MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQVGFDSQKLHRLDGWIQNQI
YFEW_SALCH            ---------MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQVGFDSQKLHRLDGWIQNQI
YFEW_SALPK            ---------MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQVGFDSQKLHRLDGWIQNQI
G5Q5Y7_SALMO          ---------MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQVGFDSQKLHRLDGWIQNQI
A0A3V8D6Q9_SALET      ---------MKFTLVATVLLTFSLSAFAVEYPVLTTASPDQVGFDSQKLHRLDGWIQNQI
YFEW_SALEP            ---------MKFTLVATVLLTFSLSAFAVEYPVLTIASPDQVGFDSQKLHRLDGWIQNQI
YFEW_SALG2            ---------MKFTLVATVLLTFSLSAFAVEYPVLTIASPDQVGFDSQKLHRLDGWIQNQI
A0A379R010_SALER      ---------MKFTIVAAVLLTFSISAFAVEYPVLTTASPDQVGFDSKKLNRLDDWIQNQI
A0A7U6BHI3_SALER      ---------MKLTIVAAVFLTFSISAFAVEYPVLTNTSPEQVGFDSKKLNRLDGWIQNQI
A0A0K0HD44_SALBC      ---------MKSTIVTVALLTFSISAFAVEYPVLTTASPDLVGFDSHKLNRLDGWIQNQI
E3GAL8_ENTLS          ---------MKKSMTLVSLLALSISAFAAEYPVLTTAGPDTVGFDLKKLNKLDDWIQNQI
A0A7G3EWK9_ENTCL      ---------MKRHAFFASLLALSASVFANNYPVLTNAQPESVGFNIDKLKKLDSWIQDQI
A0A2P5GK56_9ENTR      MSIYVKGLAMKLTPLLAVFFAVVLPAQAADTAPLTVASPESVGFDSQKLHRLESWIQQQV
A8ADF7_CITK8          ---------MKMTLLFASLLALSCTASAAPFPVLTDAAPEKAGFNIERLNALDNWIAQQV
A9MID6_SALAR          ---------MNIKLLFASLLAFSCAASATSYPVLTESTPEKVGLNIERLNRLESWIAQQV
B7LCH4_ECO55          ---------MKRTMLYLSLLAVSCSVSAAKYPVLTESSPEKAGFNVERLNQMDRWISQQV
B6I506_ECOSE          -------------MLYLSLLAVSCSVSAAKYPVLTESSPEKAGFNVERLNQMDRWISQQV
B3WY65_9ENTR          ---------MKRTMLYLSLLAVSCSVSAAKYPVLTESSPEKAGFNVERLNQMDRWISQQV
YFEW_ECOLI            ---------MKRTMLYLSLLAVSCSVSAAKYPVLTESSPEKAGFNVERLNQMDRWISQQV
S1DC98_ECOLX          ---------MKRTMLYLSLLAVSCSVSAAKYPVLTESSPEKAGFNVERLNQMDRWISQQV
B1LMM4_ECOSM          ---------MKRTMLYLSLLAVSCSVSAAKYPVLTESSPEKAGFNVERLNQMDRWISQQV
D8AES5_ECOMS          ---------MKRTMLYLSLLAVSCSVSAAKYPVLTESSPEKAGFNVERLNQMDRWISQQV
M9H2B6_ECOLX          ---------MKRTMLYLSLLAVSCSVSAAKYPVLTESSPEKAGFNVERLNQMDRWISQQV
F0JUG7_ESCFE          -------------MLCLSLLAVSCSVSAAKYPVLTESSPEKAGFNVERLNQMDRWISQQV
B7LKK5_ESCF3          ---------MKRTMLYFSLLAVSCSVSAAKYPVLTESSPEKAGFNVERLNQMDRWISQQV
                                        :::.  .. *   . ** : *: .*:: .:*: :: ** :*:

A0A0T9XIN0_SALET      DAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNF
YFEW_SALTI            DAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNF
G5LRY9_SALET          DAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNF
YFEW_SALTY            DAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNF
YFEW_SALCH            DAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNF
YFEW_SALPK            DAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNF
G5Q5Y7_SALMO          DAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNF
A0A3V8D6Q9_SALET      DAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNF
YFEW_SALEP            DAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNF
YFEW_SALG2            DAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLAHPIRATTNTMYDLASNTKMYATNF
A0A379R010_SALER      DAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLANPIRATTNTMYDLASNTKMYATNF
A0A7U6BHI3_SALER      DAGYPSINLLVIKDNHIVLQKAWGYAKKYDGSTLLANPILATTNTMYDLASNTKMYATNF
A0A0K0HD44_SALBC      DAGYPSINLLVIKDNHIVMQKAWGYAKKYEGSTLLADPILATTTTMYDLASNTKMYATNF
E3GAL8_ENTLS          SAGYPSINLLIVKDNHIVYQKAWGYAKKYEGSLLMAAPISATTATMYDLASNTKMFATNF
A0A7G3EWK9_ENTCL      NAGYPGMNVVVIKDNHIVFQKAWGYAKKYDDSHLMGNPLRATTETMYDLASNTKMYATNF
A0A2P5GK56_9ENTR      DAGYPGMNVLILKDNHIVLQKAWGYAKKYEGSTLLSTPVKATPETLYDLASNTKMYATNF
A8ADF7_CITK8          DAGYPSVNLLIIKDSHIVYRKAWGQAKKYDGSVLMSHPIKATTDTLYDLASNTKMYATNF
A9MID6_SALAR          DAGYPSVNLLIIKDNHIVYRKAWGDAKKYDGNTLMRQPIKATTETLYDLASNSKMYATNF
B7LCH4_ECO55          DAGYPGVNLLIIKDNQIVYRKAWGAAKKYDGSVLMEQPVKATTGTLYDLASNTKMYATNF
B6I506_ECOSE          DAGYPGVNLLIIKDNQIVYRKAWGAAKKYDGSVLMEQPVKATTGTLYDLASNTKMYATNF
B3WY65_9ENTR          DAGYPGVNLLIIKDNQIVYRKAWGAAKKYDGSVLMEQPVKATTGTLYDLASNTKMYATNF
YFEW_ECOLI            DVGYPSVNLLIIKDNQIVYRKAWGAAKKYDGSVLMEQPVKATTGTLYDLASNTKMYATNF
S1DC98_ECOLX          DAGYPGVNLLIIKDNQIVYRKAWGAAKKYDGSVLMAQPIKATTGTLYDLASNTKMYATNF
B1LMM4_ECOSM          DAGYPGVNLLIIKDNQIVYRKAWGAAKKYDGSALMAQPVKATTGTLYDLASNTKMYATNF
D8AES5_ECOMS          DAGYPGVNLLIIKDNQIVYRKAWGAAKKYDGSALMAQPVKATTGTLYDLASNTKMYATNF
M9H2B6_ECOLX          DDGYPGVNLLIIKDNQIVYRKAWGAAKKYDGSVLMAQPVKATTGTLYDLASNTKMYATNF
F0JUG7_ESCFE          DDGYPGVNLLIIKDNQIVYRKAWGAAKKYDGSVLMAQPVKATTGTLYDLASNTKMYATNF
B7LKK5_ESCF3          DAGYPGVNLLIIKDNQIVYRKAWGAAKKYDGSVLMAQPVKATTETLYDLASNTKMYATNF
                      . ***.:*::::**.:** :**** ****:.. *:  *: **. *:******:**:****

A0A0T9XIN0_SALET      ALQKLVYEGKIDVNDLVSKYIPGFKDMPGDKIKGKDKLRIIDILHHVAGFPADPQYPNKN
YFEW_SALTI            ALQKLVYEGKIDVNDLVSKYIPGFKDMPGDKIKGKDKLRIIDILHHVAGFPADPQYPNKN
G5LRY9_SALET          ALQKLVYEGKIDVNDLVSKYIPGFKDMPGDKIKGKNKLRIIDILHHVAGFPADPQYPNKN
YFEW_SALTY            ALQKLVYEGKIDVNDLVSKYIPGFKDMPGDKIKGKNKLRIIDILHHVAGFPADPQYPNKN
YFEW_SALCH            ALQKLVYEGKIDVNDLVSKYIPGFKDMPGDKIKGKDKLRIIDILHHVAGFPADPQYPNKN
YFEW_SALPK            ALQKLVYEGKIDVNDLVSKYIPGVKDMPGDKIKGKDKLRIIDILHHVAGFPADPQYPNKN
G5Q5Y7_SALMO          ALQKLVYEGKIDVNDLVSKYIPGFKDMPGDKIKGKDKLRIIDILHHVAGFPADPQYPNKN
A0A3V8D6Q9_SALET      ALQKLVYEGKIDVNDLVSKYIPGFKDMPGDKIKGKDKLRIIDILHHVAGFPADPQYPNKN
YFEW_SALEP            ALQKLVYEGKIDVNDLVSKYIPGFKDMPGDKIKGKDKLRIIDILHHVAGFPADPQYPNKN
YFEW_SALG2            ALQKLVYEGKIDVNDLVSKYIPGFKDMPGDKIKGKDKLRIIDILHHVAGFPADPQYPNKN
A0A379R010_SALER      ALQKLVYEGKIDVNDLVSKYIPGFRDMPGDKIKGKDKLRIIDILHHVAGFPADPQYPNKN
A0A7U6BHI3_SALER      ALQKLVYEGKINVNDLVSKYIPGFKDMPGDKIKGKDKLRIIDILHHVAGFPADPQYPNKK
A0A0K0HD44_SALBC      ALQKLVYEGKINANDLVSKYIPGFKDAPGDKIKGKDRLRIIDILHHEAGFPADPQYPNPN
E3GAL8_ENTLS          ALQKLVYEKKIDVNDLVSQYIPGFADRPGDSIRGKDALRITDILHHTAGFPADPQYPNKK
A0A7G3EWK9_ENTCL      ALQKLVYEGKINVNDRVTKYIPGFTDQLTEKIKGKDALRIIDILHHTAGFPADPQYPNKR
A0A2P5GK56_9ENTR      ALQKLVYEGKININDTVAHYLPGFADRPTDKIKGKDTLRIVDILHHTAGFPADPQYPNKK
A8ADF7_CITK8          ALQKLMSEGKLQPDDLISKYIPDFGDRPGDAIKGKSTLRIADLLHHSGGFPADPQYPNQA
A9MID6_SALAR          ALQKLMSEGKLKPDDLISKYIPGFVDRPGEAIKGKSMLRVADLLHHSGGFPADPQYPNKT
B7LCH4_ECO55          ALQKLMSEGKLHPDDRIAKYIPGFADSPNDTIKGKNTLRISDLLHHSGGFPADPQYPNKA
B6I506_ECOSE          ALQKLMSEGKLHPDDRIAKYIPGFADSPNDTIKGKNTLRISDLLHHSGGFPADPQYPNKA
B3WY65_9ENTR          ALQKLMSEGKLHPDDRIAKYIPGFADSPNDTIKGKNTLRISDLLHHSGGFPADPQYPNKA
YFEW_ECOLI            ALQKLMSEGKLHPDDRIAKYIPGFADSPNDTIKGKNTLRISDLLHHSGGFPADPQYPNKA
S1DC98_ECOLX          ALQKLMSEGKLHPDDRIAKYIPGFADSPNDTIKGKNTLRISDLLHHSGGFPADPQYPNKA
B1LMM4_ECOSM          ALQKLMSEGKLHPDDRIAKYIPGFADSPNDAIKGKNTLRISDLLHHSGGFPADPQYPNKA
D8AES5_ECOMS          ALQKLMSEGKLHPDDRIAKYIPGFADSPNDAIKGKNTLRISDLLHHSGGFPADPQYPNKA
M9H2B6_ECOLX          ALQKLMSEGKLHPDDRIAKYIPGFADNPNDAIKGKNTLRISDLLHHSGGFPADPQYPNKA
F0JUG7_ESCFE          ALQKLMSEGKLHPDDLIAKYIPGFADSPNDTIKGKNTLRISELLHHSGGFPADPQYPNKA
B7LKK5_ESCF3          ALQKLMSEGKLHPDDLIAKYILGFADSPNDTIKGKNTLRISDLLHHSGGFPADPQYPNKA
                      *****: * *:. :* :::*: .. *   : *:**. **: ::*** .**********  

A0A0T9XIN0_SALET      VAGKLFSQSKSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESITAMPLDRYVETTI
YFEW_SALTI            VAGKLFSQSKSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESITAMPLDRYVETTI
G5LRY9_SALET          VAGKLFSQSKSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESITAMPLDRYVETTI
YFEW_SALTY            VAGKLFSQSKSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESITAMPLDRYVETTI
YFEW_SALCH            VAGKLFSQSKSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESITAMPLDRYVETTI
YFEW_SALPK            VAGKLFSQSKSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESITAMPLDRYVETTI
G5Q5Y7_SALMO          VAGKLFSQSKSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIVESITAMPLDRYVETTI
A0A3V8D6Q9_SALET      VAGKLFSQSKITTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIVESITAMPLDRYVETTI
YFEW_SALEP            VAGKLFSQSKSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESITAMPLDRYVETTI
YFEW_SALG2            VAGKLFSQSKSTTLEMIKKTPLEYQPRSKHIYSDVDYMILGFIIESITAMPLDRYVETTI
A0A379R010_SALER      VAGKLFSQSKSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESVTAMPLDRYVETTI
A0A7U6BHI3_SALER      VAGKLFSQNKSTTLEMIKKTPLEYQPGSKHIYSDVDYMILGFIIESVTAMPLDRYVETTI
A0A0K0HD44_SALBC      VAGKLFSQNKSTTLEMIKKTPLEYHPGSKHIYSDVDYMILGFIIESVTAMPLDRYVETTI
E3GAL8_ENTLS          AAGALYSQNKATTLEMIKKTPLDYVPGTKHIYSDVDYMILGFIIESVVQMPLDTYVENSI
A0A7G3EWK9_ENTCL      VAGSLYSQDKQTTLEMIKRTPLDYSPGTKHVYSDVDYMILGFIIESVTAMPLDVYVEKHI
A0A2P5GK56_9ENTR      VAGTLYSQNKATTLEMIKRTPLEYAPGSRHVYSDVDYMILGFIIESVTGQPLDHYVEENI
A8ADF7_CITK8          VAGELYSQDKATTLEMIKRTPLAYPPGTKHIYSDVDYMLLGFIVESVTGQPLDRYVEENL
A9MID6_SALAR          VAGELYSQDKSTTLEMIKRTPLEYRPGTQHIYSDVDYMLLGFIVEAVTGQPLDRYVEEAI
B7LCH4_ECO55          VAGALYSQDKGQTLEMIKRTPLEYQPGSKHIYSDVDYMLLGFIVESVTGQPLDRYVEESI
B6I506_ECOSE          VAGALYSQDKGQTLEMIKRTPLEYQPGSKHIYSDVDYMLLGFIVESVTGQPLDRYVEESI
B3WY65_9ENTR          VAGALYSQDKGQTLEMIKHTPLEYQPGSKHIYSDVDYMLLGFIVESVTGQPLDRYVEESI
YFEW_ECOLI            VAGALYSQDKGQTLEMIKRTPLEYQPGSKHIYSDVDYMLLGFIVESVTGQPLDRYVEESI
S1DC98_ECOLX          VAGALYSQDKGQTLEMIKRTPLEYQPGSKHIYSDVDYMLLGFIVESVTGQPLDRYVEESI
B1LMM4_ECOSM          VAGALYSQDKGQTLEMIKRTPLEYQPGSKHIYSDVDYMLLGFIVESVTGQPLDHYVEESI
D8AES5_ECOMS          VAGALYSQDKGQTLEMIKRTPLEYQPGSKHIYSDVDYMLLGFIVESVTGQPLDHYVEESI
M9H2B6_ECOLX          VAGALYSQDKGQTLEMIKRTPLEYQPGSKHIYSYVDYMLLGFIVESVTGQPLDRYVEESI
F0JUG7_ESCFE          VAGALYSQDKGQTLEMIKRTPLEYQPGSKHIYSDVDYMLLGFIVESVTGQPLDRYVEESI
B7LKK5_ESCF3          VAGALYSQDKGQTLEMIKRTPLEYQPGSKHIYSDVDYMLLGFIVESVTGQPLDRYVEESI
                      .** *:**.*  ******:*** * * ::*:** ****:****:*::.  *** ***  :

A0A0T9XIN0_SALET      YKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSM
YFEW_SALTI            YKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSM
G5LRY9_SALET          YKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSM
YFEW_SALTY            YKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSM
YFEW_SALCH            YKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSM
YFEW_SALPK            YKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSM
G5Q5Y7_SALMO          YKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSM
A0A3V8D6Q9_SALET      YKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSM
YFEW_SALEP            YKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSM
YFEW_SALG2            YKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTLWGQVHDEKAWYSM
A0A379R010_SALER      YKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIYFPNIRTSTLWGQVHDEKAWYSM
A0A7U6BHI3_SALER      YKPLGLKHTVFNPLMKGFTPPQIAATELHGNTRDGVIHFPNIRTNTIWGQVHDEKAWYSM
A0A0K0HD44_SALBC      YKPLGLKHTVFNPLMKGFTPPQIAATELNGNTRDGEIHFPNIRTSTVWGQAHDEKAWYSM
E3GAL8_ENTLS          YKPLGLTHTVFNPLQKGFSRQQIAATELNGNTRDGVITFPNIRTSTIWGQVHDEKAWYAM
A0A7G3EWK9_ENTCL      YQPLGLKHTVFNPLLKGFKQQQIAATELNGNTRDGVISFPNIRTTTLWGQVHDEKAWYSM
A0A2P5GK56_9ENTR      YRPLGLTHTVFNPLQKGFQPAQIAATELHGNTRDGVIDFPNVRTYTLQGEVHDEKAWYSM
A8ADF7_CITK8          YRPLGLTHTVFNPLQKGFRQQQIAATELNGNTRDGVIHFPNIRTTTLWGQVHDEKAFYSM
A9MID6_SALAR          YRPLGLTHTVFNPLKKGFQPQQIAATELNGNTRDGIIHFPNIRTTTVWGQVHDEKAFYSM
B7LCH4_ECO55          YRPLGLTHTVFNPLLKGFKPQQIAATELNGNTRDGVIHFPNIRTSTLWGQVHDEKAFYSM
B6I506_ECOSE          YRPLGLTHTVFNPLLKGFKPQQIAATELNGNTRDGVIHFPNIRTSTLWGQVHDEKAFYSM
B3WY65_9ENTR          YRPLGLTHTVFNPLLKGFKPQQIAATELNGNTRDGVIHFPNIRTSTLWGQVHDEKAFYSM
YFEW_ECOLI            YRPLGLTHTVFNPLLKGFKPQQIAATELNGNTRDGVIHFPNIRTSTLWGQVHDEKAFYSM
S1DC98_ECOLX          YRPLGLTHTVFNPLLKGFKPQQIAATELNGNTRDGVIHFPNIRTSTLWGQVHDEKAFYSM
B1LMM4_ECOSM          YRPLGLTHTVFNPLLKGFKPQQIAATELNGNTRDGVIHFPNIRTSTLWGQVHDEKAFYSM
D8AES5_ECOMS          YRPLGLTHTVFNPLLKGFKPQQIAATELNGNTRDGVIHFPNIRTSTLWGQVHDEKAFYSM
M9H2B6_ECOLX          YRPLGLTHTVFNPLLKGFKPQQIAATELNGNTRDGVIHFPNIRTSTLWGQVHDEKAFYSM
F0JUG7_ESCFE          YRPLGLTHTVFNPLLKGFKPQQIAATELNGNTRDGVIHFPNIRTSTLWGQVHDEKAFYSM
B7LKK5_ESCF3          YRPLGLTHTVFNPLLKGFKPQQIAATELNGNTRDGVIHFPNIRTSTLWGQVHDEKAFYSM
                      *:****.******* ***   *******:****** * ***:** *: *:.*****:*:*

A0A0T9XIN0_SALET      GGVSGHAGLFSDTHDMAVLMQVMLNGGGYGNVKLFDNKTVAQFTRRSPEDATFGLGWRVN
YFEW_SALTI            GGVSGHAGLFSDTHDMAVLMQVMLNGGGYGNVKLFDNKTVAQFTRRSPEDATFGLGWRVN
G5LRY9_SALET          GGVSGHAGLFSDTHDMAVLMQVMLNGGGYGNVKLFDDKTVAQFTRRSPEDATFGLGWRVN
YFEW_SALTY            GGVSGHAGLFSDTHDMAVLMQVMLNGGGYGNVKLFDDKTVAQFTRRSPEDATFGLGWRVN
YFEW_SALCH            GGVSGHAGLFSDTHDMAVLMQVMLNGGGYGNVKLFDDKTVAQFTRRSPEDATFGLGWRVN
YFEW_SALPK            GGVSGHAGLFSDTHDMAVLMQVMLNGGGYGNVKLFDDKTVAQFTRRSPEDATFGLGWRVN
G5Q5Y7_SALMO          GGVSGHAGLFSDTHDMAVLMQVMLNGGGYGNVKLFDDKTVAQFTRRSPEDATFGLGWRVN
A0A3V8D6Q9_SALET      GGVSGHAGLFSDTHDMAVLMQVMLNGGGYGNVKLFDDKTVAQFTRRSPEDATFGLGWRVN
YFEW_SALEP            GGVSGHAGLFSDTHDMAVLMQVMLNGGGYGNLKLFDDKTVAQFTRHSPEDATFGLGWRVN
YFEW_SALG2            GGVSGHAGLFSDTHDMAVLMQVMLNGGGYGNLKLFDDKTVAQFTRRSPEDATFGLGWRVN
A0A379R010_SALER      GGVSGHAGLFSDTHDIAVLMQVMLNGGGYGNVKLFDKKTVEQFTRRSPEDATFGLGWRVN
A0A7U6BHI3_SALER      GGVSGHAGLFSNTHDMAVLMQVMLNGGGYGNVKLFDKKTVEQFTRHSPEDATFGLGWRVN
A0A0K0HD44_SALBC      SGVSGHAGLFSNTHDMAVLMQVMLNGGGYGNVKLFDEKTVEQFTRRSPEEATFGLGWRIN
E3GAL8_ENTLS          GGVSGHAGLFSTTSDMAVLMQVMLNDGGYGNVKLFDKNTVAQFTRGSAQDATFGLGWRVN
A0A7G3EWK9_ENTCL      EGVSGHAGLFSNTHDIAVLMQTMLNGGHYGNVTLFDQSTVDEFTRSSAADVTFGLGWRVN
A0A2P5GK56_9ENTR      GGVSGHAGLFSNTGDIAILMQVMLNGGHYKNVTLFDQKTTEAFTRSSSADPTYGLGWRVN
A8ADF7_CITK8          GGVSGHAGLFSNTGDIAVLMQTMLNGGGYGNVTLFSPETVKMFTQSSPEDATFGLGWRVN
A9MID6_SALAR          GGVSGHAGLFSNTADIAVLMQTMLNGGSYGNVTLFSPETVKMFTRRSPEDATFGLGWRVN
B7LCH4_ECO55          GGVSGHAGLFSNTGDIAVLMQTMLNGGGYGDVQLFSAETVKMFTTSSKEDANFGLGWRVN
B6I506_ECOSE          GGVSGHAGLFSNTGDIAVLMQTMLNGGGYGDVQLFSAETVKMFTTSSKEDATFGLGWRVN
B3WY65_9ENTR          GGVSGHAGLFSNTGDIAVLMQTMLNGGGYGDVQLFSAETVKMFTTSSKEDATFGLGWRVN
YFEW_ECOLI            GGVSGHAGLFSNTGDIAVLMQTMLNGGGYGDVQLFNAETVKMFTTSSKEDATFGLGWRVN
S1DC98_ECOLX          GGVSGHAGLFSNTGDIAVLMQTMLNGGGYGDVQLFSAETVKMFTTSSKEDATFGLGWRVN
B1LMM4_ECOSM          GGVSGHAGLFSNTGDIAVLMQTMLNGGGYGDVQLFNAETVKMFTTSSKEDATFGLGWRVN
D8AES5_ECOMS          GGVSGHAGLFSNTGDIAVLMQTMLNGGGYGDVQLFSAETVKMFTTSSKEDATFGLGWRVN
M9H2B6_ECOLX          GGVSGHAGLFSNTGDIAVLMQTMLNGGGYGDVQLFSAETVKMFITSSKEDATFGLGWRVN
F0JUG7_ESCFE          GGVSGHAGLFSNTGDIAVLMQTMLNGGGYGDVKLFSAETVKMFTTSSKEDATFGLGWRVN
B7LKK5_ESCF3          GGVSGHAGLFSNTGDIAVLMQTMLNGGGYGDVTLFSAETVKMFTTSSKEDATFGLGWRVN
                       ********** * *:*:***.***.* * :: **. .*.  *   *  : .:*****:*

A0A0T9XIN0_SALET      GNASMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFV
YFEW_SALTI            GNASMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFV
G5LRY9_SALET          GNASMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFV
YFEW_SALTY            GNASMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFV
YFEW_SALCH            GNASMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFV
YFEW_SALPK            GNASMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFV
G5Q5Y7_SALMO          GNASMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFV
A0A3V8D6Q9_SALET      GNASMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFV
YFEW_SALEP            GNASMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFV
YFEW_SALG2            GNSSMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVANPKVNPNVFV
A0A379R010_SALER      GNASMTPTFGVLASPQTYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVADPKVNPNVFV
A0A7U6BHI3_SALER      GNASMTPTFGVLATPQTYGHTGWTGTLTSIDPVNHVAIVILGNRPHSPVADPKVNPNVFV
A0A0K0HD44_SALBC      SNASMTPTFGVLASPETYGHTGWTGTLTSIDPVNHMAIVILGNRPHSPVADPKVNPNVFV
E3GAL8_ENTLS          GNASMTPTFGVLASAQTYGHTGWTGTLTAIDPVNHMAIVILGNKPHSPVADPKMNPNVFM
A0A7G3EWK9_ENTCL      GNSSMTPTFGVLASPQTYGHTGWTGTLTAIDPVKRMAIVILGNRPHSPVADPKMNPNVFV
A0A2P5GK56_9ENTR      ANASMTSTFGMLATPQTYGHTGWTGTLTVIDPQKHMAIVVLSNKPHSPVADPHVNPNLFV
A8ADF7_CITK8          GNASMTPTFGTLASAQAYGHTGWTGTLTVIDPANQMAIVMLSNKPHSPVADPQKNPNMFN
A9MID6_SALAR          GNASMTSTFGTLASAEAYGHTGWTGTLTVIDPVNHMAIVMLSNKPHSPVADPQKNPNMFK
B7LCH4_ECO55          GNATMTPTFGTLASPQTYGHTGWTGTVTVIDPVNHMAIVMLSNKPHSPVADPQKNPNMFE
B6I506_ECOSE          GNATMTPTFGTLASPQTYGHTGWTGTVTVIDPVNHMAIVMLSNKPHSPVADPQKNPNMFE
B3WY65_9ENTR          GNATMTPTFGTLASPQTYGHTGWTGTVIVIDPVNHMAIVMLSNKPHSPVADPQKNPNMFE
YFEW_ECOLI            GNATMTPTFGTLASPQTYGHTGWTGTVTVIDPVNHMTIVMLSNKPHSPVADPQKNPNMFE
S1DC98_ECOLX          GNATMTPTFGTLASPQTYGHTGWTGTVTVIDPVNHMAIVMLSNKPHSPVADPQKNPNMFE
B1LMM4_ECOSM          GNATMTPTFGTLASPQTYGHTGWTGTVTVIDPVNHMAIVMLSNKPHSPVADPQKNPNMFE
D8AES5_ECOMS          GNATMTPTFGTLASPQTYGHTGWTGTVTVIDPVNHMAIVMLSNKPHSPVADPQKNPNMFE
M9H2B6_ECOLX          GNATMTPTFGTLASPQTYGHTGWTGTVTVIDPVNHMAIVMLSNKPHSPVADPQKNPNMFE
F0JUG7_ESCFE          GNATMTPTFGTLASPQTYGHTGWTGTVTVIDPMNHMAIVMLSNKPHSPVADPQKNPNMFE
B7LKK5_ESCF3          GNATMTPTFGTLASPQTYGHTGWTGTVTVIDPVNHMAIVMLSNKPHSPVADPQKNPNMFE
                      .*::**.*** **:.::*********:  *** ::::**:*.*:******:*: ***:* 

A0A0T9XIN0_SALET      SGLLPAATYGWIVDQIYGSLK--
YFEW_SALTI            SGLLPAATYGWIVDQIYGSLK--
G5LRY9_SALET          SGLLPAATYGWIVDQIYGSLK--
YFEW_SALTY            SGLLPAATYGWIVDQIYGSLK--
YFEW_SALCH            SGLLPAATYGWIVDQIYGSLK--
YFEW_SALPK            SGLLPAATYGWIVDQIYGSLK--
G5Q5Y7_SALMO          SGLLPAATYGWIVDRIYGSLK--
A0A3V8D6Q9_SALET      SGLLPAATYGWIVDRIYGSLK--
YFEW_SALEP            SGLLPAATYGWIVDQIYGSLK--
YFEW_SALG2            SGLLPAATYGWIVDQIYGSLK--
A0A379R010_SALER      SGLLPVATYGWIVDQIYGSLK--
A0A7U6BHI3_SALER      SGLLPAATYGWIVDQVYGALK--
A0A0K0HD44_SALBC      SGLLPAATYGWIVDQIYGALKK-
E3GAL8_ENTLS          SGLLPAATYGWIVDQVYGALKP-
A0A7G3EWK9_ENTCL      SGTLPAATYGWIVDQIYGALNE-
A0A2P5GK56_9ENTR      SGQLPAATYGWIVDGVYGALKR-
A8ADF7_CITK8          SGLMPIATYGWVVDQIYAALKHE
A9MID6_SALAR          SGLMPVATYGWVVDQIYAALK--
B7LCH4_ECO55          SGQLPIATYGWVVDQVYAALKQK
B6I506_ECOSE          SGQLPIATYGWVVDQVYAALKQK
B3WY65_9ENTR          SGQLPIATYGWVVDQVYAALKQK
YFEW_ECOLI            SGQLPIATYGWVVDQVYAALKQK
S1DC98_ECOLX          SGQLPIATYGWVVDQVYAALKQK
B1LMM4_ECOSM          SGQLPIATYGWVVDQVYAALKQ-
D8AES5_ECOMS          SGQLPIATYGWVVDQVYAALKQK
M9H2B6_ECOLX          SGQLPIATYGWVVDQVYAALKQK
F0JUG7_ESCFE          SGQLPIATYGWVVDQVYAALKQ-
B7LKK5_ESCF3          SGQLPIATYG-------------
                      ** :* ****