CLUSTAL format seed alignment for MF_01038

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GPMI_CLOAB       ----------MAK------KPVMLMILDGFGISDKVD---GNAVKAASKPNFDKYFNNYP
GPMI_CLONN       ----------MAK------KPVMLAILDGLGLSDHKD---GNAFSLAKKPNLDKIFKEYP
GPMI_CLOB1       ----------MSK------KPVVLMILDGFGLTNKVD---GNAVSAANKPNLDNILKKYP
GPMI_CLOBL       ----------MSK------KPVVLMILDGFGLTNKVD---GNAVSAANKPNLDNILKKYP
GPMI_CLOK5       ----------MGK------KPVMLMILDGFGISKIDN---GNAVKAAYKPNLDKYFKKYP
GPMI_CLOPE       ----------MSK------KPVMLMILDGFGISPNKE---GNAVAAANKPNYDRLFNKYP
GPMI_CLOP1       ----------MSK------KPVMLMILDGFGISPNKE---GNAVAAANKPNYDRLFAKYP
GPMI_CLOPS       ----------MSK------KPVMLMILDGFGISPNKE---GNAVAAANKPNYDRLFNKYP
GPMI_CLOB8       ----------MSK------KPVMLMILDGFGIAPKSE---GNAVTLAKKPNLDKLFEKYP
GPMI_CLOTE       ----------MNK------KPVMLMILDGFGITNHED---GNAVKMANKPNFDKLLREYP
GPMI_CLOD6       ----------MMK------KPVALIIMDGFGYNKDVK---GNAIAESKTPNLDRIKKEYP
GPMI_HUNT2       ----------MKD------KLVMLIILDGYGINPRKE---GNAIEAANKPNIDRFMREYP
GPMI_LACP7       ----------MSK------KPTVLMILDGYGLNEKTE---GNAIALAKKPVLDKLMKDYP
GPMI_BACSU       ----------MSK------KPAALIILDGFGLRNETV---GNAVALAKKPNFDRYWNQYP
GPMI_BACVZ       ----------MSK------KPAALIILDGFGLRNETV---GNAVAQAKKPNFDRYWNQYP
GPMI_BACP2       ----------MSK------KPAALIILDGFGLRGETV---GNAVAQAKKPNFDRYWNEFP
GPMI_BACLD       ----------MSN------KLAALIILDGFGLRDETV---GNAVAQAKKPNFDRYWNKYP
GPMI_GEOSE       ----------MSK------KPVALIILDGFALRDETY---GNAVAQANKPNFDRYWNEYP
GPMI_GEOKA       ----------MSK------QPVALIILDGFALRDETY---GNAVAQANKPNFDRYWNEYP
GPMI_GEOTN       ----------MSK------RPVALIILDGFALREETY---GNAVAQANKPNFDRYWNEYP
GPMI_BACMQ       ----------MSK------KPVALIILDGFALRDEDK---GNAVTHAKKPNFDRFWNEYP
GPMI_BACAH       -----------MR------KPTALIILDGFGLREETY---GNAVAQAKKPNFDGYWNKFP
GPMI_BACC1       -----------MR------KPTALIILDGFGLREETY---GNAVAQAKKPNFDGYWNKFP
GPMI_BACCR       -----------MR------KPTALIILDGFGLREETY---GNAVAQAKKPNFDGYWNKFP
GPMI_BACHK       -----------MR------KPTALIILDGFGLREETY---GNAVAQAKKPNFDGYWNKFP
GPMI_BACCZ       -----------MR------KPTALIILDGFGLREETY---GNAVAQAKKPNFDGYWNKFP
GPMI_BACAN       -----------MR------KPTALIILDGFGLREETY---GNAVAQAKKPNFDGYWNKFP
GPMI_BACCN       -----------MR------KPTALIILDGFGLREETY---GNAVAQAKKPNFDRYWNKFP
GPMI_BACHD       ----------MSK------KPVALIILDGFAMRDEAK---GNAVAQANKPNFDRYWNQYP
GPMI_BACSK       ----------MSK------KPVALIILDGFGLREEEK---GNAVAHAQKPNFDRYWNEFP
GPMI_OCEIH       ----------MSQN-----KLAALIILDGFAIRDEVK---GNAVKQANTPNFDRFWNQYA
GPMI_STAAS       ----------MAK------KPTALIILDGFANRESEH---GNAVKLANKPNFDRYYNKYP
GPMI_STAAW       ----------MAK------KPTALIILDGFANRESEH---GNAVKLANKPNFDRYYNKYP
GPMI_STAAC       ----------MAK------KPTALIILDGFANRESEH---GNAVKLANKPNFDRYYNKYP
GPMI_STAAM       ----------MAK------KPTALIILDGFANRESEH---GNAVKLANKPNFDRYYNKYP
GPMI_STAAN       ----------MAK------KPTALIILDGFANRESEH---GNAVKLANKPNFDRYYNKYP
GPMI_STAAR       ----------MAK------KPTALIILDGFANRESEH---GNAVKLANKPNFDRYYNKYP
GPMI_STAEQ       ----------MAK------QPTALIILDGFANRESEH---GNAVKQAHKPNFDRYYEKYP
GPMI_STAES       ----------MAK------QPTALIILDGFANRESEH---GNAVKQAHKPNFDRYYEKYP
GPMI_STAHJ       ----------MAK------QPTALIILDGFANRESEH---GNAVKQAHKPNFDRYYSKYP
GPMI_STAS1       ----------MAK------QPTALIILDGFANRESEH---GNAVKLANKPNFDRYYSKYP
GPMI_LISMF       ----------MSK------SPVAIIILDGFGKRAETV---GNAVAQANKPNFDRYWANFP
GPMI_LISMO       ----------MSK------SPVAIIILDGFGKRAETV---GNAVAQANKPNFDRYWADFP
GPMI_LISIN       ----------MSK------SPVAIIILDGFGKRAETV---GNAVAQANKPNFDRYWANFP
GPMI_LISW6       ----------MSK------SPVAIIILDGFGKRAETV---GNAVAQANKPNFDRYWADFP
GPMI2_METAC      ----MWNSLHMTQA----RRPLMLMILDGWGYREASE---GNAILAAETPNLNSLLNEFP
GPMI_METMA       ----MRISLHMTQA----RRPLMLMILDGWGYREEKE---GNAILAASTPHLDRLQKERP
GPMI1_METBF      -------MLHMTQA----KKPLMLIILDGWGYREARE---GNAILAARTPNLDHLIEEYP
GPMI1_METAC      ----------MAQA----RRPLMLIILDGWGYREVEE---GNAVLSAGTPNLDRLVKDYP
GPMI2_METBF      ----------MTQA----RRPLMLIIFDGWGYREAKE---GNAVMTARTPNLDRLEKECP
GPMI_METBU       ----------MNFT----KRPFLLTILDGWGYSPEVE---GNAIHAANTPNLDDLLETYP
GPMI_PSEF5       ----------MTTT----PKPLVLMILDGFGHSESHE---SNAVYAAKKPVLDRLCASMP
GPMI_PSEPF       ----------MTTT----PKPLVLMILDGFGHSDSPE---SNAVYAAKKPVLDRLWATVP
GPMI_PSEU2       ----------MTAT----PKPLVLIILDGFGHSESHK---GNAILAAKMPVMDRLYQTMP
GPMI_PSE14       ----------MTAT----PKPLVLIILDGFGHSESHE---GNAILAAKMPVMDRLYETMP
GPMI_PSESM       ----------MTAT----PKPLVLIILDGFGHSESHE---GNAILAAKMPVMDRLYKTMP
GPMI_PSEP1       ----------MTST----PKPLVLIILDGFGHSDIPE---HNAIFAANKPVYDRLCATQP
GPMI_PSEPK       ----------MTST----PKPLVLIILDGFGHSDIPE---HNAIFAANKPVYDRLCATQP
GPMI_PSEPG       ----------MTST----PKPLVLIILDGFGHSEVPE---HNAIFAANTPVYDRLRATLP
GPMI_PSEE4       ----------MTST----PKPLVLIILDGFGHSESPE---YNAIFAANTPVYDRLRATQP
GPMI_PSEAB       ----------MTAT----PKPLVLIILDGFGHSESPD---YNAIYAAKKPVWDRLLATQP
GPMI_PSEAE       ----------MTAT----PKPLVLIILDGFGHSESPD---YNAIYAAKKPVWDRLLATQP
GPMI_PSEA7       ----------MTAT----PKPLVLIILDGFGHSESPD---YNAIYAAKKPVWDRLLATQP
GPMI_PSEMY       ----------MSAT----PKPLVLIILDGFGHSDKPE---YNAIHAASTPVYDRLRATYP
GPMI_ACIAD       -------MTDATVA----KIPHVLVIMDGIGHREAIK---DNAFLAAKTPSLSMMKQKHP
GPMI_SHEB5       ----------MTTA----KRPLALLILDGWGYRENTH---NNAIFHANTPVLDRLNAQYP
GPMI_SHEB8       ----------MTTA----KRPLALLILDGWGYRENTH---NNAIFHANTPVLDRLNAQYP
GPMI_SHEB9       ----------MTTA----KRPLALLILDGWGYRENTH---NNAIFHANTPVLDRLNAQYP
GPMI_SHEPC       ----------MTTT----KRPIALLILDGWGYRENTH---MNAIFHAKTPVLDRLNAQYP
GPMI_SHESW       ----------MTTT----KRPIALLILDGWGYRENTH---MNAIFHAKTPVLDRLNAQYP
GPMI_SHESR       ----------MTTT----KRPIALLILDGWGYRENTH---MNAIYHANTPVLDRLNAQYA
GPMI_SHESA       ----------MTTT----KRPIALLILDGWGYRENTH---MNAIYHANTPVLDRLNAQYA
GPMI_SHESM       ----------MTTT----KRPIALLILDGWGYRENTH---MNAIYHANTPVLDRLNAQYA
GPMI_SHEON       ----------MTTT----KRPIALLILDGWGYRENTH---MNAVYHANTPVLDRLNAQYA
GPMI_SHEDO       ----------MTTA----KRPLALLILDGWGYRENPH---NNAIFHARTPVLDKLNAQFP
GPMI_SHEHH       ----------MMTR----KRPLALLILDGWGYRENTQ---KNAVFHANTPVLDQLTAKYP
GPMI_SHEPA       ----------MTTR----KRPLALLILDGWGYRENTQ---KNAVFHANTPVLDQLNAKYP
GPMI_SHELP       ----------MTTR----KRPLALLILDGWGYRENTH---MNAVYHANTPVLDRLNKEYP
GPMI_SHESH       ----------MTTR----KRPLALLILDGWGYRENTQ---KNAVYHANTPVLDRLNAQYP
GPMI_ECOK1       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAIFSAKTPVMDALWANRP
GPMI_ECOL5       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAIFSAKTPVMDALWANRP
GPMI_ECOL6       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAIFSAKTPVMDALWANRP
GPMI_SHIBS       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAIFSAKTPVMDALWANRP
GPMI_ECO57       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAIFSAKTPVMDALWANRP
GPMI_ECO24       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAIFSAKTPVMDALWANRP
GPMI_ECOHS       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAIFSAKTPVMDALWANRP
GPMI_ECOLC       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAIFSAKTPVMDALWANRP
GPMI_SHISS       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAIFSAKTPVMDALWANRP
GPMI_ECOLI       ----------MLVS----KKPMVLVILDGYGYREEQQ---DNAIFSAKTPVMDALWANRP
GPMI_SHIFL       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAIFSAKTPVMDALWANRP
GPMI_SHIDS       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAIFSAKTPVMDALWANRP
GPMI_SALPA       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAILNAKTPVMDALWAKRP
GPMI_SALTY       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAILNAKTPVMDALWAKRP
GPMI_SALTI       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAILNAKTPVMDALWAKRP
GPMI_SALPB       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAILNAKTPVMDALWAKRP
GPMI_SALCH       ----------MSVS----KKPMVLVILDGYGYREEQQ---DNAILNAKTPVMDALWAKRP
GPMI_ENT38       ----------MSVS----KKPMVLVILDGYGYREDSQ---DNAIFNAKTPVMDALWAQRP
GPMI_CROS8       ----------MSLT----KKPVVLVILDGYGYREDSQ---DNAISAAKTPVMDSLWVNRP
GPMI_YERPA       ----------MSST----KKPLVLTILDGYGHREEQQ---DNAILNAKTPVMDVLWQQQP
GPMI_YERPP       ----------MSST----KKPLVLTILDGYGHREEQQ---DNAILNAKTPVMDVLWQQQP
GPMI_YERPN       ----------MSST----KKPLVLTILDGYGHREEQQ---DNAILNAKTPVMDVLWQQQP
GPMI_YERPE       ----------MSST----KKPLVLTILDGYGHREEQQ---DNAILNAKTPVMDVLWQQQP
GPMI_YERPS       ----------MSST----KKPLVLTILDGYGHREEQQ---DNAILNAKTPVMDVLWQQQP
GPMI_YERP3       ----------MSST----KKPLVLTILDGYGHREEQQ---DNAILNAKTPVMDVLWQQQP
GPMI_YERE8       ----------MSST----KKPLVLTILDGYGHREEQQ---DNAILNAKTPVMDRLWQQQP
GPMI_SERP5       ----------MSSN----KKPMVLVILDGYGHREEQQ---DNAILNAKTPVMDRLWQQQP
GPMI_VIBC3       -----------MSA----KKPMALVILDGWGYREDNA---NNAINNARTPVMDSLMANNP
GPMI_VIBCH       -----------MSA----KKPMALVILDGWGYREDNA---NNAINNARTPVMDSLMANNP
GPMI_VIBPA       -----------MSA----KKPLALVILDGYGYREDTA---SNAIANAKTPVMDALIANNP
GPMI_VIBCB       -----------MSA----KKPLALVILDGYGYREDTA---SNAIANAKTPVMDALIANNP
GPMI_VIBVU       -----------MSA----KKPLALVILDGYGYREDTA---SNAIANAKTPVMDALIANQP
GPMI_VIBVY       -----------MSA----KKPLALVILDGYGYREDTA---SNAIANAKTPVMDALIANQP
GPMI_ALIF1       -----------MSA----KKPMALVILDGYGHRETQA---DNAITNANTPVLDGLMANQP
GPMI_PHOPR       -----------MSA----KKPLALVILDGWGYREDNS---DNAIANANTPVMDSLIANEA
GPMI_AERS4       ----------MSTA----KKPLVLVIMDGWGYSTKQE---HNAVAAAKTPNLDRLARDYT
GPMI_PSYIN       ----------MTIA----KKPLVLLIMDGWGYRPNMP---DNAVANANTPVLDKLCKDYA
GPMI_PSEHT       ----------MSEH----KKPLVLMILDGWGYREDEQ---SNAILAANTPVLDELWATRP
GPMI_PSEA6       ----------MSQS----KKTVALIIMDGWGHREDTT---NNAIAHAKTPVLDRLTKETT
GPMI_COLP3       -----------MAN----KKSTVLMILDGWGYREETS---SNAIHQANTPVLDNLKAKYP
GPMI_IDILO       ----------MTPT----IKPLVLLILDGWGYREDAP---DNAIAKANTPVMDRLWEKYP
GPMI_HAHCH       ----------MTAK----RKPTALLILDGWGYREGKD---SNAIANANTPFWDQISSQNP
GPMI_SACD2       ----------MSEV----KKPLALIILDGFGYSESDK---YNAINAAKAPTWRKIWAENP
GPMI_CHRSD       ------MADTHTQR----PRPVALLILDGYGQNDDTE---YNAVYSARTPVMDALKQRYP
GPMI_METFK       ------------MT----VTPALLVILDGFGYREDSH---DNAIALANTPNIDRFWTQYP
GPMI_CHRVO       -----------MKS----IKPVLLLILDGFGHRTEGD---DNAILHARMPVWSRLREQYA
GPMI_THIDA       ------------MK----ALPVLLIILDGFGCRDERA---NNAIAQANKPNWDRLWKHHP
GPMI_COXBU       ----------MTQADNQNPKPMVLIILDGFGESDETT---HNAIKEANTPTLDKLFRHYP
GPMI_COXBR       ----------MTQADNQNPKPMVLIILDGFGESDETT---HNAIKEANTPTLDKLFRHYP
GPMI_COXBN       ----------MTQADNQNPKPMVLIILDGFGESDETT---HNAIKEANTPTLDKLFRHYP
GPMI_VESOH       ----------MKSK----KQTKLLLILDGWGYSKTTK---NNAIALANTSVWDRLNQTFP
GPMI_RUTMC       ----------MKSK----KQTKLLLILDGWGYSETIQ---NNAIALANTPVWDKLNQTFL
GPMI_NITOC       ----------MSTP----PRPLALLILDGWGYSEETA---SNAIHAAHTPIWDTLWDRYP
GPMI_HYDCU       ----------MTKAVQIKNRPTGLIILDGWGHREATQ---HNAIAQAHTPNWDNLLKDYH
GPMI_FRATF       ------------MK-----KTTLLVILDGWGYSDSDY---FNAIKNANTPTWDSIWQEFP
GPMI_FRATH       ------------MK-----KTTLLVILDGWGYSDSDY---FNAIKNANTPTWDSIWQEFP
GPMI_FRATW       ------------MK-----KTTLLVILDGWGYSDSDY---FNAIKNANTPTWDSIWQEFP
GPMI_FRAT1       ------------MK-----KTTLLVILDGWGYSDSDY---FNAIKNANTPTWDSIWQEFP
GPMI_FRATT       ------------MK-----KTTLLVILDGWGYSDSDY---FNAIKNANTPTWDSIWQEFP
GPMI_FRATN       ------------MK-----KTTLLVILDGWGYSDSDY---FNAIKNANTPTWDSIWQEFP
GPMI_FRAP2       ------------MK-----KTTLLVILDGWGYSESDY---FNAIKNANTPTWDSIWQDFP
GPMI_LEGPH       ----------MSHN-----APLVLMILDGWGYNENDR---YNAIAKANTPQWDEWWQTCP
GPMI_LEGPL       ----------MSHN-----APLVLMILDGWGYNENDR---YNAIAKANTPQWDEWWQTCP
GPMI_LEGPA       ----------MSHN-----APLVLMILDGWGYNENDR---YNAIAKANTPQWDEWWQTCP
GPMI_LEGPC       ----------MSHN-----APLVLMILDGWGYNENDR---YNAIAKANTPQWDEWWQTCP
GPMI_GEOSL       --------------M---PRPLVLMILDGWGINPDP---SNNAVAIGRTPAMDRLMAEYP
GPMI_PELCD       ----------MTVEI---RRPVALVILDGWGINPVC---EHNAVCQADTPRLRALLESWP
GPMI_SYMTH       -----------MSAY---RRPVALIVLDGWGLNPDP---RANAVAMARHPNFDRLMARYP
GPMI_RHOS1       ------------MTA---PKPVVLCILDGWGLRAER---EANAVALADTPTFDRLMATCP
GPMI_RHOS4       ------------MTA---PKPVVLCILDGWGLRAER---EANAVALAETPTFDRLMATCP
GPMI_RHOS5       ------------MTA---PKPVVLCILDGWGLRAER---EANAVALANTPTFDRLMATCP
GPMI_DINSH       ------------MTA---PKPVVLCILDGWGLDPDG---PANAPLLADTPVMDRLMATCP
GPMI_PARDP       ------------MTR---PKPVVLCILDGWGISSRP---EQSAPDQARTPNFDRLMRGCP
GPMI_ROSDO       ------------MTR---PKPVALCILDGWGLSERR---EGNAPLLADTPNMDRLMATCP
GPMI_RUEPO       ------------MNA---PKPVVLCILDGWGLSDDK---TANAPYLAKTPTFDAIMTKGP
GPMI_RUEST       ------------MTT---PKPVVLCILDGWGSAEPG---PANAPYLAKTPTLDAIMQSCP
GPMI_AGRFC       ------------MRT---PKPVVLTILDGWGLNEDT---SSNAPVLANTPTMDRLFATCP
GPMI_RHOPA       ------------MQS---RRPVMLVILDGWGWREDP---ADNAVLQAKTPTFDALWTNGP
GPMI_GLUOX       ---------MSASST---PRPVMLVILDGFGWREDE---SDNAVRLANTPTFDTLWATSP
GPMI_MAGMM       ----------MQTHR---PKPMTLVILDGWGLRDTQ---ENNAIANASTPHMDDWLANRP
GPMI_LAWIP       -------------MN---VVPILLLILDGYGLAPDS---TGNAAKLAFTPNIDRMLAMSG
GPMI_DESVH       -------------MS---LKPTLLLILDGWGKAPAG---PGNAVTLAGMPHLSSLLRQAG
GPMI_RHOBA       -----MVLTFMTATR---RRPVVLIVRDGWGQNPDPKWNESNAVHLANTPVDDKLTQEYP
GPMI_SYNY3       ----------MAEAP---IAPVVLVILDGWGYR-PDT--RANAIAQANTPIMDSLIAAYP
GPMI_MICAN       ----------MTHAP---ISPVVLVILDGWGYR-PQR--SDNAIAMAKTPIMDSLWEVYP
GPMI_NOSS1       ----------MTKAP---VAPVVLVILDGWGYC-EET--RGNAIAAAKTPVMESLWTAYP
GPMI_TRIV2       ----------MTKAP---VAPVVLVILDGWGYC-EET--RGNAIAAAKTPVMESLWTAYP
GPMI_TRIEI       ----------MKNGS---ISPVVLIILDGWGYR-EEK--YGNAIAVGKTPNIDSLWQAYP
GPMI_SYNE7       ----------MLDAS---ISPVVLVILDGWGYR-NAT--EGNAIRTAETPIMDALWEAYP
GPMI_SYNP6       ----------MLDAS---ISPVVLVILDGWGYR-NAT--EGNAIRTAETPIMDALWEAYP
GPMI_ACAM1       ----------MTSTP---VSPVVLVILDGWGYQ-ENS--DGNAIATANTPIIDSLWTAYP
GPMI_SYNJA       ----------MDAQS---VAPVVLVILDGWGYR-EAP--EGNAVLAARTPVVDSLWATYP
GPMI_SYNJB       ----------MDSQS---VAPVVLVILDGWGYR-DAL--DGNAVLAAETPVLDSLWAAYP
GPMI_THEEB       ----------MASSP---VAPVVLVILDGWGYR-EET--YGNAIASAYTPVIDSLWQAYP
GPMI_GLOVI       ------MAFMGTSSA---VHPAILVILDGWGYR-EQT--DGNAVAAAKTPIFDALKASYP
GPMI_PROM1       MSGSNPA-VSINKRK---VAPVVLAILDGWGYR-EEI--EHNAVRQASTPVIDALWHAYP
GPMI_PROMT       MSGSNPA-VSINKKK---VAPVVLAILDGWGYR-EEI--EHNAVRQASTPVIDALWHAYP
GPMI_PROM3       MSSSSSG-NSRHFGR---VAPVVLAILDGWGHR-EEL--EHNSIRSAETPIMDALWHAYP
GPMI_PROMM       MPSSSSG-NSRHFSR---VAPVVLAILDGWGHR-EEV--EHNSIRSAETPIMDALWHAYP
GPMI_SYNPX       MDQSSGK-GSGRDVG---VAPVVLTILDGWGHR-NDS--EHNAIRQGDTPVMEALWHAYP
GPMI_PROMA       MPNKSSA-TSMRSGH---IAPVVLTILDGWGHR-EEN--INNAINNADTPVMDALWQAYP
GPMI_PROMP       MSKFSSKNINKTKVP---ESPVVLAILDGWGHR-EEN--LDNAIKNANTPIMDSLWHAYP
GPMI_GRATL       ------------------MKSIILTILDGWGYS-ENK--KGNAIQIADTPTIDKLWNSYP
GPMI_ANTSP       ----------MNNKS---ISPIILMILDGWGHS-TNA--KGNAIHEANTPIIDKLWDNYP
GPMI_PORPU       ----------MMKKK---VHPIVLAILDGWGHS-NSH--QGNAIKIAKTPTIDSLLETYP
GPMI_PYRYE       ----------MKKKI---VHPIVLAILDGWGHT-NIQ--QGNAIKIAKTPTIDSLIQAYP
GPMI_NATPD       -------------------MEAALVILDGWGLG-DGD--ETDAVAAADTPAFDALAERGA
GPMI_HALMA       -------------------MDAGLIILDGWGLNPDDD--VRDAVAAADTPNFDRYRDAGA
GPMI_HALSA       -------------------MQAALVILDGWGLG-DHD--RRDAVRAADTPTFDEYAERGA
GPMI_HALWD       -------------------MQTALVILDGWGLG-DHD--RRNAVQTASTPTFDRLIEKGA
GPMI_STRCO       -------MSTPEPVL---AGPGILLVLDGWGSA-DAA--DDNALSLARTPVLDELVAQHP
GPMI_FLAJ1       -----------------MNKKVILMILDGWGKSPDPK---VSAIDNANVPFINSLYKNYP
GPMI_FLAPJ       -----------------MNKKVILMILDGWGKSPDPK---VSAIDNANIPFINSLYKNYP
GPMI_BACFR       -----------------MSKKALLMILDGWGLGDHGK---DDVIFNTATPYWDYLMETYP
GPMI_BACFN       -----------------MSKKALLMILDGWGLGDHGK---DDVIFNTATPYWDYLMETYP
GPMI_BACTN       -----------------MSKKALLMILDGWGLGDQKK---DDVIFNTPTPYWDYLMNNYP
GPMI_BACV8       -----------------MSKKALLMILDGWGIGDQGK---DDVIFNTPTPYWDSLLANYP
GPMI_PARD8       -----------------MSKKALLIICDGWGIGDKGK---DDVIFNTPTPYWDELLKTYP
GPMI_HELPY       -----------------MAQKTLLIITDGIGYRK-DSD--HNAFFHAKKPTYDLMFKTLP
GPMI_HELPH       -----------------MAQKTLLIITDGIGYRK-DSD--HNAFFHAKKPTYDLMFKTLP
GPMI_HELPJ       -----------------MAQKTLLIITDGIGYRK-DSD--HNAFFHAKKPTYDLMFKTLP
GPMI_HELAH       -----------------MAQKTLLIITDGIGYRK-DSD--YNAFFHAKKPTYDLMFKTLP
GPMI_HELHP       -------------------MKTILVITDGIGYSD-KTQ--YNAFYHAKKPTYDYLFKNVP
GPMI_WOLSU       -----------------MAQKTLLIITDGIGHKP-SSP--HNAFTQAKKPTYDSLFASAP
GPMI_ARCB4       -----------------MSNKTLLIITDGIGHNS-SNK--NNAFYTAKKPTYDYLFENVP
GPMI_SULDN       -----------------MAKKAILVITDGIGYSS-GME--YNAFYNAQKPTYDKLFSNTP
GPMI_CAMJ8       -----------------MKQKCVLIITDGIGYNK-NSK--FNAFEAAKKPSYEKLFKEVP
GPMI_CAMJR       -----------------MKQKCVLIITDGIGYNK-NSK--FNAFEAAKKPSYEKLFKEVP
GPMI_CAMJJ       -----------------MKQKCVLIITDGIGYNK-NSK--FNAFEAAKKPSYEKLFKEVP
GPMI_CAMJE       -----------------MKQKCVLIITDGIGYNK-NSK--FNAFEAAKKPSYEKLFKEVP
GPMI_CAMJD       -----------------MKQKCVLIITDGIGYNK-NSK--FNAFEAAKKPSYEKLFKEVP
GPMI_EHRRW       ----------------MTNHSVILCILDGWGNNK-NSQ--FNAIAQADTPYWDSIISQYP
GPMI_EHRRG       ----------------MTNHSVILCILDGWGNNK-NSQ--FNAIAQADTPYWDSIISQYP
GPMI_EHRCJ       ----------------MTNHSVILCILDGWGNGE-NNQ--FNAIAQAYKPCWDNITLQYP
GPMI_EHRCR       ----------------MTNHSVILCILDGWGNSE-NSQ--FNAIAQSYKPCWDNTILQYP
GPMI_ANAPZ       ----------------MSGSNVVLCILDGWGNGS-GGR--YDAIHAAYTPFWDTAVSCCP
GPMI_ANAMM       ----------------MSGSAVVLCILDGWGNGN-GDE--CDAIHAARKPFWESVVSGCP
GPMI_WOLPM       ----------------MNIKSVVLCILDGWGNGIENNK--YNAISNANPPCWQYISSNYP
GPMI_WOLTR       ----------------MNFKSVVLCILDGWGNGIGDSK--YNAISNANPPCWQYISSNYP
GPMI_ONYPE       ----------------MTKKFVGLTILDGLGLTDQKE---NNAFHLAKTPYLDYLLKNFP
GPMI_AYWBP       ----------------MTKKFVGLIILDGLGLTDQKE---NNAFHLAKTPYLDYLLKNFP
GPMI_ACHLI       ----------------MKEKFAALIIMDGLGIAPASD---SNSVTLADTTYLDNLLKEYP
GPMI_MYCGE       -----------------MHKKVLLAILDGYGISNAIY---GNAVQNANTPMLDELINSYP
GPMI_MYCPN       -----------------MHKKVLLAILDGYGISNKQH---GNAVYHAKTPALDSLIKDYP
GPMI_MYCGA       ------------------MKKALLMILDGYGISSTTH---GNAVKNAKTPHLDNLMNNNP
GPMI_MYCPE       ----------------MKKGPVLLAVLDGYGFSKDTK---GNAILNAKTPFMDNLVKEYD
GPMI_MYCPU       -------------MENKKNKKVILVVIDGLGLRKEKI---GNAFELAKTPFFDKMFKEFP
GPMI_MYCS5       ------------------MKKVILVVIDGLGLRSEIH---GNAFQMANTPFFDKLFSEYP
GPMI_MYCMO       -----------------MKKTVILSVIDGLGLREEKQ---GNAFKLAKTPNFDKLFNEYP
GPMI_MYCHP       ------------------MKKIILTIIDGLGLRKERQ---GNAYLQAKHPCFDYLFSMCP
GPMI_MYCH7       -----------------MKKKLVLIIIDGLGLRLESQ---GNGFALAKTPVFDRLFQEYP
GPMI_MYCHJ       -----------------MKKKLVLIIIDGLGLRLESQ---GNGFALAKTPVFDRLFQEYP
GPMI_MYCH2       ----------MQKNRKNVKKKLVLIIIDGLGLRFESQ---GNGFALAKTPVFDRLFQEYP
GPMI_UREP2       ---------------MKLNKKIGLIIIDGLGIGKEDN---TNAVHLANPPTLNYLINNFP
GPMI_UREPA       ---------------MKLNKKIGLIIIDGLGIGKEDN---TNAVHLANPPTLNYLINNFP
GPMI_MYCCT       ---------------MKVKRPILLAILDGWGLAEPDK---GNAVDNANMIFVKQLKQTYP
                                        : : ** .          .                  

GPMI_CLOAB       HTHLGASGLSVGLPDGQMGNSEVGHLNIGAGRIVYQSLTKITKAIEDG------------
GPMI_CLONN       HTVLGASGLSVGLPDGQMGNSEVGHLNIGAGRIVYQALTRITKSIEDG------------
GPMI_CLOB1       HTQLGASGMDVGLPEGQMGNSEVGHLNIGAGRIVYQALTKITKSISDG------------
GPMI_CLOBL       HTQLGASGMDVGLPEGQMGNSEVGHLNIGAGRIVYQALTKITKSISDG------------
GPMI_CLOK5       HTELGASGLSVGLPEGQMGNSEVGHLNIGAGRIVYQALTRITKSINEG------------
GPMI_CLOPE       HTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQELTRITKEIKEG------------
GPMI_CLOP1       HTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQELTRITKEIKEG------------
GPMI_CLOPS       HTELQASGLEVGLPEGQMGNSEVGHLNIGAGRIIYQELTRITKEIKEG------------
GPMI_CLOB8       TSQLQASGLAVGLPEGQMGNSEVGHLNIGSGRIVYQELTRITKAIADG------------
GPMI_CLOTE       HTQLKASGLNVGLPEGQMGNSEVGHLNIGSGRVIYQELTRITKDINDG------------
GPMI_CLOD6       NTLINASGLDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKSIKDG------------
GPMI_HUNT2       NTIVRTSGMDVGLPDGQMGNSEVGHTNIGAGRIVYQELTRITKSIQDG------------
GPMI_LACP7       FVKGNASGMAVGLPEGQMGNSEVGHLNMGAGRIVYQELTRITKEIQDG------------
GPMI_BACSU       HQTLTASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREG------------
GPMI_BACVZ       HQTLTASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREG------------
GPMI_BACP2       HQTLTASGEAVGLPQGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIRDG------------
GPMI_BACLD       HQTLTASGEAVGLPDGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREG------------
GPMI_GEOSE       HTTLKACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRINIAIREG------------
GPMI_GEOKA       HTMLKACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNIAIREG------------
GPMI_GEOTN       HATLKACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNIAIREG------------
GPMI_BACMQ       HATLQASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREG------------
GPMI_BACAH       HTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREG------------
GPMI_BACC1       HTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREG------------
GPMI_BACCR       HTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREG------------
GPMI_BACHK       HTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREG------------
GPMI_BACCZ       HTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREG------------
GPMI_BACAN       HTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREG------------
GPMI_BACCN       HTTLTACGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREG------------
GPMI_BACHD       HALLKADGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNLSIREG------------
GPMI_BACSK       HATLRADGENVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNLSIREG------------
GPMI_OCEIH       HNQLEASGKAVGLPDGQMGNSEVGHLNIGAGRIVYQSLTRVNVSIDEG------------
GPMI_STAAS       TTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIEDG------------
GPMI_STAAW       TTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIEDG------------
GPMI_STAAC       TTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIEDG------------
GPMI_STAAM       TTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIEDG------------
GPMI_STAAN       TTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIEDG------------
GPMI_STAAR       TTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIEDG------------
GPMI_STAEQ       TTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIEDG------------
GPMI_STAES       TTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIEDG------------
GPMI_STAHJ       TTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRIVYQSLTRINKSIADG------------
GPMI_STAS1       TTQIEASGLDVGLPEGQMGNSEVGHMNIGAGRVVYQSLTRINKSIEDG------------
GPMI_LISMF       HGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEG------------
GPMI_LISMO       HGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEG------------
GPMI_LISIN       HGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEG------------
GPMI_LISW6       HGELKAAGLDVGLPEGQMGNSEVGHTNIGAGRIVYQSLTRIDKAIEEG------------
GPMI2_METAC      WCFLECSGEAVGLPEGQMGNSEVGHLNIGAGRVVYQDLTRINLSVRNG------------
GPMI_METMA       SCFLETSGEAVGLPQGQMGNSEVGHLNIGAGRVVYQDLTKINVSIRNG------------
GPMI1_METBF      WCFLEASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQDLTRINFSIRKG------------
GPMI1_METAC      WCLLEASGGAVGLPEGMMGNSEDGHLNIGAGRIVYQNLTRINISIRNG------------
GPMI2_METBF      WCFLKASGEAVGLPKGMMGNSEVGHLTIGAGRIVNQDLTRINISIKNG------------
GPMI_METBU       NTLLSASGEDVGLPEGQMGNSEVGHLNIGAGRVVYQDLTRINRDIGNG------------
GPMI_PSEF5       NGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDG------------
GPMI_PSEPF       NGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDG------------
GPMI_PSEU2       NGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDG------------
GPMI_PSE14       NGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDG------------
GPMI_PSESM       NGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDG------------
GPMI_PSEP1       HGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDG------------
GPMI_PSEPK       HGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDG------------
GPMI_PSEPG       HGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDG------------
GPMI_PSEE4       HGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDG------------
GPMI_PSEAB       HGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDG------------
GPMI_PSEAE       HGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDG------------
GPMI_PSEA7       HGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDG------------
GPMI_PSEMY       HGLISGSGMDVGLPDGQMGNSEVGHMNLGAGRVVYQDFTRVTKAIRDG------------
GPMI_ACIAD       HSLISGSGEDVGLPDGQMGNSEVGHMNLGAGRVLYQDFTRITKDIRDG------------
GPMI_SHEB5       HSLISGSGLDVGLPDGQMGNSEVGHINLGSGRVVYQELTRISKAIADH------------
GPMI_SHEB8       HSLISGSGLDVGLPDGQMGNSEVGHINLGSGRVVYQELTRISKAIADH------------
GPMI_SHEB9       HSLISGSGLDVGLPDGQMGNSEVGHINLGSGRVVYQELTRISKAIADH------------
GPMI_SHEPC       HGLISGSGLDVGLPDGQMGNSEVGHINLGSGRIVYQELTRISKAISDH------------
GPMI_SHESW       HGLISGSGLDVGLPDGQMGNSEVGHINLGSGRIVYQELTRISKAISDH------------
GPMI_SHESR       HGLISGSGLDVGLPDGQMGNSEVGHINLGSGRIVYQELTRISKAIADH------------
GPMI_SHESA       HGLISGSGLDVGLPDGQMGNSEVGHINLGSGRIVYQELTRISKAIADH------------
GPMI_SHESM       HGLISGSGLDVGLPDGQMGNSEVGHINLGSGRIVYQELTRISKAIADH------------
GPMI_SHEON       HGLISGSGLDVGLPDGQMGNSEVGHINLGSGRIVYQELTRISKAIADH------------
GPMI_SHEDO       NSLISGSGLDVGLPDGQMGNSEVGHINIGSGRVVYQELTRVSKAIEEG------------
GPMI_SHEHH       NSLISGSGIDVGLPDGQMGNSEVGHINIGSGRIVYQELTRISKAIDDG------------
GPMI_SHEPA       NSLISGSGIDVGLPDGQMGNSEVGHINIGSGRIVYQELTRISKAIDDG------------
GPMI_SHELP       NSLISGSGLDVGLPDGQMGNSEVGHINIGSGRVVYQELTRIGKSIEDG------------
GPMI_SHESH       NSLISGSGLDVGLPDGQMGNSEVGHINIGSGRIVYQELTRIGKAIEDG------------
GPMI_ECOK1       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKDR------------
GPMI_ECOL5       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKDR------------
GPMI_ECOL6       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKDR------------
GPMI_SHIBS       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKDR------------
GPMI_ECO57       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKDR------------
GPMI_ECO24       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKDR------------
GPMI_ECOHS       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKDR------------
GPMI_ECOLC       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKDR------------
GPMI_SHISS       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKDR------------
GPMI_ECOLI       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKDR------------
GPMI_SHIFL       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKDR------------
GPMI_SHIDS       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKDR------------
GPMI_SALPA       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKER------------
GPMI_SALTY       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKER------------
GPMI_SALTI       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKER------------
GPMI_SALPB       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKER------------
GPMI_SALCH       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKER------------
GPMI_ENT38       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKER------------
GPMI_CROS8       HTLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKER------------
GPMI_YERPA       HTLIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEG------------
GPMI_YERPP       HTLIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEG------------
GPMI_YERPN       HTLIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEG------------
GPMI_YERPE       HTLIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEG------------
GPMI_YERPS       HTLIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEG------------
GPMI_YERP3       HTLIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKDG------------
GPMI_YERE8       HTLIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKDG------------
GPMI_SERP5       HQLIAASGLDVGLPDGQMGNSEVGHVNLGAGRIVYQDLTRLDKEIKEG------------
GPMI_VIBC3       HTLISASGMDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKAIMDG------------
GPMI_VIBCH       HTLISASGMDVGLPDGQMGNSEVGHTNIGAGRIVYQDLTRITKAIMDG------------
GPMI_VIBPA       HTLISASGMDVGLPDGQMGNSEVGHTNIGAGRVVYQDLTRITKSIADG------------
GPMI_VIBCB       NTLISASGMDVGLPDGQMGNSEVGHTNIGAGRVVYQDLTRITKSIADG------------
GPMI_VIBVU       NTLISASGMDVGLPDGQMGNSEVGHTNIGAGRVVYQDLTRITKSILDG------------
GPMI_VIBVY       NTLISASGMDVGLPDGQMGNSEVGHTNIGAGRVVYQDLTRITKSILDG------------
GPMI_ALIF1       NTLISASGMDVGLPDGQMGNSEVGHTNIGAGRVVYQDLTRITKAISDG------------
GPMI_PHOPR       NTLISASGFDVGLPDGQMGNSEVGHTNIGAGRVVYQDLTRITKSIADG------------
GPMI_AERS4       STLISGSGLDVGLPDGQMGNSEVGHVNIGAGRIVYQELTRISKEIKDG------------
GPMI_PSYIN       NNLLSASGMDVGLPDGQMGNSEVGHTNIGAGRTVYQNLTKVTKSISDG------------
GPMI_PSEHT       RTLISASGFDVGLPDGQMGNSEVGHVNLGAGRVVYQDFTRITKAINDG------------
GPMI_PSEA6       NTLISASGMDVGLPGGQMGNSEVGHVNLGAGRVVYQDFTRVTKAIEDG------------
GPMI_COLP3       NMLIDTSGMAVGLPEGQMGNSEVGHVNLGAGRVVYQDFTRITKAISDG------------
GPMI_IDILO       HCLVDGSGGAVGLPDGQMGNSEVGHVNLGAGRIVYQDFTRISKAISDR------------
GPMI_HAHCH       HVLIHTSGMAVGLPEGQMGNSEVGHMNLGAGRIVYQNFTRITKDIEDG------------
GPMI_SACD2       KTTIATSGMAVGLPEGQMGNSEVGHMTLGAGRVVYQNFTRINKAIADG------------
GPMI_CHRSD       STLLHTDGKYVGLPDGQMGNSEVGHMNLGAGRIVYQDFTRITKAIEDN------------
GPMI_METFK       HTLINASETFVGLPRGQMGNSEVGHLNIGAGRVVFQDFERINQAIASR------------
GPMI_CHRVO       YGTINASENFVGLPSGQFGNSEVGHLNIGAGRIVQQDISRIDCDIEDG------------
GPMI_THIDA       HTLIHASESEVGLPKGQMGNSEVGHLNIGAGRVVYQEFTRIDRAIESG------------
GPMI_COXBU       HTLLEASGRAVGLPDGQMGNSEVGHLHIGGGRKVPQDLTRIDAAIASG------------
GPMI_COXBR       HTLLEASGRAVGLPDGQMGNSEVGHLHIGGGRKVPQDLTRIDAAIASG------------
GPMI_COXBN       HTLLEASGRAVGLPDGQMGNSEVGHLHIGGGRKVPQDLTRIDAAIASG------------
GPMI_VESOH       HSLIHTSGKDVGLPGKQMGNSEVGHLNLGAGRIVKQDFTRIYNELQNG------------
GPMI_RUTMC       HSLIHTSGKDVGLPGKQMGNSEVGHLNLGAGRIVKQDFTRIYNELQNG------------
GPMI_NITOC       HTIIRASGAEVGLPNEQMGNSEVGHLNLGSGRVIYQEYTRVNRALRTG------------
GPMI_HYDCU       HTLINTSGLAVGLPEGQMGNSEVGHMNLGAGRVVYQELTRIQKDIDDG------------
GPMI_FRATF       KTLINASSLEVGLPRSQMGNSEVGHVNIGCGRVVYQELTKIDKAIEEK------------
GPMI_FRATH       KTLINASSLEVGLPRSQMGNSEVGHVNIGCGRVVYQELTKIDKAIEEK------------
GPMI_FRATW       KTLINASSLEVGLPRSQMGNSEVGHVNIGCGRVVYQELTKIDKAIEEK------------
GPMI_FRAT1       KTLINASSLEVGLPRSQMGNSEVGHVNIGCGRVVYQELTKIDKAIEEK------------
GPMI_FRATT       KTLINASSLEVGLPRSQMGNSEVGHVNIGCGRVVYQELTKIDKAIEEK------------
GPMI_FRATN       KTLINASSLEVGLPRGQMGNSEVGHVNIGCGRVVYQELTKIDKAIEEK------------
GPMI_FRAP2       RTLISASSLEVGLPRGQMGNSEVGHVNIGCGRVVYQELTKIDKAIEEK------------
GPMI_LEGPH       HILLKASGLPVGLPDEQMGNSEVGHMHIGAGRVIQQDFTRINEAINNG------------
GPMI_LEGPL       HILLKASGLPVGLPDEQMGNSEVGHMHIGAGRVIQQDFTRINEAINNG------------
GPMI_LEGPA       HILLKASGLPVGLPDEQMGNSEVGHMHIGAGRVIQQDFTRINEAINNG------------
GPMI_LEGPC       HILLKASGLPVGLPDEQMGNSEVGHMHIGAGRVIQQDFTRINEAINNG------------
GPMI_GEOSL       SVEMETSGMAVGLPDGQMGNSEVGHLNIGAGRVVYQDLTRITKSIDDG------------
GPMI_PELCD       HARIGASGRDVGLPDGQMGNSEVGHLNIGAGRTVYQDLTRISLSIEED------------
GPMI_SYMTH       HTTLTASGEAVGLLPGQMGDSNVGHLNLGAGRIVYQTLVRIWRSIQDG------------
GPMI_RHOS1       NATLVTHGPDVGLPRGQMGNSEVGHTNIGAGRVVAMDLGAIDLAIEEG------------
GPMI_RHOS4       NATLVTHGPDVGLPRGQMGNSEVGHTNIGAGRVVAMDLGAIDLAIEEG------------
GPMI_RHOS5       NATLITHGPDVGLPRGQMGNSEVGHTNIGAGRVVAMDLGAIDLAIEEG------------
GPMI_DINSH       NATLTTFGPDVGLPSGQMGNSEVGHTNIGAGRVVAMDLGQIDLAIEDG------------
GPMI_PARDP       HGTLVTFGPDVGLPKGQMGNSEVGHTNIGAGRVVAMDLGQIDLAIEDG------------
GPMI_ROSDO       HATLTTFGPDVGLPSGQMGNSEVGHTNIGAGRVVAMDLGQIDLAIEEG------------
GPMI_RUEPO       HARLITHGPDVGLPSGQMGNSEVGHTNIGAGRVVAMDLGQIDLAIEDG------------
GPMI_RUEST       TARLVTHGPDVGLPSGQMGNSEVGHTNIGAGRVVAMDLGQIDLAIEDG------------
GPMI_AGRFC       NATLTTFGPNVGLPTGQMGNSEVGHTNIGAGRIVAMDLGQIDLAIEDG------------
GPMI_RHOPA       HAFLRTSGKSVGLPNGQMGNSEVGHLNIGAGRVVMQDLPRISDAIANG------------
GPMI_GLUOX       HAFLKTSGEDVGLPDGQMGNSEVGHLNIGAGRVVMQELPRISRSARDG------------
GPMI_MAGMM       HAQVRTSGRDVGLPDGQMGNSEVGHLNLGAGRVVYQEFTRVSCAIEDG------------
GPMI_LAWIP       GTQIHASGRAVGLPDGYMGNSEVGHLNIGAGRVVYQQMTRIDVAIENK------------
GPMI_DESVH       CTELACSGRAVGLPEGFMGNSEVGHMNIGAGRVVYQDMTRIDIAVERG------------
GPMI_RHOBA       SVLIHTSGEDVGLPAGVMGNSEVGHQNIGAGRIVDQEVMRITRAIRDD------------
GPMI_SYNY3       NTLVNTSGKDVGLPKGQMGNSEVGHLNLGAGRVVPQELVRISDAIEDG------------
GPMI_MICAN       HTLIRTSAKDVGLPEGQMGNSEVGHLNIGAGRVVPQELVRISDAIEDG------------
GPMI_NOSS1       HTLIHTSGKAVGLPEGQMGNSEVGHLNIGAGRVVPQELVRISDAVEDG------------
GPMI_TRIV2       HTLIHTSGKAVGLPEGQMGNSEVGHLNIGAGRVVPQELVRISDAVEDG------------
GPMI_TRIEI       RTLIQASGKAVGLPEGQMGNSEVGHLNIGAGRVVPQELVRISDAIEDG------------
GPMI_SYNE7       STLIHTSGKDVGLPDGQMGNSEVGHLNLGAGRIVPQELVRITDAVEDG------------
GPMI_SYNP6       STLIHTSGKDVGLPDGQMGNSEVGHLNLGAGRIVPQELVRITDAVEDG------------
GPMI_ACAM1       STFIQTSGKAVGLPAGQMGNSEVGHLNLGAGRTVPQELVRIADAIEDG------------
GPMI_SYNJA       HTLLQASGRAVGLPSGQMGNSEVGHLTLGAGRVVPQELVRISDAIETG------------
GPMI_SYNJB       HTLLQASGRAVGLPAGQMGNSEVGHLTLGAGRVVPQELVRISDAIETG------------
GPMI_THEEB       HTLIHTSGKAVGLPKGQMGNSEVGHLNIGAGRIVPQELVRISDAVEEG------------
GPMI_GLOVI       FTLIHTSGKAVGLPRGQMGNSEVGHLNLGAGRMVPQELVRISDAVEEG------------
GPMI_PROM1       HTLIEASGADVGLPDEQMGNSEVGHLTIGAGRIIQQELVRISNTVKEN------------
GPMI_PROMT       HTLIEASGADVGLPDEQMGNSEVGHLTIGAGRIIQQELVRISNTVKEN------------
GPMI_PROM3       HTLIEASGAAVGLPDNQMGNSEVGHLTIGAGRVIRQELVRISETVQTG------------
GPMI_PROMM       HTLIEASGAAVGLPDNQMGNSEVGHLTIGAGRVIRQELVRISETVQAG------------
GPMI_SYNPX       HALIQASGSHVGLPDHQMGNSEVGHLTIGAGRIIRQELVRISDTVRDD------------
GPMI_PROMA       HTLIEASGADVGLPDNQMGNSEVGHLTIGAGRIIQQELVRISNTIRSK------------
GPMI_PROMP       HTLINASGADVGLPNGQMGNSEVGHLTIGSGRIIQQELVRITNVVKNN------------
GPMI_GRATL       NTLLNASGRDVGLPEGQMGNSEVGHTTIGAGRIINQDLVRISKSIEDR------------
GPMI_ANTSP       KTLLSASGEHVGLPHKQMGNSEVGHTTIGAGRIINQDLVKISKSIKNK------------
GPMI_PORPU       NTLLVASGEEVGLPKGQMGNSEVGHTTIGGGRVVEQELVKIGNSIENK------------
GPMI_PYRYE       STLLAASGQEVGLPKGQMGNSEVGHTTIGGGRVIQQELVKIGNSIVDN------------
GPMI_NATPD       TGQLETHGRSVGLPDGQMGNSEVGHLNIGAGRVVKQDSTRVTDDIDAG------------
GPMI_HALMA       ASTLTTHGRRVGLPEGQMGNSEVGHLNIGAGRVVKQDSARVSDSIARSRGEAPPDDDAQD
GPMI_HALSA       FGTLTTSGRDVGLPDGQMGNSEVGHLTIGAGRVVKQAYTRIEDAIAAG------------
GPMI_HALWD       NGTLDVSGRQVGLPAGQMGNSEVGHLNIGAGQVVKQAYTRVEDAIDNG------------
GPMI_STRCO       STLAEASGEAVGLLPGTVGNSEIGHMVIGAGRPLPYDSLLVQQAIDSG------------
GPMI_FLAJ1       SAQLRTDGLNVGLPEGQMGNSEVGHMNLGAGRIVYQDLAKINLAVAHK------------
GPMI_FLAPJ       SAQLRTDGLNVGLPEGQMGNSEVGHMNLGAGRIVYQDLAKINLAVQNK------------
GPMI_BACFR       HSQLQASGENVGLPDGQMGNSEVGHLNIGAGRVVYQDLVKINLSCRDN------------
GPMI_BACFN       HSQLQASGENVGLPDGQMGNSEVGHLNIGAGRVVYQDLVKINLSCRDN------------
GPMI_BACTN       HSQLQASGENVGLPDGQMGNSEVGHLNIGAGRVVYQDLVKINRACADN------------
GPMI_BACV8       HSELQASGENVGLPDGQMGNSEVGHLNIGAGRIVYQDLVKINRACADN------------
GPMI_PARD8       ASQLQASGENVGLPDGQMGNSEVGHLNIGAGRIVYQDLVKINIACREN------------
GPMI_HELPY       YSLIDTHGLSVGLPKGQMGNSEVGHMCIGAGRVLYQDLVKISLSLQND------------
GPMI_HELPH       YSLIDTHGLSVGLPEGQMGNSEVGHMCIGAGRVLYQDLVKISLSLQND------------
GPMI_HELPJ       YSLIDTHGLSVGLPKGQMGNSEVGHMCIGAGRVLYQDLVRISLSLQND------------
GPMI_HELAH       YSLIDTHGLSVGLPKGQMGNSEVGHMCIGAGRVLYQDLVKISLSLQND------------
GPMI_HELHP       YGMIDTFGLSVGLPQGQMGNSEVGHMCIGSGRVLYQDLVRISRAIEYD------------
GPMI_WOLSU       HALLSTHGLSVGLPEGQMGNSEVGHMCIGAGRILYQDLVKISLALKDG------------
GPMI_ARCB4       YSLIHTYGEYVGLPDMQMGNSEVGHMTIGSGRVLYQDLVKIHLAIKND------------
GPMI_SULDN       HSFIETHGLSVGLPEGQMGNSEVGHMSMGSGRVLYQDLVKISLSLSEN------------
GPMI_CAMJ8       NSLLKTSGLAVGLPEGQMGNSEVGHMCIGSGRIIYQNLVRINKAIENK------------
GPMI_CAMJR       NSLLKTSGLAVGLPEGQMGNSEVGHMCIGSGRIIYQNLVRINKAIENK------------
GPMI_CAMJJ       NSLLKTSGLAVGLPEGQMGNSEVGHMCIGSGRIIYQNLVRINKAIENK------------
GPMI_CAMJE       NSLLKTSGLAVGLPEGQMGNSEVGHMCIGSGRIIYQNLVRINKAIENK------------
GPMI_CAMJD       NSLLKTSGLAVGLPEGQMGNSEVGHMCIGSGRIIYQNLVRINKAIKNK------------
GPMI_EHRRW       QSNIVTHGPDVGLPDRQIGNSEVGHISLGSGRIVLQDLCRINEEIKN-------------
GPMI_EHRRG       QSNIVTHGPDVGLPDRQIGNSEVGHISLGSGRIVLQDLCRINEEIKN-------------
GPMI_EHRCJ       KSHLITHGSSVGLPDGQIGNSEVGHVNLGSGRIVLQDLCKINNEIKY-------------
GPMI_EHRCR       KSQLITHGLNVGLPDGQIGNSEVGHVNLGSGRIVLQDLCKINNEIKY-------------
GPMI_ANAPZ       MSSLSASGTDVGLPSGQVGNSEVGHISIGCGRIVLQDLLRINLEINE-------------
GPMI_ANAMM       RSSLSASGEDVGLPAAQVGNSEVGHISLGAGRVVLQDLQRINAEIGE-------------
GPMI_WOLPM       KCSLSACGADVGLPGGQIGNSEVGHMNIGSGRVVIQSLQRINQEIGT-------------
GPMI_WOLTR       RCSLSACGTDVGLPDGQIGNSEVGHMNICSGRVVMQSLQRIDREIKT-------------
GPMI_ONYPE       NTTLKASGEEVGLPQGQMGNSEVGHLNLGAGRVVYQSLTQINKAIRDK------------
GPMI_AYWBP       NTTLKASGEEVGLPQGQMGNSEVGHLNLGAGRVVYQSLTQINKAIRDK------------
GPMI_ACHLI       NSTLVTSGEAVGLPEGQMGNSEVGHLNLGAGRIVWQSLSRINVAIKDG------------
GPMI_MYCGE       CVLLDASGEAVGLPMGQIGNSEVGHLNIGAGRVVYTGLSLINQHIKDR------------
GPMI_MYCPN       CVMLEASGEAVGLPQGQIGNSEVGHLNIGAGRIVYTGLSLINQNIKTG------------
GPMI_MYCGA       TIMLQASGEAVGLPKNQIGNSEVGHLNIGAGRIIYTGLSLINKEIENK------------
GPMI_MYCPE       HCYIEASGEYVGLPDGQIGNSEVGHLTIGAGRIVYTGLSLINQDIKTK------------
GPMI_MYCPU       WSFIQASGKFVGLPEGQMGNSEVGHLNIGAGQIVYTGLSLINKDLEEK------------
GPMI_MYCS5       NTLIQASGEYVGLPDGQIGNSEVGHLNIGAGRVVYTGLSLINKALKDD------------
GPMI_MYCMO       NSVIQASGDYVGLPDDQMGNSEVGHLNIGAGQIVYTGLSLINKDIKDN------------
GPMI_MYCHP       NSVLQASGQYVGLPEGQIGNSEVGHLNIGAGRVVYTGLSLINKAIENN------------
GPMI_MYCH7       NSLIAASGQEVGLPEGQMGNSEVGHLNIGAGFVVYTGISIINNALKTG------------
GPMI_MYCHJ       NSLIAASGQEVGLPEGQMGNSEVGHLNIGAGFVVYTGISIINNALKTG------------
GPMI_MYCH2       NSLIAASGQEVGLPEGQMGNSEVGHLNIGAGFVVYTGISIINNALKTG------------
GPMI_UREP2       TLQISAAQQNIGLLENQAGNSEIGHLTIGAGRIILNDNANINNYMKSV------------
GPMI_UREPA       TLQISAAQQNIGLLENQAGNSEIGHLTIGAGRIILNDNANINNYMKSV------------
GPMI_MYCCT       WLKAHASGKWVGLPENQMGNSEVGHIHLGAGRINLESLAKLNHETKTN------------
                           :**     *:*: **  :  *         :                   

GPMI_CLOAB       -DFFKNAALNKAVNNVLEND--STLHLMGLLSPGGVHSHTNHLKGLLQLAKKKNVKK--V
GPMI_CLONN       -DIFKNEALLKAIDNAKNND--SAIHFMGLLSDGGVHSHIDHLKGLIDFAAKSGVKK--V
GPMI_CLOB1       -DFFENVALNKAIENVKKNN--STLHLLGLLSPGGVHSHIDHLKGLIKLAKEKDIKK--V
GPMI_CLOBL       -DFFENVALNKAIENAKKNN--STLHLLGLLSPGGVHSHIDHLKGLIKLAKEKDIKK--V
GPMI_CLOK5       -QFFKNEVLNSAVDNAVKNN--SDLHLLGLVSPGGVHSHTNHLKGLLQLAKQKGASR--V
GPMI_CLOPE       -TFFTNKALVKAMDEAKENN--TSLHLMGLLSNGGVHSHIDHLKGLLELAKKKGLQK--V
GPMI_CLOP1       -TFFTNKALVKAMDEAKENN--TSLHLMGLLSNGGVHSHIDHLKGLLELAKKKGLQK--V
GPMI_CLOPS       -TFFTNKALVKAMDEAKENN--TSLHLMGLLSNGGVHSHIDHLKGLLELAKKKGLQK--V
GPMI_CLOB8       -DFFENESLKLAMTNAKKTG--SSLHLMGLLSDGGVHSHIEHLRGLLEFAKKEEVQN--V
GPMI_CLOTE       -VFFENTEINYAIDEAIKNN--SSLHLLGLLSDGGVHSHIDHLKAILKLAKDKGLNR--V
GPMI_CLOD6       -DFFTNKVLCEAMDNAKEN----SLHVMGLLSDGGVHSHIDHLKAIIKMAKDKGVQK--V
GPMI_HUNT2       -DFFEKKEFLDAAENCRKHN--SKLHLFGLLSDGGVHSHNTHLYGLLEFAKRQNLKD--V
GPMI_LACP7       -DFFENTQLIKAVENCKKNN--TALHLFGLLSDGGVHSHITHLYGLLELAKRHGLEN--V
GPMI_BACSU       -EFERNQTFLDAISNAKENN--KALHLFGLLSDGGVHSHINHLFALLKLAKKEGLTK--V
GPMI_BACVZ       -EFERNQTFLDAIKNAKDND--KALHLFGLLSDGGVHSHINHLFALLKLAKSEGLTK--V
GPMI_BACP2       -EFEKNETFLEAMTYAKEND--KALHLFGLLSDGGVHSHIQHLFALLKLAKKEGLTK--V
GPMI_BACLD       -EFEQNETFLAAMKHVKEKG--TNLHLFGLLSDGGVHSHIHHLYALLKLAKKEGVEN--V
GPMI_GEOSE       -EFDRNETFLAAMNHVKQHG--TSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKR--V
GPMI_GEOKA       -EFDRNETFLAAMNHVKQHG--TSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKR--V
GPMI_GEOTN       -EFDRNETFLAAMNHVKQHG--TSLHLFGLLSDGGVHSHIHHLYALLRLAAKEGVKR--V
GPMI_BACMQ       -EFEQNETLLAAVKHAKEKG--TNLHLFGLLSDGGVHSHIEHLYALLRLAKSEGLEK--V
GPMI_BACAH       -EFDKNETFQSAIKSVKEKG--TALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEK--V
GPMI_BACC1       -EFDKNETFQSAIKSVKEKG--TALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEK--V
GPMI_BACCR       -EFDKNETFQSAIKSVKEKG--TALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEK--V
GPMI_BACHK       -EFDKNETFQSAIKSVKEKG--TALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEK--V
GPMI_BACCZ       -EFDKNETFQSAIKSVKEKG--TALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEK--V
GPMI_BACAN       -EFDKNETFQSAIKSVKEKG--TALHLFGLLSDGGVHSHMNHMFALLRLAAKEGVEK--V
GPMI_BACCN       -EFDKNETFQNAIKHVKEKG--TALHLFGLLSDGGVHSHIDHMFALLRLAAKEGVEK--V
GPMI_BACHD       -EFFENETFLNAMNHVKEKG--SSLHIYGLVSDGGIHSHINHLYALLELAKREQVER--V
GPMI_BACSK       -DFFKNETFIKAMDHVKEKQ--SALHIYGLLSDGGIHSHIDHIYALLDMAKQQNVER--V
GPMI_OCEIH       -DFYEVDAFIKSVEHAKKHD--KALHLFGLLSDGGVHSHINHLFALLRLAKKHELEN--V
GPMI_STAAS       -DFFENDVLNNAIAHVNSHD--SALHIFGLLSDGGVHSHYKHLFALLELAKKQGVEK--V
GPMI_STAAW       -DFFENDVLNNAIAHVNSHD--SALHIFGLLSDGGVHSHYKHLFALLELAKKQGVEK--V
GPMI_STAAC       -DFFENDVLNNAIAHVNSHD--SALHIFGLLSDGGVHSHYKHLFALLELAKKQGVEK--V
GPMI_STAAM       -DFFENDVLNNAIAHVNSHD--SALHIFGLLSDGGVHSHYKHLFALLELAKKQGVEK--V
GPMI_STAAN       -DFFENDVLNNAIAHVNSHD--SALHIFGLLSDGGVHSHYKHLFALLELAKKQGVEK--V
GPMI_STAAR       -DFFENDVLNNAIAHVNSHD--SALHIFGLLSDGGVHSHYKHLFALLELAKKQGVEK--V
GPMI_STAEQ       -EFFDNTVLNNAVKHVKDNG--SALHVFGLLSDGGVHSHYKHLFAILELAKKQGIDK--V
GPMI_STAES       -EFFDNTVLNNAVKHVKDNG--SALHVFGLLSDGGVHSHYKHLFAILELAKKQGIDK--V
GPMI_STAHJ       -DFFENDVLNNAVQHVNEHD--SALHVFGLLSDGGVHSHYQHLFALLELAKQKGLDK--V
GPMI_STAS1       -DFFENDVLNNAINHVKKND--SVLHVFGLLSDGGVHSHYKHLFALLDLAKKQGLEK--V
GPMI_LISMF       -EFQENKALNNAFTHTKENN--SDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKN--V
GPMI_LISMO       -EFQENKALNNAFTHTKENN--SDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKN--V
GPMI_LISIN       -EFQENKALNNAFTHTKENN--SDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKN--V
GPMI_LISW6       -EFQENKALNNAFTHTKENN--SDLHLFGLLSDGGVHSHINHLVALLETAKDKGVKN--V
GPMI2_METAC      -DFFENPVLLDAISNVKLND--SSLHLMGLVSYGGVHSYMTHLYALIKLARDKGLKK--V
GPMI_METMA       -DFFENPVLLDAISNVKLNN--SSLHLMGLVSYGGVHSHMTHLYALIKLAQEKGLKK--V
GPMI1_METBF      -DFFKNPAFLGAISNAKAND--SSLHLMGLVSYGGVHSYMAHIHALIKLAQQEGVKK--V
GPMI1_METAC      -DFFKNPVFLNAISKVKAND--SSLHLIGLVSCGGVHSYTPHLHALIKLAKEKGLKK--V
GPMI2_METBF      -DFFKNPVFLNAISNVKANA--SSLHLMGLASCGGIHSYMPHLHALLKLVQEKDLKK--V
GPMI_METBU       -DFFKNPVLKQAIENAKAQG--SALHLMGLFSYGGVHSHMKHLRALIEFAKDEGITE--I
GPMI_PSEF5       -EFFENPTICAAVDKAVDAG--KAVHILGLLSDGGVHSHQDHLIAMAELAFKRGAEK--I
GPMI_PSEPF       -EFFENPTICAAVDKAVAAG--KAVHFMGLLSDGGVHSHQDHLIAMAELAFKRGAEK--I
GPMI_PSEU2       -EFFENPTICAAVDKAVSAG--KAVHIMGLLSDGGVHSHQDHLVAMAELAVKRGAEK--I
GPMI_PSE14       -EFFENPTICAAVDKAVGAG--KAVHIMGLLSDGGVHSHQGHLVAMAELAVKRGAEK--I
GPMI_PSESM       -EFFENPTICAAVDKAVSAG--KAVHIMGLLSDGGVHSHQDHLVAMAELAVRRGADK--I
GPMI_PSEP1       -EFFENPVLTGAVDKAVGAG--KAVHILGLLSDGGVHSHQDHLVAMAKLAAQRGAEK--I
GPMI_PSEPK       -EFFENPVLTGAVDKAVGAG--KAVHILGLLSDGGVHSHQDHLVAMAELAAQRGAEK--I
GPMI_PSEPG       -EFFKNPVLTGAVDKAASAG--KAVHILGLLSDGGVHSHQDHLVAMAELAAQRGAEK--I
GPMI_PSEE4       -EFFENPVLTGAVDKAASAG--KAVHILGLLSDGGVHSHQDHLIAMAELAAQRGAEK--I
GPMI_PSEAB       -EFFENPVIAAAVDKAVAAD--KAVHILGLLSPGGVHSHEDHLVAMAQMAARRGAGK--I
GPMI_PSEAE       -EFFENPVIAGAVDKAVAAD--KAVHILGLLSPGGVHSHEDHLVAMAQMAARRGAGK--I
GPMI_PSEA7       -EFFDNPVIASAVDKAVAAD--KAVHILGLLSPGGVHSHEDHLVAMAQMAARRGAGK--I
GPMI_PSEMY       -EFFDNAAINQAVDKAVAAG--KAVHILGLLSDGGVHSHQDHIVAMAELAARRGAEK--I
GPMI_ACIAD       -VFFEHEVLVDAVEKAKAVH--GAVHIMGLLSEGGVHSHEDHIVAMCELALKRGA-T--V
GPMI_SHEB5       -EFEQNPALCDAVDSAIKAG--GAVHIMGLLSAGGVHSHEEHIEAMCRMAVARGATK--V
GPMI_SHEB8       -EFEQNPALCDAVDSAIKAG--GAVHIMGLLSAGGVHSHEEHIEAMCRMAVARGATK--V
GPMI_SHEB9       -EFEQNPALCDAVDSAIKAG--GAVHIMGLLSPGGVHSHEEHIEAMCRMAVARGATK--V
GPMI_SHEPC       -EFETNPALCDAVDSAINAG--GAVHIMGLLSPGGVHSHEEHIEAMCRMAVARGATK--V
GPMI_SHESW       -EFETNPALCDAVDSAINAG--GAVHIMGLLSPGGVHSHEEHIEAMCRMAVARGATK--V
GPMI_SHESR       -EFEQNPALCDAVDAAVKAG--GAVHIMGLLSPGGVHSHEEHIEAMCRMAVARGATK--V
GPMI_SHESA       -EFEQNPALCDAVDAAVKAG--GAVHIMGLLSPGGVHSHEEHIEAMCRMAVARGATK--V
GPMI_SHESM       -EFEQNPALCDAVDVAVKAG--GAVHIMGLLSPGGVHSHEEHIEAMCRMAVARGATK--V
GPMI_SHEON       -EFEQNPALCDAVDAAVKTG--GAVHIMGLLSPGGVHSHEEHIEAMCRMAVARGATK--V
GPMI_SHEDO       -EFEENTVLCKTIDDAIKAN--GAVHIMGLLSPGGVHSHEEHIEAMCRMAVKRGAKQ--V
GPMI_SHEHH       -EFDTNPTLIKAIDDAIKAD--AAVHIMGLLSPGGVHSHQDHIEAMCRLSVKRGAKK--V
GPMI_SHEPA       -EFDTNPALTKAIDDAIEVN--GAVHIMGLLSPGGVHSHQDHIEAMCRLAVKRGAKK--V
GPMI_SHELP       -EFDSNPAFVDAVDKAIAAD--GAVHIMGLLSPGGVHSHESHIQAMCKMAVARGAKQ--V
GPMI_SHESH       -EFDKNQALVESIDKAIANQ--GAVHIMGLLSPGGVHSHESHIEAMCRLAVARGAKQ--V
GPMI_ECOK1       -AFFANPVLTGAVDKAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_ECOL5       -AFFANPVLTGAVDKAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_ECOL6       -AFFANPVLTGAVDKAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_SHIBS       -AFFANPVLTGAVDKAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_ECO57       -AFFANPVLTGAVDKAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_ECO24       -AFFANPVLTGAVDKAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_ECOHS       -AFFANPVLTGAVDKAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_ECOLC       -AFFANPVLTGAVDKAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_SHISS       -AFFANPVLTGAVDKAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_ECOLI       -AFFANPVLTGAVDKAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_SHIFL       -AFFANPVLAGAVHKAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_SHIDS       -VFFANPVLTGAVDKAKSAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_SALPA       -TFFANPVLTNAVDQAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_SALTY       -TFFANPVLTNAVDQAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_SALTI       -TFFANPVLTNAVDQAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_SALPB       -TFFANPVLTNAVDQAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_SALCH       -TFFANPVLTNAVDQAKNAG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEK--I
GPMI_ENT38       -TFFSNPTLTGAVDKAVSAG--KAVHIMGLLSAGGVHSHEDHILAMVEMAAERGAEK--I
GPMI_CROS8       -TFFENPVLTAAVDKAVAAG--KAVHIMGLASPGGVHSHEDHILAMIELAAARGAEK--I
GPMI_YERPA       -DFFTNPTLTAAVDNAVKTG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATA--I
GPMI_YERPP       -DFFTNPTLTAAVDNAVKTG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATA--I
GPMI_YERPN       -DFFTNPTLTAAVDNAVKTG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATA--I
GPMI_YERPE       -DFFTNPTLTAAVDNAVKTG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATA--I
GPMI_YERPS       -DFFTNPTLTAAVDNAVKTG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATA--I
GPMI_YERP3       -DFFTNPTLTAAVDNAVKTG--KAVHIMGLLSAGGVHSHEDHIMAMVELAAKRGATA--I
GPMI_YERE8       -DFFTNPTLTAAVDKAVKAG--KAVHIMGLLSAGGVHSHEDHILAMVELAAKRGATA--I
GPMI_SERP5       -DFFANPTLTAAVDKAVQAG--KAVHIMGLLSPGGVHSHEDHILAMIELASQRGAKA--V
GPMI_VIBC3       -EFQHNKVLVAAIDKAVAAG--KAVHLMGLMSPGGVHSHEDHIYAAVEMAAARGAEK--I
GPMI_VIBCH       -EFQHNKVLVAAIDKAVAAG--KAVHLMGLMSPGGVHSHEDHIYAAVEMAAARGAEK--I
GPMI_VIBPA       -EFEQTPALVEAIDAAVKAE--KAVHIMGLMSPGGVHSHEDHIYAAVEMAAARGAEK--I
GPMI_VIBCB       -EFAETAALVEAIDSAVKAE--KAVHIMGLMSPGGVHSHEDHIYAAVEMAAARGAEK--I
GPMI_VIBVU       -EFQQTAALVEAIDTAVKAE--KAVHIMGLMSPGGVHSHEDHILAAVEMAAERGAEK--I
GPMI_VIBVY       -EFQQTAALVEAIDTAVKAE--KAVHIMGLMSPGGVHSHEDHILAAVEMAAERGAEK--I
GPMI_ALIF1       -EFQQNETLVNAIDKAVKAG--KAVHIMGLMSPGGVHSHEDHIYAAVEMAAARGAEK--I
GPMI_PHOPR       -DFFENEALTTAMDKAINAG--KAVHIMGLMSPGGVHSHEDHIAAAIEMAAKRGAEK--I
GPMI_AERS4       -DFFQNVELAKALDSAVTKG--KAVHIMGLMSPGGVHSHEEHIMGMIEMAAKRGAEQ--I
GPMI_PSYIN       -DFFDNKNFVDAVDQAVAAG--KAVHIMGLASPGGVHSHDQHIVAAIELAAQRGAKN--I
GPMI_PSEHT       -EFDSTPALVDNIDKAVSAD--KAVHIMGLLSPGGVHSHEDHIVASIELAAKRGAKE--V
GPMI_PSEA6       -DFFENEVLVSNVDKAIKQD--KAVHIMGLLSPGGVHSHQDHIFAMIKLAAKRGAKK--I
GPMI_COLP3       -DFIENPTLCHAVDTATSNN--KAVHIFGLLSPGGVHSHEEHIFAMMELAKKRGAQK--V
GPMI_IDILO       -SFFSNTILCDALKKAKAAK--GAVHIMGLLSAGGVHSHEDHLVAMIEMAVEQGAED--V
GPMI_HAHCH       -VFAQNPAISSAIDKAVSNG--KAVHLLGLLSPGGVHSHEDHILAACKVARERGADK--V
GPMI_SACD2       -DFYTNPVYTKAVDDAQSQG--KAVHVIGLLSDGGVHSHEDHMIAMMELAVKRGAEK--V
GPMI_CHRSD       -ELASNPVLTAPIDAAVAAG--RAVHLLGLLSPGGVHSHEDHILAVAALAAERGAKH--V
GPMI_METFK       -EFFSNPVLIEAVNKAKAGH--KAVHILGLLSDGGVHSHQDHIHATIEMAVNAGVEK--V
GPMI_CHRVO       -RFSSNDTLQQAMSKAQGS----ALHILGLLSDGGVHSHENHIHALIRAAQAAGVPK--I
GPMI_THIDA       -YFYTNPALLNAVHLARDNG--KTLHVLGLLSDGGVHSHELHFHALLDLAAREGLSK--V
GPMI_COXBU       -EFYENPALIEALEKAKALN--KAVHILGLLSPGGVHSRDNQIAALVELAHRCGIKK--I
GPMI_COXBR       -EFYENPALIEALEKAKALN--KAVHILGLLSPGGVHSRDNQIAALVELAHHCGIKK--I
GPMI_COXBN       -EFYENPALIEALEKAKALN--KAVHILGLLSPGGVHSRDNQIAALVELAHRCGIKK--I
GPMI_VESOH       -DFFRNPILRNSLEYANDNN--KAIHIMGLLSDGGVHSHEEQIHAMLEMTSRQGCKN--V
GPMI_RUTMC       -DFFRNPILKNSLEYANDNN--KAVHIMGLLSDGGVHSHEEQIHAMLEMTHKQGCKN--V
GPMI_NITOC       -SFFTNHTLTEAVDRAVKSD--KAIHILGLLSPSGIHCHEDHIHAMVELAIKRRCQE--V
GPMI_HYDCU       -RFFENNALVKAIDAASNRD--HKVHILGLLSDGGVHSHISHIKASIKMAHDRGAK---V
GPMI_FRATF       -TFGDNKAICAAIDNVIKND--SNLHLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKR--L
GPMI_FRATH       -TFGDNKAICAAIDNVIKND--SNLHLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKR--L
GPMI_FRATW       -TFGDNKAICAAIDNVIKND--SNLHLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKR--L
GPMI_FRAT1       -TFGDNKAICAAIDNAIKND--SNLHLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKR--L
GPMI_FRATT       -TFGDNKAICAAIDNAIKND--SNLHLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKR--L
GPMI_FRATN       -TFGDNKAIGAAIDNVIKND--SNLHLIGLLSPGGVHSHEEHIFEMIKIAKQKGIKR--L
GPMI_FRAP2       -TFGNNKAICDAIDNVIQKD--SNLHLMGLLSPGGVHSHEEHIFEMIKIAKQKGVKR--V
GPMI_LEGPH       -KFAKNAVFHEVIDQLKKTE--KSLHIMGLLSPGGVHSHEQHLFALLALCNQKKFRS--V
GPMI_LEGPL       -KFAKNAVFHEVIDQLKKTE--KSLHIMGLLSPGGVHSHEQHLFALLALCNQKKFRS--V
GPMI_LEGPA       -KFAKNAVFHEVIDQLKKTE--KSLHIMGLLSPGGVHSHEQHLFALLALCNQKKFRS--V
GPMI_LEGPC       -KFAKNAVFHEVIDQLKKTE--KSLHIMGLLSPGGVHSHEQHLFALLALCNQKKFRS--V
GPMI_GEOSL       -DFFTNPVLLDCMARVKAAG--GRLHLGGLLSDGGVHSHNTHLYALIELARRQGVKD--V
GPMI_PELCD       -TFFENTELRKVMQQVVESQ--GKLHLMGLLSDGGVHSHMEHLYALVEMARRAGVEQ--V
GPMI_SYMTH       -SFYTLPVWRPVLDRAKQPG--KALHLMGLVSDGGVHSHIDHLLALIDLAKRENVER--V
GPMI_RHOS1       -SFPQNPALRDFIAKVKANG--GTAHLMGVVSDGGVHGHIQHLISAVEVLAGEGIP---V
GPMI_RHOS4       -SFPQNPALRDFIGKVKAKS--GTAHLMGVVSDGGVHGHIQHLISAVEVLAGEGIP---V
GPMI_RHOS5       -TFARNPALCDFIAKVKAKG--GTAHLMGVVSDGGVHGHIQHLIAAVEVIAASGVP---V
GPMI_DINSH       -SFARNPALTGFIDRLKSSG--GTAHLMGVASDGGVHGHTDHIIAAAKAVAGAGVP---V
GPMI_PARDP       -SFYENAALGEFIRKLKASG--GTAHLMGVVSDGGVHGHIQHVIAAARAVTDKGVP---V
GPMI_ROSDO       -LFAQNSRLRAFIVTLQDSG--GTAHLMGVVSDGGVHGHINHMIAAAKALADENIP---V
GPMI_RUEPO       -SFFDNAALRDFIARTRAAG--GTAHLMGLVSDGGVHGHLNHIIAAAQAITNAGVP---V
GPMI_RUEST       -SFYDNDALQAFIAKLKETG--GAAHLMGLVSDGGVHGHVTHILAAIKAIRDAGVP---V
GPMI_AGRFC       -SFFRNAAMLDFAATVKAAG--GVAHLMCVVSDGGVHGHILHGQAAVKLMVSHGLK---V
GPMI_RHOPA       -EIERAPGLVAFIDKLKASG--GTCHLMGLVSPGGVHSLQDHACALAKILAKAGVK---T
GPMI_GLUOX       -SLAQNPALLEFIAALKASG--GTCHLMGLISPGGVHAHQDHVVALTKIVSAAGVP---V
GPMI_MAGMM       -SFMHNQVLLDAIRAANEAG--GAVHLYGLLSPGGVHSHQDQILAAVQCAKQNGASE--I
GPMI_LAWIP       -ELDSNPILLDLFTKVKSSN--GRLHLLGLLSNGGVHSHIRHLEALLSIAKEHNI---QV
GPMI_DESVH       -ELASNPALTGLFEAVRATG--GRVHLMGLLSDGGVHSHIAHVEALALAARDAGV---EV
GPMI_RHOBA       -SFFSNPVVTGAIDHVKKSG--GRLHLLGLMSDGRVHSDLQHGIAVIDLAKRNGLTGDQL
GPMI_SYNY3       -TFFDNQALIEVCQRVRDRR--GKLHLIGLCSDGGVHSHIDHLLGLIDLAKLQGISQ--L
GPMI_MICAN       -SIQQNQALLKLCAEIRPKK--SKLHLIGLCSEGGVHSHLDHLLGLLDLAKVQGISD--V
GPMI_NOSS1       -SILSNSALVKICQEVRNRN--GKLHLVGLCSEGGVHSHITHLFGLLDLAKEQRISE--V
GPMI_TRIV2       -SILSNSALVKICQEVRNRN--GKLHLVGLCSEGGVHSHITHLFGLLDLAKEQRISE--V
GPMI_TRIEI       -LIVQNQAIKKICQDVIERN--SKLHLVGLCSSGGVHSHVNHLLGLLDVAKAKGISD--V
GPMI_SYNE7       -SILENPALLQACSAVRQHG--SKLHLIGLCSDGGVHAHLDHLGGLLKLAAAQGIQD--V
GPMI_SYNP6       -SILENPALLQACSAVRQHG--SKLHLIGLCSDGGVHAHLDHLGGLLKLAAAQGIQD--V
GPMI_ACAM1       -SLATNPALDKVCKQVSQAS--TKLHLIGLCSKGGVHAHSDHLLALLKLAKEHNISQ--V
GPMI_SYNJA       -SLFHEPLLVEVCHRLKEQG--GRFHFIGLCSEGGVHSHIDHLYGLLKLAAQAGIP---A
GPMI_SYNJB       -SLFQDPLLMQVCRQLRERG--GRFHFVGLCSEGGVHSHIDHLYGLLKLAAQAEIP---A
GPMI_THEEB       -SLFSNPVLVRLCQTVKERN--GKLHFIGLCSAGGVHSHIDHLYGLVELAKRHGLP---A
GPMI_GLOVI       -TLLSNPELLRLCRTVRERG--GKLHGVGLVSDGGVHSHIEHLFGLLDLAKREGFET--L
GPMI_PROM1       -KLITNPALNQFSQSLKKGG--GTLHIMGLCSDGGVHSHINHLCGLIEWAASKGLKS--V
GPMI_PROMT       -KLIANPALNQFSQSLKKGG--GTLHIMGLCSDGGVHSHIKHLCGLIEWAASKGLKN--V
GPMI_PROM3       -RLGQTPALIALAERLRKSD--GTLHLLGLCSDGGVHSHINHLCGLLHWAAAAGLNK--V
GPMI_PROMM       -RLGQTPALIALAERLRKSD--GTLHLLGLCSDGGVHSHINHLCGLLHWAAAAGLNK--V
GPMI_SYNPX       -QLNNTPALVELAEHLQNDT--GTLHLLGLCSDGGVHSHVNHLCGLIHWAAAAGIKK--V
GPMI_PROMA       -KLDQITNLSNLANKLIETD--KTLHLVGLCSDGGVHSHINHLCGLLEWAKNKGIQK--V
GPMI_PROMP       -QLTQVNELKEMANSIKKKK--GTLHITGLCSDGGVHSHIDHLLGLIKWASEEHIEK--V
GPMI_GRATL       -SFFNNEAINSICQKINFYN--TKLHLIGLCSNGGVHSHIKHLFALLDIAMRYKI-Q--I
GPMI_ANTSP       -EFFNNYQLHNIYKYSCEKN--SKVHIVGLCSNGGVHSHINHLKALIQISKQYKV-M--T
GPMI_PORPU       -SFFNNVQLNCACDHAISTQ--TSLHLIGLCSNGGVHSHLDHLLALIHVAESKKVPN--L
GPMI_PYRYE       -SFFNNLELNEACEYANNNK--ASLHLIGLCSNGGVHSHIDHLLALIDLADSKQVTN--L
GPMI_NATPD       -VFADNEALARAFDHADDHD--GRVHFMGLVSDGGVHSYQSHLHALVDLAAERGVEA--V
GPMI_HALMA       PPFFENETILSAFEHAEAHG--GRVHFMGLVSDGGVHSYQDHLHALIELAGERGTDA--V
GPMI_HALSA       -DLCGNDAISGALDHVADTG--GTLHVMGLVSDGGVHADQQHIHALVECAAGRGVEA--A
GPMI_HALWD       -SFQTNAAINAAFNHAVATN--GRVHFMGLLSDGGVHSEQEHLHALIELAGDRNIDA--I
GPMI_STRCO       -ALRSHPRLDAVLNEVAATS--GALHLIGLCSDGQIHAHVEHLSELLAAAATHQVER--V
GPMI_FLAJ1       -TLAKEQVLIDAFTYAKENN--KKVHFLGLVSDGGVHSHTSHLRGLIDASQEYGLDQ--V
GPMI_FLAPJ       -TLSQEKALKEAFQYAKENN--KPIHFLGLLSDGGVHSHTSHLRGLLDAAQNFGLKK--T
GPMI_BACFR       -SILKNPEIVSAFSYAKENG--KNVHFMGLTSDGGVHSSLDHLFKLCDIAKEYNIEN--T
GPMI_BACFN       -SILKNPEIVSAFSYAKENG--KNVHFMGLTSDGGVHSSLDHLFKLCDIAKEYNIEN--T
GPMI_BACTN       -SILQNPEIVSAFSYAKENG--KSVHFMGLTSNGGVHSSMVHLFKLCDISKEYGIDN--T
GPMI_BACV8       -SIMKNPEIVSAFSYAKENG--KNIHFMGLTSNGGVHSSFDHLFKLCDISKEYGIEN--T
GPMI_PARD8       -TIMENPEIKRAYSYAKENN--KQIHFMGLVSDGGVHSSLEHLLKLTDIAKEYGISK--A
GPMI_HELPY       -ELKNNPAFLNTIQKSP------VVHLMGLMSDGGVHSHIEHFIALALECEKSHKK---V
GPMI_HELPH       -DLKNNPAFLNTIHKSP------VVHLMGLMSDGGVHSHIEHFIALALECEKSHKK---V
GPMI_HELPJ       -ELKNNPAFLNTIQKSH------VVHLMGLMSDGGVHSHIEHFIALALECEKSHKK---V
GPMI_HELAH       -GLKNNTAFLSAIQKSS------VVHLMGLMSDGGVHSHIEHFIALALECEKFHKK---V
GPMI_HELHP       -EIKDNPALVEVTQQSA------VVHLCGLLSDGGVHSHIVHLKALAQILSTQGKR---V
GPMI_WOLSU       -SLEKNPTLLGFSSRAK------RIHLAGLASDGGVHSHMEHLLGLAQIFSRLGHE---V
GPMI_ARCB4       -TLKDNEVLKNTISKSN------NIHLLGLASDGGVHSHINHIIAMAKIAKNMGKK---V
GPMI_SULDN       -RFRDNEAFRELLAKSS------RLHLIGLMSDGGVHSHIDHFMGIADIAAKEGKE---V
GPMI_CAMJ8       -ELEKNENLQKLLAKCK------RVHIIGLYSDGGVHSMDTHFKAMLEICAKNGNE---V
GPMI_CAMJR       -ELEKNENLQKLLAKCK------RVHIIGLYSDGGVHSMDTHFKAMLEICAKNGNE---V
GPMI_CAMJJ       -ELEKNENLQKLLAKCK------RVHIIGLYSDGGVHSMDTHFKAMLEICAKNGNE---V
GPMI_CAMJE       -ELEKNENLKKLLAKCK------RVHIIGLYSDGGVHSMDTHFKAMLEICAKNGNE---V
GPMI_CAMJD       -ELEKNENLQKLLAKCK------RVHIIGLYSDGGVHSMDTHFKAMLEICAKNGNE---V
GPMI_EHRRW       --IRKNTHLLEFTEQIKRNN--GICHIAGLLSDGGIHSSLSHMLDIIDALSYLKIQ---V
GPMI_EHRRG       --IRKNTHLLEFTEQIKRNN--GICHIAGLLSDGGIHSSLSHMLDIIDALSYLKIQ---V
GPMI_EHRCJ       --IKDNVYLLEFINKIKKNN--GICHIAGLLSDGGVHSSYTHILDIINTLSDFQIQ---V
GPMI_EHRCR       --IKNNRYLLEFIKKIKQNN--GICHIAGLLSDGGVHSLHTHMLDIIDTLSNFQIQ---I
GPMI_ANAPZ       --VHKNPKLLDFVRDIQAKG--GVCHMIGLLSDGGVHSLQAHMETIIEVITGFGIK---V
GPMI_ANAMM       --IHSNPYLLQFAEAIKNGR--GVCHIMGLLSDGGVHGLQDHITQLARVLAELRIK---V
GPMI_WOLPM       --IENNVNLQSFINDLKSKN--GVCHIMGLVSDGGVHSHQKHISTLANKISQHGIK---V
GPMI_WOLTR       --IENNKNLRSFISDLKDKN--GVCHIMGLVSDGGVHSHQKHISTLANKISQHEIK---V
GPMI_ONYPE       -SFFTNKQFLQAIEHVKKNN--SKMHLLGLISDGGIHSHLDHFKALFDLLKENNLAN-NT
GPMI_AYWBP       -TFFTNKQFLQAIEHVKKNN--SKIHLLGLISDGGIHSHLDHFKALFDLLKENNLAN-NT
GPMI_ACHLI       -SFFKNQAFLDAVAHAKKHN--SKLHIMGLVSDGGVHAQMGHYLALYDFAKQQNILD-RT
GPMI_MYCGE       -SFFANKAFLKTIEHVEKNH--SKIHLIGLFSNGGVHSHNEHLLALIELFSKH----AKV
GPMI_MYCPN       -AFHHNQVLLEAIARAKANN--AKLHLIGLFSHGGVHSHMDHLYALIKLAAPQ----VKM
GPMI_MYCGA       -KFFTNQALLNAIDHAKKNN--SKLHILGLVSNGGVHSHINHIYAIMELANQHN---VPA
GPMI_MYCPE       -KFDSNKTLLEAINHAKKNN--SNIHIMGLLSPGGVHSNEQHIFEMIRIVSENG---LKP
GPMI_MYCPU       -NFINNKAFLEVIEDVKKNN--STLHLMGLVSPGGVHSLEDHLFEIIDVAYQKGL--KKV
GPMI_MYCS5       -KFKENQVFLNAFNKVKENN--STLHLMGLLSPGGVHSLEAHLFEILKQAHNSGV--ENV
GPMI_MYCMO       -KFKQNAKFIAAFNAVKKNNETNTLHLMGLLSDGGVHSHEEHLFKLIEAAHENGL--KNV
GPMI_MYCHP       -TFKDNEILNDVIDKTIKNN--TTLHVMGLLSNGGVHSLDLHLFEILKLAHSKGL--KNV
GPMI_MYCH7       -KFFENEKFILAFRHSIKTG--FPLQIMGLFSPGGVHSHQDHLFALIDFAANFGV--KKL
GPMI_MYCHJ       -KFFENEKFILAFRHSIKTG--FPLQIMGLFSPGGVHSHQDHLFALIDFAANFGV--KKL
GPMI_MYCH2       -KFFENEKFILAFRHSIKTG--FPLQIMGLFSPGGVHSHQDHLFALIDFAANFGV--KKL
GPMI_UREP2       -DYE-------SAVLSNIKN--EIVHIVGMYSNGLVHSNYEHIHWIIKQIIKNN---NQV
GPMI_UREPA       -DYE-------SAVLSNIKN--EIVHIVGMYSNGLVHSNYEHIHWIIKQIIKNN---NQV
GPMI_MYCCT       -NIAKNDEIVKTFEYVKKNN--SALHLMGLFSNGGVHSHFDHMIAIYKAAIVYGI--TNI
                                          :   : * . :*    :                  

GPMI_CLOAB       FVHAFLDGRDVPPSSAKEFIKDIEDYMNEIG------LGEIATVSGRYYAMDRDNRWERE
GPMI_CLONN       YVHAFLDGRDTAPKSALTYIEDLEKHMAEVG------VGSIATVSGRYYAMDRDKRWERI
GPMI_CLOB1       YIHAFLDGRDVAPSSAKEYIEDIENYMNEIG------VGEIATISGRYYAMDRDKRWERV
GPMI_CLOBL       YIHAFLDGRDVAPSSAKEYIEDIEIYMQEIG------VGEIATISGRYYAMDRDKRWERV
GPMI_CLOK5       YIHAFTDGRDVPPSSAYMYIDDMEKYIQKIG------IGKIATVSGRYYAMDRDKRWERV
GPMI_CLOPE       YVHAFMDGRDVAPSSGKDFIVELENAMKEIG------VGEIATISGRYYAMDRDNRWERV
GPMI_CLOP1       YVHAFMDGRDVAPSSGKEFIVELENAMKEIG------VGEIATISGRYYAMDRDNRWERV
GPMI_CLOPS       YVHAFMDGRDVAPSSGKEFIVELENAMKEIG------VGEIATISGRYYAMDRDNRWERV
GPMI_CLOB8       YVHAFMDGRDVPPSSGQEFIEKTEKMMAEVG------VGKIATVSGRYYAMDRDNRWERV
GPMI_CLOTE       YVHAFLDGRDVPPSSAKEYIINIENYMKELS------VGQIATLAGRYYAMDRDKRWERV
GPMI_CLOD6       YVHAFTDGRDTDPQSALEYAKEVQASMDEIG------VGEFATVSGRYYAMDRDKRWERV
GPMI_HUNT2       YVHCFFDGRDVPPDSAMGYVEELENKIREIG------VGEIATVMGRYYAMDRDNRWERV
GPMI_LACP7       YVHAFLDGRDTAPTSGKSFMEALEAKMAELG------VGRIASVTGRYYVMDRDNRWDRV
GPMI_BACSU       YIHGFLDGRDVGPQTAKTYINQLNDQIKEIG------VGEIASISGRYYSMDRDKRWDRV
GPMI_BACVZ       YIHGFLDGRDVGPQTAKTYIQQLNEQVEEIG------VGEIASISGRYYSMDRDKRWDRV
GPMI_BACP2       YIHGFLDGRDVGQKTAKVYLKQLEEQIKEIG------VGEVATLSGRYYSMDRDKRWDRV
GPMI_BACLD       YIHGFLDGRDVGPQTAEKYIKELQDQIEEIG------VGEIATLSGRYYSMDRDKRWDRV
GPMI_GEOSE       YIHGFLDGRDVGPQTAPQYIKELQEKIKEYG------VGEIATLSGRYYSMDRDKRWDRV
GPMI_GEOKA       YIHGFLDGRDVGPQTAPQYIKELQEKIKEYG------VGEIATLSGRYYSMDRDKRWDRV
GPMI_GEOTN       YIHGFLDGRDVGPQTAPQYIKELQEKIKEYG------VGEIATLSGRYYSMDRDKRWERV
GPMI_BACMQ       YIHGFLDGRDVAPQSAETYLKELNEKIEEYG------VGEIATLSGRYYSMDRDKRWERV
GPMI_BACAH       YIHAFLDGRDVGPKTAQSYIDATNEVMKETG------VGQFATISGRYYSMDRDKRWDRV
GPMI_BACC1       YIHAFLDGRDVGPKTAQSYIDATNEVIKETG------VGQFATISGRYYSMDRDKRWDRV
GPMI_BACCR       YIHAFLDGRDVGPKTAQSYIDATNEVIKETG------VGQFATISGRYYSMDRDKRWDRV
GPMI_BACHK       YIHAFLDGRDVGPKTAQSYIDATNEVIKETG------VGQFATISGRYYSMDRDKRWDRV
GPMI_BACCZ       YIHAFLDGRDVGPKTAQSYIDATNEVIKETG------VGQFATISGRYYSMDRDKRWDRV
GPMI_BACAN       YIHAFLDGRDVGPKTAQSYIDATNEVIKETG------VGQFATISGRYYSMDRDKRWDRV
GPMI_BACCN       YIHAFLDGRDVGPQTAKGYIDATNAVIKETG------VGQFATIAGRYYSMDRDKRWDRV
GPMI_BACHD       YIHGFLDGRDVGPTSAESYLVDLEAKMKELG------VGELATLHGRYYAMDRDKRWDRV
GPMI_BACSK       YVHGFLDGRDVGPTSAEVYLKGLQDKFDEVG------LGKLATVHGRYYAMDRDKRWDRV
GPMI_OCEIH       FVHAFLDGRDVGPKTASKYIKETQDVMDELG------VGQFATISGRYYSMDRDKRWDRV
GPMI_STAAS       YVHAFLDGRDVDQKSALKYIEETEAKFNELG------IGQFASVSGRYYAMDRDKRWERE
GPMI_STAAW       YVHAFLDGRDVDQKSALKYIEETEAKFNELG------IGQFASVSGRYYAMDRDKRWERE
GPMI_STAAC       YVHAFLDGRDVDQKSALKYIEETEAKFNELG------IGQFASVSGRYYAMDRDKRWERE
GPMI_STAAM       YVHAFLDGRDVDQKSALKYIEETEAKFNELG------IGQFASVSGRYYAMDRDKRWERE
GPMI_STAAN       YVHAFLDGRDVDQKSALKYIEETEAKFNELG------IGQFASVSGRYYAMDRDKRWERE
GPMI_STAAR       YVHAFLDGRDVDQKSALKYIEETEAKFNELG------IGQFASVSGRYYAMDRDKRWERE
GPMI_STAEQ       YVHAFLDGRDVDQKSALKYIEETEDKFKELG------VGQFASVSGRYYAMDRDKRWDRE
GPMI_STAES       YVHAFLDGRDVDQKSALKYIEETEDKFKELG------VGQFASVSGRYYAMDRDKRWDRE
GPMI_STAHJ       YVHAFLDGRDVDQKSALKYIEETEAKFKSLG------VGEFASISGRYYAMDRDKRWDRE
GPMI_STAS1       YVHAFLDGRDVDQKSALKYIEETEAKFKELG------IGQFASVSGRYYAMDRDKRWDRE
GPMI_LISMF       YIHAFLDGRDVAPQSSLEYLETLQKAISDLN------YGAIATVSGRFYAMDRDKRWERV
GPMI_LISMO       YIHAFLDGRDVAPQSSLEYLETLQKAISDLN------YGAIATVSGRFYAMDRDKRWERV
GPMI_LISIN       YIHAFLDGRDVAPQSSLEYLETLEKAISDLN------YGAIATVSGRFYAMDRDKRWERV
GPMI_LISW6       YIHAFLDGRDVAPQSSLEYLETLQKAMNDLN------YGEIATVSGRFYAMDRDKRWERV
GPMI2_METAC      YIHAFLDGRDVPPKAALADIRELDAFCKENG------SARIATVQGRYYAMDRDKRWERS
GPMI_METMA       YIHVFLDGRDVPPKAALGDVKELDAFCKENQ------SVKIATVQGRYYAMDRDKRWERT
GPMI1_METBF      YIHAFLDGRDVPPKAALKDIEELDAFCKENG------NAKIATISGRYYAMDRDKRWDRT
GPMI1_METAC      YIHAFLDGRDVPPKTALGDIKKLNEFCKEHG------GAKIATVSGRYYAMDRDKRWDRT
GPMI2_METBF      YIHAFLDGRDEPPKAALGDIKKLDAFCKEHG------NAKIATVSGRYYAMDRDKRWDRT
GPMI_METBU       FIHAFLDGRDVSPRAALEDMKEHVEYCNNLS------VGKIATVSGRYYAMDRDNRWDRT
GPMI_PSEF5       YLHAFLDGRDTPPKSAQSSIELLDETFKTLG------KGRIASLIGRYFAMDRDNRWDRV
GPMI_PSEPF       YLHAFLDGRDTPPKSAASSIELLDATFQALG------KGRIASLIGRYYAMDRDNRWDRV
GPMI_PSEU2       YLHAFLDGRDTPPRSAKKSLELMDATFARLG------KGRTATIVGRYFAMDRDNRWDRV
GPMI_PSE14       YLHAFLDGRDTPPRSAKKSLELMDATFARLG------KGRTATIIGRYFAMDRDNRWDRV
GPMI_PSESM       YLHAFLDGRDTPPRSAKKSLELMDETFARLG------KGRIATIIGRYFAMDRDNRWDRV
GPMI_PSEP1       YLHAFLDGRDTPPRSAQSSIELLDATFAKLG------KGRIASLIGRYYAMDRDNRWDRV
GPMI_PSEPK       YLHAFLDGRDTPPRSAQSSIELLDATFAKLG------KGRIASLIGRYYAMDRDNRWDRV
GPMI_PSEPG       YLHAFLDGRDTPPRSAQSSIELLDATFAKLG------KGRIASLIGRYYAMDRDNRWDRV
GPMI_PSEE4       YLHAFLDGRDTPPRSAQSSIELLDATFAKLG------KGRIASLIGRYYAMDRDNRWDRV
GPMI_PSEAB       YLHAFLDGRDTPPKSAQPSLERLDATFAGLG------KGRIASIIGRYFAMDRDNRWDRV
GPMI_PSEAE       YLHAFLDGRDTPPKSAQPSLERLDATFAGLG------KGRIASIIGRYFAMDRDNRWDRV
GPMI_PSEA7       YLHAFLDGRDTPPKSAQPSLERLDATFAGLG------KGRIASIIGRYFAMDRDNRWDRV
GPMI_PSEMY       YLHAFLDGRDTPPKSAQPSIELLDAAFARLG------KGRIASLTGRYFAMDRDNRWDRV
GPMI_ACIAD       YLHAFLDGRDTPPKSAQPSLEKLDALFAQYPE-----QGRIVSMIGRYFAMDRDNRWDRV
GPMI_SHEB5       YLHAFLDGRDTPPRSAKSSLSHFDDLFTTL------GHGRIASIIGRYFAMDRDNRWDRV
GPMI_SHEB8       YLHAFLDGRDTPPRSAKTSLSHFDDLFTTL------GHGRIASIIGRYFAMDRDNRWDRV
GPMI_SHEB9       YLHAFLDGRDTPPRSAKSSLSHFDDLFTTL------GHGRIASIIGRYFAMDRDNRWDRV
GPMI_SHEPC       YLHAFLDGRDTPPRSAKASLSHFDDLFTTL------GHGRVASIIGRYFAMDRDNRWDRV
GPMI_SHESW       YLHAFLDGRDTPPRSAKASLSHFDDLFTTL------GHGRVASIIGRYFAMDRDNRWDRV
GPMI_SHESR       YLHAFLDGRDTPPRSAKGSLSHFDDLFTTL------GHGRIASIIGRYFAMDRDNRWDRV
GPMI_SHESA       YLHAFLDGRDTPPRSAKGSLSHFDDLFTTL------GHGRIASIIGRYFAMDRDNRWDRV
GPMI_SHESM       YLHAFLDGRDTPPRSAKGSLSHFDDLFTTL------GHGRIASIIGRYFAMDRDNRWDRV
GPMI_SHEON       YLHAFLDGRDTPPRSAKSSLSHFDDLFTTL------GHGRIASIIGRYFAMDRDNRWDRV
GPMI_SHEDO       YLHAFLDGRDTPPRSAKGSLAHFGDLFTTL------GQGRIASVIGRYYAMDRDNRWDRV
GPMI_SHEHH       YLHAFLDGRDTPPRSAKPGLAHFEELFKTL------GTGQVASLIGRYYAMDRDNRWDRV
GPMI_SHEPA       YLHAFLDGRDTPPRSAKPGLAHFEELFKSL------GTGQVASVIGRYYAMDRDNRWDRV
GPMI_SHELP       YLHAFLDGRDTPPRSAKGSLQAFNELFAEL------GTGRIASLIGRYYAMDRDNRWDRV
GPMI_SHESH       YLHAFLDGRDTPPRSAKGSLAHFDDLFTTL------GTGRVASVIGRYYAMDRDNRWDRV
GPMI_ECOK1       YLHAFLDGRDTPPRSAESSLKKFEEKFAAL------GKGRVASIIGRYYAMDRDNRWDRV
GPMI_ECOL5       YLHAFLDGRDTPPRSAESSLKKFEEKFAAL------GKGRVASIIGRYYAMDRDNRWDRV
GPMI_ECOL6       YLHAFLDGRDTPPRSAESSLKKFEEKFAAL------GKGRVASIIGRYYAMDRDNRWDRV
GPMI_SHIBS       YLHAFLDGRDTPPRSAESSLKKFEEKFAAL------GKGRVASIIGRYYAMDRDNRWDRV
GPMI_ECO57       YLHAFLDGRDTPPRSAESSLKKFEEKFAAL------GKGRVASIIGRYYAMDRDNRWDRV
GPMI_ECO24       YLHAFLDGRDTPPRSAESSLKKFEEKFAAL------GKGRVASIIGRYYAMDRDNRWDRV
GPMI_ECOHS       YLHAFLDGRDTPPRSAESSLKKFEEKFAAL------GKGRVASIIGRYYAMDRDNRWDRV
GPMI_ECOLC       YLHAFLDGRDTPPRSAESSLKKFEEKFAAL------GKGRVASIIGRYYAMDRDNRWDRV
GPMI_SHISS       YLHAFLDGRDTPPRSAESSLKKFEEKFAAL------GKGRVASIIGRYYAMDRDNRWDRV
GPMI_ECOLI       YLHAFLDGRDTPPRSAESSLKKFEEKFAAL------GKGRVASIIGRYYAMDRDNRWDRV
GPMI_SHIFL       YLHAFLDGRDTPPRSAESSLKKFEEKFAAL------GKGRVASIIGRYYAMDRDNRWDRV
GPMI_SHIDS       YLHAFLDGRDTPPRSAESSLKKFEEKFAAL------GKGRVASIIGRYYAMDRDNRWDRV
GPMI_SALPA       YLHAFLDGRDTPPRSAEASLKKFEDKFAAL------GKGRVASIVGRYYAMDRDNRWDRV
GPMI_SALTY       YLHAFLDGRDTPPRSAEASLKKFEDKFAAL------GKGRVASIVGRYYAMDRDNRWDRV
GPMI_SALTI       YLHAFLDGRDTPPRSAEASLKKFEDKFAAL------GKGRVASIVGRYYAMDRDNRWDRV
GPMI_SALPB       YLHAFLDGRDTPPRSAEASLKKFEDKFAAL------GKGRVASIVGRYYAMDRDNRWDRV
GPMI_SALCH       YLHAFLDGRDTPPRSAEASLKKFEDKFAAQ------GKGRVASIVGRYYAMDRDNRWDRV
GPMI_ENT38       YLHAFLDGRDTPPRSAKSSLQTFEDKFAEL------GKGRVASIIGRYYAMDRDNRWDRV
GPMI_CROS8       YLHAFLDGRDTPPRSAKASLEKFAAKFAEV------GKGRIASIIGRYFAMDRDNRWDRV
GPMI_YERPA       YLHAFLDGRDTPPRSAESSLKRFTAKFAEL------GNGRIASIIGRYYAMDRDNRWDRV
GPMI_YERPP       YLHAFLDGRDTPPRSAESSLKRFTAKFAEL------GNGRIASIIGRYYAMDRDNRWDRV
GPMI_YERPN       YLHAFLDGRDTPPRSAESSLKRFTAKFAEL------GNGRIASIIGRYYAMDRDNRWDRV
GPMI_YERPE       YLHAFLDGRDTPPRSAESSLKRFTAKFAEL------GNGRIASIIGRYYAMDRDNRWDRV
GPMI_YERPS       YLHAFLDGRDTPPRSAESSLKRFTAKFAEL------GNGRIASIIGRYYAMDRDNRWDRV
GPMI_YERP3       YLHAFLDGRDTPPRSAESSLKRFTAKFAEL------GNGRIASIIGRYYAMDRDNRWDRV
GPMI_YERE8       YLHAFLDGRDTPPRSAEPSLKRFTEKFAAL------GKGRIASIIGRYYAMDRDNRWDRV
GPMI_SERP5       YLHAFLDGRDTPPRSAEASLQRFSDAFAKL------GTGRIASLIGRYYAMDRDNRWDRV
GPMI_VIBC3       YLHCFLDGRDTPPRSAEASLKRFQDLFAKL------GKGRIASIVGRYYAMDRDNNWDRV
GPMI_VIBCH       YLHCFLDGRDTPPRSAEASLKRFQDLFAKL------GKGRIASIVGRYYAMDRDNNWDRV
GPMI_VIBPA       YLHCFLDGRDTPPRSAENSLQRFQDLFAKL------GKGRVASLVGRYYAMDRDNNWERV
GPMI_VIBCB       YLHCFLDGRDTPPRSAENSLQRFQDLFAKL------GKGRVASLVGRYYAMDRDNNWDRV
GPMI_VIBVU       YLHCFLDGRDTPPRSAEGSLQRFQDLFAKL------GKGRVASLVGRYYAMDRDNNWDRV
GPMI_VIBVY       YLHCFLDGRDTPPRSAEGSLQRFQDLFAKL------GKGRVASLVGRYYAMDRDNNWDRV
GPMI_ALIF1       YLHCFLDGRDTPPRSAENSLKNFQELFAKL------GKGRIASLVGRYYAMDRDNNWERV
GPMI_PHOPR       YLHCFLDGRDTPPRSAQNSLERFDALFAEL------GKGRTASLVGRYYAMDRDNNWDRV
GPMI_AERS4       YFHAFLDGRDVPPRSAQSSIEQFDALFARL------GKGRFASMIGRYFAMDRDNRWDRV
GPMI_PSYIN       LVHAFLDGRDTPPRSAAGTLALFDEKYAQL------GVGRTATLVGRYFAMDRDNRWDRV
GPMI_PSEHT       YFHGFLDGRDTPPRSAKASIERIEAVFAKL------QCGRLASLIGRYYAMDRDNRWNRV
GPMI_PSEA6       FLHAFLDGRDTPPRSAKAPLEAADKVFEEL------GVGKTATLVGRYYAMDRDSRWDRV
GPMI_COLP3       YLHAFLDGRDTPPRSAQASLEKAQQKFSKLFTETDTGEGQIASVIGRYYAMDRDQRWDRV
GPMI_IDILO       YLHAFLDGRDTPPKSALPSIERFEALFARL------GKGRFATLSGRFFAMDRDKRWERI
GPMI_HAHCH       FVHAFLDGRDTPPRSAQPSLERTDKLLKEL------GCGRVASIIGRYYAMDRDNRWDRV
GPMI_SACD2       YMHAFLDGRDTPPRSAKAPLQKTEEKLKAL------GGGKIASIIGRFFALDRDNRWDRV
GPMI_CHRSD       YLHAFLDGRDTAPKSARASLERANARLAELFG---ADNAYVASIVGRYYAMDRDNRWDRV
GPMI_METFK       YVHAFLDGRDTPPISAKPYLEKLEQACASIG------GGKIASICGRFYAMDRDKRWPRV
GPMI_CHRVO       YVHAFLDGRDTPPRSAETYLKRLDAALAECP------NARLVSVTGRYWAMDRDKRWERV
GPMI_THIDA       CLHVFLDGRDTPPKSAELYLRRLTDKIAQAG------VGHVASMIGRYFAMDRDRRWQRV
GPMI_COXBU       YLHAILDGRDTPPKSALLSIEKITDQFHAYG------NGKIASLIGRYYAMDRDKRWDRT
GPMI_COXBR       YLHAILDGRDTPPKSALLSIEKITDQFHAYG------NGKIASLIGRYYAMDRDKRWDRT
GPMI_COXBN       YLHAILDGRDTPPKSALLSIEKITDQFHAYG------NGKIASLIGRYYAMDRDKRWDRT
GPMI_VESOH       YLHIFTDGRDCAQKSAKKYIKKLESKMKELN------TGEIVSLIGRYFSMDRDNRWSRI
GPMI_RUTMC       YLHLFTDGRDCAQKSAEKYIQKFEEKMAILG------TGEIVSIIGRYFSMDRDNRWSRI
GPMI_NITOC       YLHAFLDGRDTAPKSAQASILAMQAKFTELG------KGRFASLIGRYYGMDRDHRWPRI
GPMI_HYDCU       YVHIFTDGRDTAPQSALQYIEELETFMKELG------GGRIASVTGRYFALDRDNRWERV
GPMI_FRATF       YLHAFLDGRDTPPRSAEKSIKKADKLLQDLN------LGYIASVCGRYYAMDRDNRWDRV
GPMI_FRATH       YLHAFLDGRDTPPRSAEKSIKKADKLLQDLN------LGYIASVCGRYYAMDRDNRWDRV
GPMI_FRATW       YLHAFLDGRDTPPRSAEKSIKKADKLLQDLN------LGYIASVCGRYYAMDRDNRWDRV
GPMI_FRAT1       YLHAFLDGRDTPPRSAEKSIKKADKLLQDLN------LGYIASVCGRYYAMDRDNRWDRV
GPMI_FRATT       YLHAFLDGRDTPPRSAEKSIKKADKLLQDLN------LGYIASVCGRYYAMDRDNRWDRV
GPMI_FRATN       YLHAFLDGRDTPPRSAEKSIKKADKLLQDLN------LGYIASVCGRYYAMDRDNRWDRV
GPMI_FRAP2       YLHAFLDGRDTPPRSAESSIKKTDDLLQKLN------LGYIASVSGRYYAMDRDNRWDRV
GPMI_LEGPH       HLHLFLDGRDTPPQSALDSLKCLNEELAKHP------VATINSICGRYYAMDRDKRWERV
GPMI_LEGPL       HLHLFLDGRDTPPQSALDSLKCLNEELAKHP------VATINSICGRYYAMDRDKRWQRV
GPMI_LEGPA       HLHLFLDGRDTPPQSALDSLKCLNEELAKHP------VATINSICGRYYAMDRDKRWERV
GPMI_LEGPC       HLHLFLDGRDTPPQSALDSLKCLNEELVKHP------VATINSICGRYYAMDRDKRWERV
GPMI_GEOSL       FVHAFLDGRDTPPSSGAGYLAELEAEIGRIG------FGRVATVMGRYWAMDRDNRWERV
GPMI_PELCD       CIHAFMDGRDTPPQSGAGYLAQLEDKLQDIG------LGRVATVIGRYWAMDRDNRWERV
GPMI_SYMTH       YVHAFLDGRDVPPQSALPYLERVEAKLKETG------IGAIATISGRYYAMDRDKRWDRT
GPMI_RHOS1       VIHAITDGRDVAPTSAGEFVGQLVRVLPE--------GARIGTVIGRYWAMDRDKRWDRV
GPMI_RHOS4       VIHAITDGRDVAPTSAGEFVGQLVRVLPE--------GARIGTVIGRYWAMDRDKRWDRV
GPMI_RHOS5       VIHAITDGRDVAPTSAGGFVQQLAEALPA--------GASIGTVIGRYWAMDRDKRWDRV
GPMI_DINSH       VLHAITDGRDVAPKSADRFMPALEAALPE--------GARIGTVIGRYYAMDRDNRWDRV
GPMI_PARDP       VIHVVTDGRDVPPQSAMGFVTELLGELPE--------AARIGTVVGRYYAMDRDNRWERV
GPMI_ROSDO       VIHALTDGRDVAPRSALGYFETLQAALPD--------GVEIATVTGRYFAMDRDNRWDRV
GPMI_RUEPO       VMHAITDGRDVAPKSAYGFMAELEDRLPK--------GARIVTVTGRYFALDRDNRWERV
GPMI_RUEST       WLHAITDGRDVAPKSALTYLDQLEAGMAP--------GAQIATVTGRYFAMDRDNRWERV
GPMI_AGRFC       VVHAITDGRDVAPQSAEDFVAALVASLPQ--------GASIGTVIGRYYAMDRDNRWERV
GPMI_RHOPA       VLHAFTDGRDTPPKSAVDDIVRLRAELPP--------NVPIATVSGRYYAMDRDNRWERV
GPMI_GLUOX       AVHIFSDGRDTAPRSGEDFIGKFLKELPD--------SVQIATLSGRYYAMDRDRRWERV
GPMI_MAGMM       YIHALLDGRDTPPQSAMEYMTRFEEGLQKLG------AGRVATVCGRYFTMDRDKRWERV
GPMI_LAWIP       ILHPFMDGRDTGPKDGLKFMKEIVSFLTSTS------SGVIGSFCGRFYAMDRDKRWERI
GPMI_DESVH       VVHAFLDGRDTAPTSGVGYVKRLASFLESNR------AGRIGSLVGRYYAMDRDKRWDRN
GPMI_RHOBA       AIHAITDGRDTSPRGGLKFVSQLTDHCEASG------VGVVASVIGRFYAMDRDLRWERV
GPMI_SYNY3       CIHAITDGRDTPTNEGAHFVQQIQAHLEKIG------LGRIVSVSGRYYALDRDRRWDRV
GPMI_MICAN       CIHVITDGRDTNVTDGMPAIKRIQEHINKIK------LGRMVTLSGRYYAMDRDRRWDRV
GPMI_NOSS1       CIHAITDGRDTAPTDGINAISALEDYINHVG------IGRIVTVSGRYYAMDRDRRWDRV
GPMI_TRIV2       CIHAITDGRDTAPTDGINAISALEDYINHVG------IGRIVTVSGRYYAMDRDRRWDRI
GPMI_TRIEI       CVHAITDGRDTNPKSGLHVLKQIEYHTNQIG------IGRIATVSGRYYAMDRDKRWDRI
GPMI_SYNE7       YIHAITDGRDTNPTEGVNCITKIERLIATAG------VGQIVTICGRYFAMDRDRRWDRV
GPMI_SYNP6       YIHAITDGRDTNPTEGVNCITKIERLIATAG------VGQIVTICGRYFAMDRDRRWDRV
GPMI_ACAM1       CIHAILDGRDTPPKSAKDEILRLQKQIAHIG------VGQIVTLSGRYFAMDRDRRWDRI
GPMI_SYNJA       YVHAITDGRDTLPRDGARVLAALEKELQWLG------SGVIATLSGRYYAMDRDRRWERT
GPMI_SYNJB       YVHAITDGRDTLPRDGARVLAALEKELQWLG------NGVIATLSGRYYAMDRDRRWERT
GPMI_THEEB       CIHVITDGRDTPPRDAAGVLEELEQRLKTSG------CGRIVTVSGRYYAMDRDRRWERT
GPMI_GLOVI       FIHGMSDGRDTPPTSGVAYFEKLEARIAETG------FGTIATLGGRYFGMDRDRRWDRT
GPMI_PROM1       SLHLFTDGRDTSAKSANKYINTIEAKIKSTG------VGEISSLCGRYWAMDRDNRWERT
GPMI_PROMT       SLHLFTDGRDTSAKSATKYINTIEAKIKATG------VGEISSLCGRYWAMDRDNRWERT
GPMI_PROM3       ALHLITDGRDTPTQSASNYLHQIEDAINASG------VGELASLCGRYWAMDRDHRWERT
GPMI_PROMM       AVHLITDGRDTPIQSASKYLHQIEDAINASG------VGELASLCGRYWAMDRDHRWERT
GPMI_SYNPX       AVHAITDGRDTPTQSAMGSITLVQRAMEEAG------VGHLASLCGRYWAMDRDKRWDRT
GPMI_PROMA       AVHAFTDGRDTPAKSSLQYLKIIKEKFEVLG------IGELATLCGRYWSMDRDNRWERI
GPMI_PROMP       AIHIITDGRDTPAKSAYKYIRQIEDCIKKFK------VGEIASICGRYWIMDRNLIWERT
GPMI_GRATL       CIHAITDGRDTSPYGSKIFIEEINNQIQQFN------HINICTISGRYYSMDRDCRWART
GPMI_ANTSP       CLHLITDGRDTLPKQAKLFVKEIIDIIDENY------NTEICTISGRYYSMDRDCRWSRT
GPMI_PORPU       YIHLITDGRDTNSNSAKSFIKLIADHIEKKS------FVIISTISGRYYAMDRDFRWSRT
GPMI_PYRYE       YLHLITDGRDTSSNSAKYFIKIVADHIEHKQ------FATISTISGRYYAMDRDFRWSRT
GPMI_NATPD       -THAFTDGRDTAPKSGVGFIEDLAATVEEAG------TGDVATVCGRYYAMDRDENWERT
GPMI_HALMA       -SHAFTDGRDTSPTGGEDYLADLEAHVEEHG------TGHVATVCGRYYAMDRDQNWERT
GPMI_HALSA       -VHAFTDGRDTSPTGGEDYLADLEAVADEHG------TGDVASVSGRYYAMDRDQNWART
GPMI_HALWD       -THVFTDGRDTNPHSSEQYLTTLEEVIHTHG------TGDIATVSGRYYAMDRDKNWTRT
GPMI_STRCO       FIHAITDGRDVADHTGEAYLTRVAELAAAAG------TGQIATVIGRGYAMDKAGDLDLT
GPMI_FLAJ1       YVHAFTDGRDVDPKSGAKYIHDLQDYIKDTP-------VKIASIVGRYYAMDRDKRWERV
GPMI_FLAPJ       FIHAFTDGRDVDPKSAIATIENLNKYIHNTP-------AKLASVIGRYYAMDRDKRWERI
GPMI_BACFR       FVHCFMDGRDTDPKSGKGFIEQLEAHCAKSA-------GKVASIIGRYYAMDRDKRWERV
GPMI_BACFN       FVHCFMDGRDTDPKSGKGFIEQLEAHCAKSA-------GKVASIIGRYYAMDRDKRWERV
GPMI_BACTN       FIHCFMDGRDTDPKSGKGFIEELSAHCEKSA-------GKIASIIGRYYAMDRDKRWERV
GPMI_BACV8       FIHCFMDGRDTDPKSGKGFIEQLTAHCEKSA-------GKIASIVGRFYAMDRDKRWERV
GPMI_PARD8       YVHCFMDGRDTDPKSGKGFIEELENHLKTTG-------GKIASIIGRYYAMDRDKRWERV
GPMI_HELPY       CLHLITDGRDVAPKSALTYLKQMQNICNE--------SIQIATISGRFYAMDRDKRFERI
GPMI_HELPH       CLHLITDGRDVAPKSALTYLKQMQNICNE--------NIQIATISGRFYAMDRDKRFERI
GPMI_HELPJ       CLHLITDGRDVAPKSALTYLKQMQNICNE--------NIQIATISGRFYAMDRDNRFERI
GPMI_HELAH       YLHLITDGRDVAPKSALTYLEIMQNICNE--------SIQIATMSGRFYAMDRDNRFERI
GPMI_HELHP       YLHLITDGRDVLPKSALNYLADIESICED--------NVSIASVSGRFYAMDRDKRWDRV
GPMI_WOLSU       LLHLITDGRDVSPTSSKEFIAQALALESD--------LIKIATISGRYYAMDRDKRWDRI
GPMI_ARCB4       FIHIITDGRDVAPNCAKTYINQILEICDE--------DIKIATISGRYYAMDRDNRWDRV
GPMI_SULDN       FLHLITDGRDVSPTSAKKYLAQVEKHLGA--------NIKIATVSGRFYSMDRDNRWERV
GPMI_CAMJ8       FAHAITDGRDVSPKSGLNFIKDLKEFCENL-------GVHFATLCGRFYAMDRDKRWDRV
GPMI_CAMJR       FAHAITDGRDVSPKSGLNFIKDLKGFCENL-------GVHFATLCGRFYAMDRDKRWDRV
GPMI_CAMJJ       FAHAITDGRDVNPKSGLNFIKDLKEFCENL-------GVHFATLCGRFYAMDRDKRWDRV
GPMI_CAMJE       FAHAITDGRDVSPKSGLNFIKDLKEFCENL-------GVHFATLCGRFYAMDRDKRWDRV
GPMI_CAMJD       FAHAITDGRDVSPKSGLNFIKDLKGFCENL-------GVHFATLCGRFYSMDRDKRWDRV
GPMI_EHRRW       VIHIFLDGRDTPPISALKYINILCSHIKDLS------NVSIATISGRYYSMDRDNRLDRT
GPMI_EHRRG       VIHIFLDGRDTPPISALKYINILCSHIKDLN------NVSIATISGRYYSMDRDNRLDRT
GPMI_EHRCJ       AVHIFLDGRDTPPISATKYISILCEHIKHLN------NINIATLSGRYYAMDRDNRLDRT
GPMI_EHRCR       AVHIFLDGRDTPPISAIKYINILREHIKHLN------NVNIATISGRYYSMDRDNKLDRT
GPMI_ANAPZ       FIHVILDGRDVPPRSAEKYIGMLNAKIEHL-------NAEIATVAGRYYAMDRDNRLDRT
GPMI_ANAMM       LIHAFLDGRDVSPRSAKKHVTALNDAVHSY-------DISIATISGRYYAMDRDHRLDRT
GPMI_WOLPM       VIHAFLDGRDTLPNSGKKCIQEFTKSIKGN-------DTRIATVSGRYYAMDRDNRWKRT
GPMI_WOLTR       VIHAFLDGRDTLPNSGKKCVQEFEENIKGN-------DIRIATVSGRYYAMDRDNRWERT
GPMI_ONYPE       FLHAFTDGRDTSPHSGINYIKDLLDYGFN-----------IASVVGRYYALDRDNNWNRI
GPMI_AYWBP       FLHAFTDGRDTGTHSGINYIKNLLDYGFN-----------IASVAGRYYALDRDNNWDRI
GPMI_ACHLI       YLHVFTDGRDTPQESGYGFVKTLVDYGFN-----------VATVSGRFYAMDRDNNWDRV
GPMI_MYCGE       VLHLFGDGRDVAPCSLKQDLEKLMIFLKNYP------NVVIGTIGGRYYGMDRDQRWDRE
GPMI_MYCPN       VLHLFGDGRDVAPCTMKSDLEAFMVFLKDYH------NVIIGTLGGRYYGMDRDQRWDRE
GPMI_MYCGA       ILHIFGDGRDVPPTQLLADLDQL-IKKAETT------KTKIGTISGRFYAMDRDQRWDRI
GPMI_MYCPE       VIHVFGDGRDVAPQSIISSLERLNDVLKKYP------GT-IATISGRFYSMDRDKRWERT
GPMI_MYCPU       SVHVFGDGRDVAPRSIKSSFEKLEKITNKY-------NYDIASISGRFYSMDRDKIFERT
GPMI_MYCS5       AVHVFGDGRDVAPKSIRESLEKLQELVDKY-------GYKIATISGRFYSMDRDKMFDRT
GPMI_MYCMO       SVHVFGDGRDVAPRSILTSIKKLEAITKKY-------NYAIGSIMGRFYAMDRDQIFTRN
GPMI_MYCHP       SVHVFGDGRDVKPQSIKNSLETLKDLCQKF-------GYKISSISGRFYAMDRDSIFSRN
GPMI_MYCH7       NLHLFGDGRDVGPKSIKPWIKMLNLKLKNYE------NYKIASISGRFYSMDRDKMFDRV
GPMI_MYCHJ       NLHLFGDGRDVGPKSIKPWIKMLNLKLKNYE------DYKIASISGRFYSMDRDKMFDRV
GPMI_MYCH2       NLHLFGDGRDVGPKSIKPWIKMLNLKLKNYE------NYKIASISGRFYSMDRDKMFDRV
GPMI_UREP2       VLHLISDGRDDYPYGFAQFIEQINALKKQYN-------IIVKSLSGRYFAMDRDQRWERT
GPMI_UREPA       VLHLISDGRDDYPYGFAQFIEQINALKKQYN-------IIVKSLSGRYFAMDRDQRWERT
GPMI_MYCCT       KFDLITDGRDTKPKLAYDFIKNLLELIKQNNN-----IGIISSVSGRYYAMDRDKRFDRS
                   . . ****                                :. ** : :*:       

GPMI_CLOAB       ELAYNAMVLGKGE----EAESAIKAVDASYH-----DNKTDEFVLPTVIVK-E-------
GPMI_CLONN       ELAYNAMVLGKGE----VATSPKEAVERSYH-----DNKTDEFVLPTVIEK-D-------
GPMI_CLOB1       QLCYNAIVLGKGE----EANSAVEGLEKSYR-----DNKTDEFVLPSVVLK-E-------
GPMI_CLOBL       QLCYNAIVLGKGE----EANSAVEGLEKSYR-----DNKTDEFVLPSVVLK-E-------
GPMI_CLOK5       ELAYNALVYGRGN----KAASASEAVTNSYD-----NGKTDEFIVPTVIEE-D-------
GPMI_CLOPE       ELAYNAMALGEGE----KASSAVEAIEKSYH-----DNKTDEFVLPTVIEE-D-------
GPMI_CLOP1       ELAYNAMVLGEGE----KASSAVEAIEKSYH-----DNKTDEFVLPTVIEE-D-------
GPMI_CLOPS       ELAYNAMVLGEGE----KASSAVEAIEKSYH-----DNKTDEFVLPTVIEE-D-------
GPMI_CLOB8       ELAYNALVLGKGE----TASSATQAIEKSYH-----DNKTDEFVLPTVVTE-N-------
GPMI_CLOTE       ELAYNALVYGTGE----LSNSAVEAIEKSYK-----DNTTDEFVLPTVILK-D-------
GPMI_CLOD6       ELAYNAMVRGIGE----KANSIEEAIQNSYD-----DGKNDEFIMPTVIMK-D-------
GPMI_HUNT2       KLAYDAMVLGRGN----QAQSAKEAVAESYK-----RQEFDEFVKPTVIMK-N-------
GPMI_LACP7       EKAYAALVDGEGV----EAANAVEAVAASYA-----EGVNDEFVLPTVVVK-D-------
GPMI_BACSU       EKAYRAMAYGEGP----SYRSALDVVDDSYA-----NGIYDEFVIPSVITKEN-------
GPMI_BACVZ       EKAYRAMAYGEGP----SYRSAMDVVDDSYA-----NGIHDEFVIPSVITKEN-------
GPMI_BACP2       EKAYRAMAYGEGP----SYQNIYDVVDDSYE-----NGIYDEFVIPSVITREN-------
GPMI_BACLD       EKAYRAMAYGEGP----KYQNPLDVVKDSYE-----NGIYDEFVIPSVITKEN-------
GPMI_GEOSE       EKAYRAMVYGEGP----TYRDPLECIEDSYK-----HGIYDEFVLPSVIVRED-------
GPMI_GEOKA       EKAYRAMVYGEGP----TYRDPLECIEDSYK-----HGIYDEFVLPSVIVRED-------
GPMI_GEOTN       EKAYRAMVYGEGP----TYRDPLECIEDSYK-----NGIYDEFVLPSVIVRED-------
GPMI_BACMQ       EKSYRAMVYGEGP----SYTSAEECVKDSYD-----NGIYDEFVLPSVITKED-------
GPMI_BACAH       EKCYRAMVNGEGP----TYKSAEECVEDSYA-----NGIYDEFVLPSVIVNED-------
GPMI_BACC1       EKCYRAMVNGEGP----TYKSAEECVEDSYA-----NGIYDEFVLPSVIVNED-------
GPMI_BACCR       EKCYRAMVNGEGP----TYKSAEECVEDSYA-----NGIYDEFVLPSVIVNED-------
GPMI_BACHK       EKCYRAMVNGEGP----TYKSAEECVEDSYA-----NGIYDEFVLPSVIVNED-------
GPMI_BACCZ       EKCYRAMVNGEGP----TYKSAEECVEDSYA-----NGIYDEFVLPSVIVNED-------
GPMI_BACAN       EKCYRAMVNGEGP----TYKSAEECVEDSYA-----NGIYDEFVLPSVIVNED-------
GPMI_BACCN       EKCYRAMVYGEGP----TYKNAYECVEDSYA-----NGIYDEFVLPSVIVNED-------
GPMI_BACHD       EKSYRAMVYGEGP----AYSSALDVIKDSYE-----NSIHDEFVIPSVITNED-------
GPMI_BACSK       EKSYRAMVYGEGP----SYKNGLELLDDSYK-----NNIVDEFVIPSVITEED-------
GPMI_OCEIH       KKCYDAMVYGEGP----SYKSAQEVVDDNYA-----NEIYDEFVIPSVITDDN-------
GPMI_STAAS       EKAYNAIRNFDAP----TYATAKEGVEASYN-----EGLTDEFVVPFIVENQN-------
GPMI_STAAW       EKAYNAIRNFDAP----TYATAKEGVEASYN-----EGLTDEFVVPFIVENQN-------
GPMI_STAAC       EKAYNAIRNFDAP----TYATAKEGVEASYN-----EGLTDEFVVPFIVENQN-------
GPMI_STAAM       EKAYNAIRNFDAP----TYATAKEGVEASYN-----EGLTDEFVVPFIVENQN-------
GPMI_STAAN       EKAYNAIRNFDAP----TYATAKEGVEASYN-----EGLTDEFVVPFIVENQN-------
GPMI_STAAR       EKAYNAIRNFDAP----TYATAKEGVEASYN-----EGLTDEFVVPFIVEDQN-------
GPMI_STAEQ       ERAYNAIRNFEGP----TFTSAKAGVEANYK-----NDVTDEFVEPFIVEGQN-------
GPMI_STAES       ERAYNAIRNFEGP----TFTSAKAGVEANYK-----NDVTDEFVEPFIVEGQN-------
GPMI_STAHJ       QKAYNAIRNFEGP----AYASAKEGVEANYA-----NDLTDEFVEPFIVEGQN-------
GPMI_STAS1       EKAYNAIRNFGGT----TFESAKAGVEANYD-----KDLTDEFVEPFIVQDQN-------
GPMI_LISMF       EKAYKAIVNAEGE----KFEDPIELVKASYA-----NDKNDEFVVPAIITK-D-------
GPMI_LISMO       EKAYKAIVSAEGE----KFEDPIELVKASYA-----NDKNDEFVVPAIITK-D-------
GPMI_LISIN       EKAYKAIVSAEGE----KFEDPIELVKASYA-----NDKNDEFVVPAIITK-D-------
GPMI_LISW6       EKAYKAIVSAEGE----KFEDPIELVKASYA-----NDKNDEFVVPAIITK-D-------
GPMI2_METAC      KLAYDALTLGVAPY---TTSDAETAVSDAYA-----RGETDEFVKPTVVTGSD-------
GPMI_METMA       KLAYDALTLGVAPY---KTSDAVTAVSEAYE-----RGETDEFIKPTIVTDSE-------
GPMI1_METBF      KLAYDALTMGVAPY---KTPDAETAVSEAYK-----RGETDEFVKPTVITDSE-------
GPMI1_METAC      KLAYDVLTLGASQY---KAPNAETAVSEAYG-----RGETDEFVKPTVITDHE-------
GPMI2_METBF      KLAYDALTRGVAPY---TAPNAETAVSNAYS-----RGETDEFVKPTIITEQVITEQVIT
GPMI_METBU       EDAYNAITRGDGVY---YSKGPVDAISEGYG-----RGENDEFIKPTVIVDEN-------
GPMI_PSEF5       AQAYNLIVDGQGQF---NAATAQEGLQAAYA-----REESDEFVKATTI-----------
GPMI_PSEPF       AQAYNLIVDGKGEI---NAATAQEGLEAAYA-----RGESDEFVKATSI-----------
GPMI_PSEU2       SSAYNLIVDSTADF---HADSAVAGLEAAYA-----RDENDEFVKATRI-----------
GPMI_PSE14       STAYNLIVDSTAEF---HADSGVAGLEAAYA-----RDENDEFVKATRI-----------
GPMI_PSESM       STAYNLIVDSSAEF---HAATGVAGLEAAYA-----RDENDEFVKATRI-----------
GPMI_PSEP1       SAAYNLIVDSAAEY---TADTALAGLEAAYA-----RDESDEFVKATRI-----------
GPMI_PSEPK       SAAYNLIVDSAAEY---TADTALAGLEAAYA-----RDESDEFVKATRI-----------
GPMI_PSEPG       SAAYNLIVDSAAEY---TADTAQAGLEAAYA-----RDESDEFVKATRI-----------
GPMI_PSEE4       SAAYNLIVDSAAEY---TADSALAGLQAAYA-----REENDEFVKATRI-----------
GPMI_PSEAB       QAAYELIVDGKAEF---TADSSVAALEAAYA-----RGESDEFVKATAVVPAG-------
GPMI_PSEAE       QAAYELIVDGKAEF---TADSSVAALEAAYA-----RGESDEFVKATAVVPAG-------
GPMI_PSEA7       QAAYELIVDGKAEF---TADSSVAALEAAYA-----RGESDEFVKATAVVPAG-------
GPMI_PSEMY       EQAYHLIVDGAGQF---NAASAVEGLQAAYE-----RGESDEFVKATTI-----------
GPMI_ACIAD       EQAYRLLTESEAVR---TAQSAVQGLELAYA-----AGESDEFVKATRI-----------
GPMI_SHEB5       SQAYDLITQGKSKF---QYDNAVTALEAAYE-----RNENDEFVSSSAITDAD-------
GPMI_SHEB8       SQAYDLITQGKSKF---QYDNAVTALEAAYE-----RNENDEFVSSSAITDAD-------
GPMI_SHEB9       SQAYDLITQGKSKF---QYDNAVTALEAAYE-----RNENDEFVSSSAITDAD-------
GPMI_SHEPC       SQAYELITQGKAKF---QYDNAVTALEAAYA-----RDENDEFVSSSAITDVD-------
GPMI_SHESW       SQAYELITQGKAKF---QYDNAVTALEAAYA-----RDENDEFVSSSAITDVD-------
GPMI_SHESR       SQAYDLITQGKAKF---QYDNAVTALEAAYE-----RNENDEFVSSSAITDSE-------
GPMI_SHESA       SQAYELITQGKAKF---QYDNAVTALEAAYE-----RNENDEFVSSSAITDSE-------
GPMI_SHESM       SQAYDLITQGKAKF---QYDNAVTALEAAYE-----RNENDEFVSSSAITDSE-------
GPMI_SHEON       SQAYDLITQGKSKF---QYDNAVTALEAAYS-----RDENDEFVSSSAITDAN-------
GPMI_SHEDO       SQAYELITQGKGKF---SYSNAVDALEAAYS-----RDENDEFVAASSITDAQ-------
GPMI_SHEHH       SQAYELITEGKGLH---QATSAVEGIEAAYT-----RDENDEFVGSTAIPDAQ-------
GPMI_SHEPA       SQAYELITEGKSLH---QSATAVDAIEAAYT-----RDENDEFVGSTVIPDAQ-------
GPMI_SHELP       SQAYELITQGKALH---LYQDAVEALDAAYG-----RDENDEFVASSAITDAD-------
GPMI_SHESH       SQAYELITEGKSLH---QYSNAVEALEAAYA-----RDENDEFVGSSAILDAQ-------
GPMI_ECOK1       EKAYDLLTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_ECOL5       EKAYDLLTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_ECOL6       EKAYDLLTLAQGEF---QADTTVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_SHIBS       EKAYDLLTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_ECO57       EKAYDLLTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_ECO24       EKAYDLLTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_ECOHS       EKAYDLLTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_ECOLC       EKAYDLLTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_SHISS       EKAYDLLTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_ECOLI       EKAYDLLTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_SHIFL       EKAYDLLTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_SHIDS       EKAYDLLTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_SALPA       EKAYDLMTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_SALTY       EKAYDLMTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_SALTI       EKAYDLMTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_SALPB       EKAYDLMTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVILAEG-------
GPMI_SALCH       EKAYDLMTLAQGEF---QADTAVAGLQAAYA-----RDENDEFVKATVIRAEG-------
GPMI_ENT38       EQAYDLMTMAKGEF---QFDTAVAGLEAAYA-----RDENDEFVKATVIRAEG-------
GPMI_CROS8       EQAYDLLTLAKGEY---EAPNAVAGLEAAYA-----RDENDEFVKATVIRGEG-------
GPMI_YERPA       QLAYDLLTQAKGEF---TADNAVAGLQAAYA-----RGENDEFVKPTVIQATG-------
GPMI_YERPP       QLAYDLLTQAKGEF---TADNAVAGLQAAYA-----RGENDEFVKPTVIQATG-------
GPMI_YERPN       QLAYDLLTQAKGEF---TADNAVAGLQAAYA-----RGENDEFVKPTVIQATG-------
GPMI_YERPE       QLAYDLLTQAKGEF---TADNAVAGLQAAYA-----RGENDEFVKPTVIQATG-------
GPMI_YERPS       QLAYDLLTQAKGEF---TADNAVAGLQAAYA-----RGENDEFVKPTVIQATG-------
GPMI_YERP3       QLAYDLLTQAKGEF---TADNAVAGLQAAYA-----RGENDEFVKPTVIQATG-------
GPMI_YERE8       QLAYDLLTQAKGEF---TADNAVVGLQAAYA-----RNENDEFVKPTVIQAAG-------
GPMI_SERP5       QLAYDLLTQAKGDY---VTDNAVGALQAAYE-----RGENDEFVKPTVLQAAG-------
GPMI_VIBC3       EKAYDLLTLAQGEF---TYDSAVEALQAAYA-----REENDEFVKATEIRAAG-------
GPMI_VIBCH       EKAYDLLTLAQGEF---TYDSAVEALQAAYA-----REENDEFVKATEIRAAG-------
GPMI_VIBPA       QVAYDLLTQAKAEF---TAETAVAGLEAAYA-----RDENDEFVKATAIKAEG-------
GPMI_VIBCB       QVAYDLLTQAKAEF---TAETAVAGLEAAYA-----REENDEFVKATAIKAEG-------
GPMI_VIBVU       QVAYDLLTQAKADF---TYDSAVAGLAAAYE-----RGENDEFVKATEIKAEG-------
GPMI_VIBVY       QVAYDLLTQAKADF---TYDSAVAGLAAAYE-----RGENDEFVKATEIKAEG-------
GPMI_ALIF1       QKAYDLMTEAKAEF---TFATAVEGLEAAYA-----REENDEFVQATEIKAEG-------
GPMI_PHOPR       EVAYNLLSAAKADF---TVDSAVAGLTDAYS-----RDENDEFVKATEIRAEG-------
GPMI_AERS4       QQAYDLMTQGKGEF---TADSASEALAAAYA-----RDENDEFVKATRIGAA--------
GPMI_PSYIN       EQAYNLLTQAKADH---TAESALAGLENAYA-----RDENDEFVKATVIGEP--------
GPMI_PSEHT       EKAYNLLTLAQGDF---SYPTGVSALEAAYE-----RDENDEFVAASTITPAG-------
GPMI_PSEA6       EKAYKVIAKGEGAF---NVACAIEGLENSYS-----RDENDEFMQPTVI-----------
GPMI_COLP3       EAAYNLMVNGEGLH---QYNSALDALAAAYE-----RNENDEFVGASAITSPS-------
GPMI_IDILO       EQSYKAVYHGLSGV---TSANATDAVENAYE-----RGETDEFVTPVVI-----------
GPMI_HAHCH       QAAYDLLTLGEAPY---HAESAVQALTAAYE-----RGEDDEFVKATLIKGSS-------
GPMI_SACD2       QQAFDLMVDGKAAF---TAQSATAGLEAAYE-----RDENDEFVKATAIVDAD-------
GPMI_CHRSD       EQAYRVIVEGEGSQ---VATSAEAGLDAAYE-----RGETDEFVAATSIRPH--------
GPMI_METFK       EAAYNLITDGQGEF---ASASALQGLEAAYA-----RDEKDEFVKATAIAAAG-------
GPMI_CHRVO       EPAYRLLVDGEGLF---HAETGLDALKAAYE-----RDENDEFVKATGIGA---------
GPMI_THIDA       KSAYDLLTQGAAEF---SAGSAQAGLEAAYA-----RGETDEFVKATAIVPAD-------
GPMI_COXBU       EKAYDLLTQGTAQF---HALTAKEGLMLAYE-----QGNTDEFVSPTSIHRHN-------
GPMI_COXBR       EKAYDLLTQGTAQF---HALTAKEGLMLAYE-----QGNTDEFVSPTSIHRHN-------
GPMI_COXBN       EKAYDLLTQGTAQF---HAPTAKEGLMLAYE-----QGNTDEFVSPTSIHRHN-------
GPMI_VESOH       RYAYELIAKGKAKF---LAKSALNAIELAYA-----RGETDEFIQSTSI-----------
GPMI_RUTMC       RCAYELIAKGKAKF---LAQSALHAVELAYA-----RGETDEFIQSTSI-----------
GPMI_NITOC       QAAYNLIATGQAEY---EAESAKQALAMAYE-----RGETDEFVQATRIVPSG-------
GPMI_HYDCU       KKAYDAIACGSAEF---EAKDAKEAVELAYA-----RGENDEFIQATVIPRNN-------
GPMI_FRATF       EKAYNAIVNANADF---IYDSALEALEQSYA-----RDQSDEFVIPTCIK-KD-------
GPMI_FRATH       EKAYNAIVNANADF---IYDSALEALEQSYA-----RDQSDEFVIPTCIK-KD-------
GPMI_FRATW       EKAYNAIVNANADF---IYDSALEALEQSYA-----RDQSDEFVIPTCIK-KD-------
GPMI_FRAT1       EKAYNAIVNANADF---IYDSALEALEQSYA-----RDQSDEFVIPTCIK-KD-------
GPMI_FRATT       EKAYNAIVNANADF---IYDSALEALEQSYA-----RDQSDEFVIPTCIK-KD-------
GPMI_FRATN       EKAYNAIVNANADF---IYDSALEALEQSYA-----RDQSDEFVIPTCIK-KD-------
GPMI_FRAP2       EKAYNAIVNADAEF---VCNSALEALEESYA-----RDQSDEFVIPTCIQ-KD-------
GPMI_LEGPH       EPVYNLLTQGKSER---QFPDAETAIHFYYK-----NKISDEFVPPTLIG-KE-------
GPMI_LEGPL       EPVYNLLTQGKSER---QFPDAETAIHFYYK-----NKISDEFVPPTLIG-KE-------
GPMI_LEGPA       EPVYNLLTQGKSER---QFPDAETAIHFYYK-----NKISDEFVPPTLIG-KE-------
GPMI_LEGPC       EPVYNLLTQGKSEH---QFPDAETAIHFYYK-----NKISDEFVPPTLIG-KE-------
GPMI_GEOSL       ERAYNTIVKGEGA----HRPDSAAAIEASYS-----AGVTDEFVEPAVIAPNG-------
GPMI_PELCD       EKAYRAMTEGVGT----SFESSAAAIADAYA-----QGQTDEFVEPRFVG--G-------
GPMI_SYMTH       EKAFLAITQGIGH----TAGSVAEAVERAYA-----RGETDEFVQPTVIE----------
GPMI_RHOS1       KRASDAMLHATGE----HAPDAEAAVAAALA-----RGETDEFIAPTVVGDYA-------
GPMI_RHOS4       KRASDAMLHATGE----HAPDAEAAVAAALA-----RGETDEFIAPTVVGDYA-------
GPMI_RHOS5       KRASDAMLHGQGE----RAADAVAAVAAALA-----RGETDEFIAPTVIGSYT-------
GPMI_DINSH       ARAFVAMVRAQGE----TAESAQAAVAAAYG-----RGETDEFIAPTVIGGYA-------
GPMI_PARDP       ARAYAAMVRAEGL----PAPDAAQAVADAYA-----RGETDEFIQPTVVEGYA-------
GPMI_ROSDO       SKAYQAIVTGTGR----KAASASDAVDQAYG-----QGENDEFISPTVLGGYT-------
GPMI_RUEPO       QEAYDAMVRGEGR----RVSTAHSAIDYAYN-----QSESDEFITASVLTGYD-------
GPMI_RUEST       SEAYDAMVKGAGQF---TAATARDAVENAYG-----RDELDEFVKATVVEGFD-------
GPMI_AGRFC       EKAYDAMVLGKGE----HARDAVSAVAQSYA-----NKVTDEFILPTVIDGYE-------
GPMI_RHOPA       SKAYGVIADADGP----RFADANAVIADGYA-----AGVNDEFIVPAVIGDYQ-------
GPMI_GLUOX       ALAVEAIRDAKGP----HAKDALSALQASYA-----SDKGDEFVLPTVLGDYA-------
GPMI_MAGMM       ERGYRLMALGEGT----PFDSACEAIQAAYD-----AQQTDEFVEPAVMVEQG-------
GPMI_LAWIP       KLAWDAIVHGVGL----HVEDSVKALEQAYA-----SGETDEFIKPRVM--GN-------
GPMI_DESVH       LLAWAMLTRGEGA----PADDPVGAVEAAYA-----AGETDEFVKPRVVVEGG-------
GPMI_RHOBA       EAAYNLMTQGTGQ----TFPSASAAIESYYANPTESSRDGDEFITASSIVPEG-------
GPMI_SYNY3       EKAYRVMTEDGVGDGR----SAAQVIKDYYA-----SDITDEFIPPTRI-----------
GPMI_MICAN       EKAYNVMTSDQGIDGR----SITEVLQAFYD-----QNITDEFIPPTRI-----------
GPMI_NOSS1       QRAYDVMTQDGVGDGR----KAVDVLQASYA-----EGVNDEFIVPVRI-----------
GPMI_TRIV2       QRAYDVMTQDGAGDGR----KAVDVLQASYA-----EGVNDEFIVPVRI-----------
GPMI_TRIEI       QKAYEVMTQDGYGTGC----SASDLLQKSYA-----EGITDEFVLPVRV-----------
GPMI_SYNE7       RKAYELLTIDGEGCGQ----TATEVLQETYA-----KGVSDEFVEPTRL-----------
GPMI_SYNP6       RKAYELLTIDGEGCGQ----TATEVLQETYA-----KGVSDEFVEPTRL-----------
GPMI_ACAM1       QQAYDVMVNDQVAVPR--DWSPLDAITDAYD-----HKTTDEFLPPTRI-----------
GPMI_SYNJA       QKAYEILTEDGPGCGR----SAAEVMEDFYA-----QDITDEFIPPTRL-----------
GPMI_SYNJB       QKAYEIMTQDGPGRGQ----SAAEVMEAFYA-----QDLTDEFIPPTRL-----------
GPMI_THEEB       EAAYRVMTSNEHIQPL----RAVDVARQSYA-----QDIGDEFIVPTRI-----------
GPMI_GLOVI       EAMYRVMTETGPGTGK----RASETLRESHA-----AGKTDEFVLPVRL-----------
GPMI_PROM1       SKAYELLTDPRFALS--K-LSAAESINKSYQ-----EGITDEFIEPVRL-----------
GPMI_PROMT       SKAYELLTDPRFAIS--K-LSAAESINKSYQ-----EGITDEFIEPVRL-----------
GPMI_PROM3       IRAYEVLTDPNQSIS--R-VTAEDVLSASYA-----NGTTDEFLEPTRL-----------
GPMI_PROMM       IRAYEVLTDPNQSIS--R-VTAEDVLSASYA-----NGTTDEFLEPTRL-----------
GPMI_SYNPX       EKAYDLYTDPTRSIS--D-QSPQQLLAESYA-----AGITDEFLKPVRL-----------
GPMI_PROMA       EKAYELLTNPNYPLS--E-LSSDEIITNSYD-----SSITDEFLEPIRL-----------
GPMI_PROMP       EKAFVNLTDPNGKKI--D-ISPADYLNKSYN-----ANITDEFLEPIRI-----------
GPMI_GRATL       EKSYNTLL-KNTLGF--T-KDPILMINEYYK-----KNISDEFIPPTRL-----------
GPMI_ANTSP       EKAYKAMV-ENSCNQNSS-SDILSIIDKYYE-----QNISDEFLPPTKI-----------
GPMI_PORPU       KAAYTVLTSDNSDITNQP-LNYNDLIDHYYN-----KGISDEFIPPSRI-----------
GPMI_PYRYE       QAAYNILTSNNSIKLNAS-VNYGDLIDHYYN-----KGISDEFIPPSRI-----------
GPMI_NATPD       KRAYDAIVHREA-PH--EADSAVAAVAASYD-----RGDTDEYVEPTLVS----------
GPMI_HALMA       RRAYDAIVHREG-DH--HADEAVTAATESYA-----RDTTDEFIEPTTV-----------
GPMI_HALSA       KRAYDAITRSDGVAH--HAAAAVDAVTDSYE-----RGDTDEFVEPTTI-----------
GPMI_HALWD       RMSYDAIVNRTA-EH--TTSTALEAVSESYD-----RGDTDEFIEPTLI-----------
GPMI_STRCO       ERAVALVADGRG-----SPADSAHSAVHSSE-----RG--DEWVPASVLT--E-------
GPMI_FLAJ1       KLAYDLVVNGVGTP----STNPVSSVLESYE-----KDVTDEFIEPVVIVDENA------
GPMI_FLAPJ       KLAYDLLVNGKGKP----SQDAVLSISNSYQ-----NNITDEFIEPIIMTDDNN------
GPMI_BACFR       KEAYDLLVNGIGKK----ATDMVQAMQESYD-----EGVTDEFIKPIVNAGVD-------
GPMI_BACFN       KEAYDLLVNGIGKK----ATDMVQAMQESYD-----EGVTDEFIKPIVNAGVD-------
GPMI_BACTN       KEAYDLLVNGQGKK----ATDMVQAMQESYD-----EGVTDEFIKPIVNANCD-------
GPMI_BACV8       KEAYDLLVEGKGKQ----ATDMVQAMQESYD-----EGVTDEFIKPINNSTVD-------
GPMI_PARD8       KEAYDLLVEGKGKQ----AECMVKAMEESYA-----EGVTDEFIKPIVHVENGK------
GPMI_HELPY       ELAYHSLMGLNH-----TPLSPSEYIQSQYD-----KNITDEFIMPACF-----------
GPMI_HELPH       ELAYHSLMGLNH-----TPLSPSEYIQSQYD-----KNITDEFITPACF-----------
GPMI_HELPJ       ELAYNSLMGLNH-----TPLSPSEYIQSQYD-----KNITDEFIIPACF-----------
GPMI_HELAH       KLAYNSLMGLTDP----TPLSPSEYIQSQYD-----KNITDEFIMPTCF-----------
GPMI_HELHP       QKAYESIALGKNP----TNLSPKEYIQSQYD-----EGIFDEFLTPVSF-----------
GPMI_WOLSU       KRAFGVIARGDSP----TSLTPQEYIQAQYQ-----AGITDEFIEPAAL-----------
GPMI_ARCB4       KKAYDSITFANPK----TQDDILSYIETSYK-----NEIFDEFIEPTSF-----------
GPMI_SULDN       QKGYEAIVKAEPK----TTLNPSEYIDASYA-----KNETDEFIEPIAF-----------
GPMI_CAMJ8       KEYYECLL-GKAY----KVPNLLEYLQKSYD-----ENVTDEFIKAAQN-----------
GPMI_CAMJR       KEYYECLL-GKAY----KVPNLLEYLQKSYD-----ENVTDEFIKAAQN-----------
GPMI_CAMJJ       KECYECLL-GKAY----KVPNLLEYLQKSYD-----ENVTDEFIKAVQN-----------
GPMI_CAMJE       KEYYECLL-GKAY----KVPNLLEYLQKSYD-----ENVTDEFIKAAQN-----------
GPMI_CAMJD       KEYYECLL-GKAY----KVPNLLEYLQKSYD-----ENITDEFIKATQN-----------
GPMI_EHRRW       TKAYNSIAFGHGK----RYEDPISAVQDNYN-----AGITDEFIIPCVI-----------
GPMI_EHRRG       TKAYNSIAFGDGK----RYEEPISAVQDNYN-----AGITDEFIIPCVI-----------
GPMI_EHRCJ       TKAYNAIAFANAK----RYEDPLTAVQDSYN-----LGITDEFILPCII-----------
GPMI_EHRCR       RTAYKAMAFADAK----RYTDPSLAIQDSYN-----AGITDEFILPCVI-----------
GPMI_ANAPZ       CKAYDAIAYATGP----RSGSAMEALEKSYN-----SGVTDEFMVPTVI-----------
GPMI_ANAMM       EKAYEAIALARGP----RYRDAMTAIESSYS-----EGISDEFLVPSVI-----------
GPMI_WOLPM       IEAYEAIAFAKAP----CHDNAVSLIENNYQ-----NNITDEFIRPAVI-----------
GPMI_WOLTR       IETYEAIAFARAT----CHNNVMSLIDNNYQ-----NNITDEFIRPTVI-----------
GPMI_ONYPE       NLVYNMLTSKQAPV---IDLPLEDTIQNFYN-----QGITDEFITPFITN----------
GPMI_AYWBP       NLVYNMLTSKQAPV---ITLSLEKTMQNFYN-----QGITDEFITPFITD----------
GPMI_ACHLI       QLAFDAMTLGDGPH---FNSALDG-IESSYK-----SGIQDEFIKPFIVN----------
GPMI_MYCGE       MIAYKALLGVSK----NKFNDPIGYIETQYQ-----NQITDEFIYPAINANLNS------
GPMI_MYCPN       EIAYNAILGNSK----ASFTDPVAYVQSAYD-----QKVTDEFLYPAVNGNVDK------
GPMI_MYCGA       DLAYNNLLSNTG----KSFADLKTYVKDSYQ-----QNITDEFIVPAYNNNYKS------
GPMI_MYCPE       KQAYDNLLGISN----NYFDNPIDYVNKQYS-----ENIFDEFLVPARINDSN-------
GPMI_MYCPU       EKAYEALLGNSN----SKFDNWSEFLNKQYS-----QEISDEFFIPSINASKNV------
GPMI_MYCS5       EKAYKAILGKSG----NEFSSALEYLDLQYS-----QNITDEFLEPAKNSTLDS------
GPMI_MYCMO       EQALEVMMGKTT----NYFTNASEYIKAQYQ-----KDISDEFFIPAINKDYLA------
GPMI_MYCHP       QEAYDAILGQSK----NVIENIDDYIESQYK-----KGIFDEFFEPAQLKD---------
GPMI_MYCH7       ELGYNALLGKAE----NTFTDPIDYINFQYE-----KGVSDEFFEPAINLKVNK------
GPMI_MYCHJ       ELGYNALLGKAE----NTFTDPIDYINFQYE-----KGVSDEFFEPAINLKVNK------
GPMI_MYCH2       ELGYNALLGKAE----NTFTDPIDYVNFQYE-----KGVSDEFFEPAINLKVNK------
GPMI_UREP2       QKAFNAMFVKQDK---ICEKTFLEVAQSIAN-----SYKSDEFVQPVVFNDDE-------
GPMI_UREPA       QKAFNAMFVKQDK---ICEKTFLEVAQSIAN-----SYKSDEFVQPVVFNDDE-------
GPMI_MYCCT       RIAYNAIVNRNNV---RSFTNILDYIQQEYM-----INHDDEMIIPAFNQDDF-------
                                                         ** . .              

GPMI_CLOAB       ---GKPVATIKDKDSVIFFNFRPDRARQITRAIAEEAFDG-------FKR---DR--LNI
GPMI_CLONN       ---GKPVATIKSNDSVVFFNFRPDRARQITRAINDKEFDG-------FKR---ET--LNL
GPMI_CLOB1       ---GKPKAKIENKDSVVFFNFRPDRARELTRAINDKVFDG-------FER---ET--LDL
GPMI_CLOBL       ---GKPKAKIENKDSVVFFNFRPDRARELTRAINDKVFDG-------FER---ET--LDL
GPMI_CLOK5       ---NKPVTTIKNGDSVIFFNFRPDRARQLTRALNDNIFKG-------FKR---EK--LDL
GPMI_CLOPE       ---GHPVARIKDGDSVIFFNFRPDRAREITRAIVDPEFKG-------FER---KQ--LHV
GPMI_CLOP1       ---GHPVARIKDGDSVIFFNFRPDRAREITRAIVDPEFKG-------FER---KQ--LHV
GPMI_CLOPS       ---GHPVSRIKDGDSVIFFNFRPDRAREITRAIVDPEFKG-------FER---KQ--LHV
GPMI_CLOB8       ---GNPTANIKNGDSVIFFNFRPDRAREITRAINDKEFAG-------FKR---ET--LDL
GPMI_CLOTE       ---GKPTGTIKDEDSIIFFNFRPDRARQITRALNDKDFDG-------FER---KR--LKL
GPMI_CLOD6       ---DKPVGSIKENDSIIFFNFRPDRARQITRALVCEEFDG-------FKR---ED--IKN
GPMI_HUNT2       ---GSPVATVGENDSIIFFNFRPDRAREITRAFTEVNFSG-------FER---EKGYFPV
GPMI_LACP7       ---GKAIAPIKANDSIIFFNFRPDRAREITRAFCTDDFDG-------FVR---KSGRLPL
GPMI_BACSU       ---GEPVAKIQDGDSVIFYNFRPDRAIQISNTFTNKDFRD-------FDRG--ENYPKNL
GPMI_BACVZ       ---GEPVAKIHDGDSVIFYNFRPDRAIQISNTFTNKDFRD-------FDRG--ENHPKNL
GPMI_BACP2       ---GEPVAKVNDGDSVIFYNFRPDRAIQISNTFTNEDFRS-------FDRG--EAHPKNL
GPMI_BACLD       ---GEPVATIKDNDAVIFYNFRPDRAIQISNTFTNDDFRD-------FDRG--DKHPKNL
GPMI_GEOSE       ---GRPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFRE-------FDRG--PKHPKHL
GPMI_GEOKA       ---GRPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFRE-------FDRG--PKHPKHL
GPMI_GEOTN       ---GSPVATIQDNDAIIFYNFRPDRAIQISNTFTNEDFRE-------FDRG--PKHPKNL
GPMI_BACMQ       ---GSPVATIQDEDAVIFYNFRPDRAIQISNTFANEDFRS-------FDRG--EKHPKHL
GPMI_BACAH       ---NTPVATINDDDAVIFYNFRPDRAIQIARVFTNEDFRE-------FDRG--EKVPHIP
GPMI_BACC1       ---NTPVATINDDDAVIFYNFRPDRAIQIARVFTNEDFRE-------FDRG--EKVPHIP
GPMI_BACCR       ---NTPVATINDDDAVIFYNFRPDRAIQIARVFTNEDFRE-------FDRG--EKVPHIP
GPMI_BACHK       ---NTPVATINDDDAVIFYNFRPDRAIQIARVFTNEDFRE-------FDRG--EKVPHIP
GPMI_BACCZ       ---NTPVATINDDDAVIFYNFRPDRAIQIARVFTNEDFRE-------FDRG--EKVPHIP
GPMI_BACAN       ---NTPVATINDDDAVIFYNFRPDRAIQIARVFTNGDFRE-------FDRG--EKVPHIP
GPMI_BACCN       ---ETPVATINDDDAVIFYNFRPDRAIQIARVFTNEDFRE-------FDRG--EKVPHIP
GPMI_BACHD       ---GSPVATIEDDDAIIFFNFRPDRAIQMSQVFTNKDFRG-------FDRG--EKLPQNV
GPMI_BACSK       ---GTPVATVKDDDAVIFCNFRPDRAIQLSQVFTNEDFRG-------FDRG--EKMPKRL
GPMI_OCEIH       ---DEPVATIKDEDSIIFYNFRPDRAIQISRTFANEDFRD-------FERG--DKAPKKL
GPMI_STAAS       ---DG----VNDGDAVIFYNFRPDRAAQLSEIFANRAFEG-------FKV----EQVKDL
GPMI_STAAW       ---DG----VNDGDAVIFYNFRPDRAAQLSEIFANRAFEG-------FKV----EQVKDL
GPMI_STAAC       ---DG----VNDGDAVIFYNFRPDRAAQLSEIFANRAFEG-------FKV----EQVKDL
GPMI_STAAM       ---DG----VNDGDTVIFYNFRPDRAAQLSEIFANRAFEG-------FKV----EQVKDL
GPMI_STAAN       ---DG----VNDGDTVIFYNFRPDRAAQLSEIFANRAFEG-------FKV----EQVKDL
GPMI_STAAR       ---DG----VNDGDAVIFYNFRPDRAAQLSEIFANRAFEG-------FKV----EQVKDL
GPMI_STAEQ       ---DG----VNDGDAVIFYNFRPDRAAQLSEIFTNKAFDG-------FKV----EQVDNL
GPMI_STAES       ---DG----VNDGDAVIFYNFRPDRAAQLSEIFTNKAFDG-------FKV----EQVDNL
GPMI_STAHJ       ---NG----INDGDAVIFFNFRPDRAAQLSEVFTNKAFDG-------FKV----EQVKDL
GPMI_STAS1       ---EG----VNDGDAVIFYNFRPDRAGQLSEIFTDKAFEG-------FKV----EQINDL
GPMI_LISMF       ---GKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDH-------FDRG--ANHPKNI
GPMI_LISMO       ---GKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDH-------FDRG--ADHPKNI
GPMI_LISIN       ---GKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDH-------FDRG--ANHPKNI
GPMI_LISW6       ---GKPVATVKDNDAVIFFNFRPDRAIQLSNAFTDKEWDH-------FDRG--ANHPKNI
GPMI2_METAC      ---GKPEAVVQDNDSIIFFNFRPDRARQLTWAFENDDFDG-------FPREK-RPKVH--
GPMI_METMA       ---GNPEAVIQDTDSIVFLNFRPDRARQLTWAFVKDDFEG-------FTREK-RPKVH--
GPMI1_METBF      ---GKPEAVIKDNDSIIFFNFRPDRARQLTWAFVNKDFEN-------FPREK-HPKVY--
GPMI1_METAC      ---EKPVATIRDKDSVIFFNFRADRARQLTWAFVKDDFDG-------FVREK-RPKIY--
GPMI2_METBF      EQAEKPVATVQDNDSVIFFNFRADRARQITWAFVKDDFDG-------FMREK-RPEVY--
GPMI_METBU       ---GRPIGRMNENDTVIFFNFRPDRARQLTYAFVNDEFDN-------FERKS-HPKVH--
GPMI_PSEF5       ----GEPVKVEDGDAVVFMNFRADRARELTRVFVEDDFKD-------FERPR-QPKLA--
GPMI_PSEPF       ----GEPVKVEDGDAVVFMNFRADRARELSRVFVEDGFKE-------FERAR-QPK-V--
GPMI_PSEU2       ----GEAARVEDGDAVVFMNFRADRARELTRVFVEDDFKD-------FERAR-QPK-V--
GPMI_PSE14       ----GEPARVEDGDAVVFMNFRADRARELTRVFVEDDFKD-------FERAR-QPK-V--
GPMI_PSESM       ----GEPANVEDGDAVVFMNFRADRARELTRVFVEDDFKD-------FERAR-QPK-V--
GPMI_PSEP1       ----GDAVKVEDGDAVIFMNFRADRARELSRAFVEPDFTE-------FARAR-LPKMA--
GPMI_PSEPK       ----GEAVKVEDGDAVIFMNFRADRARELSRAFVEPDFTE-------FARAR-LPKMA--
GPMI_PSEPG       ----GEAVKVEDGDAVVFMNFRADRARELSRAFVEPDFTE-------FARAR-LPKMA--
GPMI_PSEE4       ----GEAVKVEDGDAVIFMNFRADRARELSRAFVEPDFNE-------FPRAR-LPKLA--
GPMI_PSEAB       ----AEAVRVEDGDAVIFMNFRADRARELSRAFVEPAFKE-------FPREQ-APQLA--
GPMI_PSEAE       ----AEAVRVEDGDAVIFMNFRADRARELSRAFVEPAFNE-------FPRER-APQLA--
GPMI_PSEA7       ----AEAVRVEDGDAVIFMNFRADRARELSRAFVEPAFGE-------FPRQR-AAQLA--
GPMI_PSEMY       ----GAPVQVEDGDAVVFMNFRADRARELTRAFVEPGFQE-------FERKR-APQV---
GPMI_ACIAD       ----GDAVAVQDGDSIVFMNFRADRARELTRAFVEHDFSG-------FTRQR-IPHLS--
GPMI_SHEB5       ----GQVATLQDGDALIFMNFRADRARQITRSFINPDFDG-------FERAV-VPKM---
GPMI_SHEB8       ----GQVATLQDGDALIFMNFRADRARQITRSFINPDFDG-------FERAV-VPKM---
GPMI_SHEB9       ----GQVATLQDGDALIFMNFRADRARQITRSFINPDFDG-------FERAV-VPKM---
GPMI_SHEPC       ----GKVATLQDGDALIFMNFRADRARQITRSFIHPDFDG-------FERAV-VPKM---
GPMI_SHESW       ----GKVATLQDGDALIFMNFRADRARQITRSFIHPDFDG-------FERAV-VPKM---
GPMI_SHESR       ----GKVASLNDGDALIFMNFRADRARQITRSFINADFDG-------FERAV-TPKV---
GPMI_SHESA       ----GKVASLNDGDALIFMNFRADRARQITRSFINADFDG-------FERAV-TPKV---
GPMI_SHESM       ----GKVASLNDGDALIFMNFRADRARQITRSFINADFDG-------FERAV-TPKV---
GPMI_SHEON       ----GQVATLQDGDALIFMNFRADRARQITRSFINPEFDG-------FARAV-TPKV---
GPMI_SHEDO       ----GQTASLNDGDSLIFMNFRADRARQITRSVINADFDG-------FERAV-TPKI---
GPMI_SHEHH       ----GNIIKLEDNDALIFMNFRADRARQITRSFINADFDG-------FKRAV-TPKI---
GPMI_SHEPA       ----GNIAKLVDNDALIFMNFRADRARQITRSFVDADFDG-------FERAV-TPKI---
GPMI_SHELP       ----GQVATLNDNDALIFMNFRADRARQITRSFVDPGFDG-------FERAV-TPKI---
GPMI_SHESH       ----GDSAQLADGDALIFMNFRADRARQITRSFVDADFDG-------FERNV-TPKA---
GPMI_ECOK1       ----QPDAAMEDGDALIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNV---
GPMI_ECOL5       ----QPDAAMEDGDALIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNV---
GPMI_ECOL6       ----QPDAAMEDGDALIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNV---
GPMI_SHIBS       ----QPDAAMEDGDALIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNV---
GPMI_ECO57       ----QPDAAMEDGDALIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNV---
GPMI_ECO24       ----QPDAAMEDGDALIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNV---
GPMI_ECOHS       ----QPDAAMEDGDALIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNV---
GPMI_ECOLC       ----QPDAAMEDGDALIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNV---
GPMI_SHISS       ----QPDAAMEDGDALIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNV---
GPMI_ECOLI       ----QPDAAMEDGDALIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNV---
GPMI_SHIFL       ----QPDAAMEDGDALIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNV---
GPMI_SHIDS       ----QPDAAMEDGDALIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNV---
GPMI_SALPA       ----QADAAMEDGDTLIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNL---
GPMI_SALTY       ----QADAAMEDGDTLIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNL---
GPMI_SALTI       ----QADAAMEDGDTLIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNL---
GPMI_SALPB       ----QADAAMEDGDTLIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNL---
GPMI_SALCH       ----QADAAMEDGDTLIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNL---
GPMI_ENT38       ----QADAAMEDGDALIFMNFRADRAREITRAFVNADFDG-------FARKK-VVNL---
GPMI_CROS8       ----EASAAMEDGDALIFMNFRADRARQITRAFVNRDFEG-------FSRKK-VVKFA--
GPMI_YERPA       ----EADAAMNEGDTLIFMNFRADRARQITRTFVNAEFDG-------FKRDK-VVNFG--
GPMI_YERPP       ----EADAAMNEGDTLIFMNFRADRARQITRTFVNAEFDG-------FKRDK-VVNFG--
GPMI_YERPN       ----EADAAMNEGDTLIFMNFRADRARQITRTFVNAEFDG-------FKRDK-VVNFG--
GPMI_YERPE       ----EADAAMNEGDTLIFMNFRADRARQITRTFVNAEFDG-------FKRDK-VVNFG--
GPMI_YERPS       ----EADAAMNEGDTLIFMNFRADRARQITRTFVNADFDG-------FKRDK-VVNFG--
GPMI_YERP3       ----EADAAMNEGDTLIFMNFRADRVRQITRTFVNADFDG-------FKRDK-VVNFG--
GPMI_YERE8       ----EPDAAMNDGDALIFMNFRADRARQITRTFVNADFDG-------FKRDK-VVNFG--
GPMI_SERP5       ----EAKAELHDGDALIFMNFRADRARQIVRSFVNADFDG-------FPRAK-IINFG--
GPMI_VIBC3       ----QESAAMQDGDALLFMNYRADRARQITRTFV-PDFAG-------FSRKA-FPAL---
GPMI_VIBCH       ----QESAAMQDGDALLFMNYRADRARQITRTFV-PDFAG-------FSRKA-FPAL---
GPMI_VIBPA       ----QEDAIMQDGDAVIFMNYRADRARQITRAFV-PGFDG-------FERAV-FPAI---
GPMI_VIBCB       ----QEDAIMQDGDAVIFMNYRADRARQITRAFV-PAFDG-------FERAV-FPAI---
GPMI_VIBVU       ----QESAAMQDGDAVIFMNYRADRARQITRTFV-ADFAG-------FERAV-FPAV---
GPMI_VIBVY       ----QESAAMQDGDAVIFMNYRADRARQITRTFV-ADFAG-------FERAA-FPAV---
GPMI_ALIF1       ----EESAAIVDGDAVIFMNYRADRARQITRTFV-PSFDG-------FTRNV-FPAI---
GPMI_PHOPR       ----QESAAMVDGDTVIFMNYRADRAREITRAFE-ADFTS-------FVRTQ-TPALA--
GPMI_AERS4       -------APMQDGDALIFMNFRADRAREITRAFVDSDFTG-------FARAA-TPAL---
GPMI_PSYIN       -------AAIEDGDAVLFMNFRADRARELTYTFTDSNFSG-------FERAS-VPNV---
GPMI_PSEHT       ----AEPVQINDGDTVIFANFRADRAREITRAFVEPNFDG-------FAKQK-SPALS--
GPMI_PSEA6       ----GDAAPIEDGDALVFMNFRADRAREISRPFVEKDFSD-------FEKGE-HIDLS--
GPMI_COLP3       ----GKAIKVNDGDALIFMNFRADRARQFSRCFTDTNFNG-------FERKR-IPAIS--
GPMI_IDILO       ----GQPAPIANGDSVFFMNFRADRAREMTQAFVDKDFDG-------FDRGS-RADIS--
GPMI_HAHCH       ----DNDAVISDGDAVIFMNFRADRARELTRCFVEQDFDG-------FQRNK-LPKLA--
GPMI_SACD2       ----GKPVTIEDGDAVIFMNFRPDRARQLTNAFVDKNFDG-------FARAR-VPALS--
GPMI_CHRSD       ----GEPVRMADGDAALFLNFRADRARELTRAFVEDDFSG-------FTRQA-RPKLAHE
GPMI_METFK       ----EQPVTMEDGDVVIFVNFRSDRARQLTHALLDPDFEG-------FNRRR-QPKLA--
GPMI_CHRVO       ------PVKMQDGDALIFMNFRADRARQLTSALTDPAFDG-------FKAR--QPKFG--
GPMI_THIDA       ----GRPVTMEDGDSVIFLNFRSDRARQLSRPFIEPDFSE-------FERER-TPRLA--
GPMI_COXBU       ----ETPITIEDGDVVVFMNFRADRARQLTYAFLDDHFTA-------FNRQV-RPKL--S
GPMI_COXBR       ----ETPITIEDGDVVVFMNFRADRARQLTYAFLDDHFTA-------FNRQV-RPKL--S
GPMI_COXBN       ----ETPITIEDGDVVVFMNFRADRARQLTYAFLDDHFTA-------FNRQV-RPKL--S
GPMI_VESOH       ----KAPTSIKKGDVLILMNYRADRARQITCAFTDEDFQG-------FSRGT-FVP---T
GPMI_RUTMC       ----KIPISIKKGDVLIFMNYRADRARQITRAFTDENLQG-------FSRGT-FVP---T
GPMI_NITOC       ----KAPVQVKDGDVIIFMNFRSDRARQITRAFIEPDFTG-------FERLY-WPKL--A
GPMI_HYDCU       ----GKPARVKDGDSVIFMNFRSDRARQLTEAFIMDDFAD-------FHRCK-TPVL--S
GPMI_FRATF       ----GHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDH-------FPRKK-HLNIN--
GPMI_FRATH       ----GHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDH-------FPRKK-HLNIN--
GPMI_FRATW       ----GHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDH-------FPRKK-HLNIN--
GPMI_FRAT1       ----GHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDH-------FPRKK-HLNIN--
GPMI_FRATT       ----GHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDH-------FPRKK-HLNIN--
GPMI_FRATN       ----GHLVKVQDNDSVIFMNFRADRAREISHAFTDESFDH-------FPRKK-HLNIN--
GPMI_FRAP2       ----GKLIKVEDNDSVIFMNFRADRAREISHAFTDENFDH-------FPKDR-HLNIN--
GPMI_LEGPH       ----H---SIQDGDAVLFFNFRADRARQLTSTFLDPSFKG-------FERKT-LPKLSY-
GPMI_LEGPL       ----H---SIQDGDAVLFFNFRADRARQLTSTFLDPSFKG-------FERKT-LPKLSY-
GPMI_LEGPA       ----H---SIQDGDAVLFFNFRADRARQLTSTFLDPLFKG-------FERKT-LPKLSC-
GPMI_LEGPC       ----H---SIQDGDAVLFFNFRADRARQLTSTFLDPLFKG-------FERKT-LPKLSY-
GPMI_GEOSL       ----SPLGLLADGDGFICFNFRSDRAREITRALTDPAFA-------GFDRS---PWPRLA
GPMI_PELCD       ----EKPCTVDDGDGMIFFNFRADRAREITRTFTSSDFS-------GFSRE---KTPRLA
GPMI_SYMTH       ----GVDGRVREGDGVIFFNFRPDRARQLVRALHETAFD-------GFKRP---EGYRPV
GPMI_RHOS1       ----G----ARDGDGFFCLNFRADRAREILAGLGQPGFD-------AYETG---TRPDWS
GPMI_RHOS4       ----G----ARDGDGFFCLNFRADRAREILAGLAQPGFD-------AYDTG---ARPDWS
GPMI_RHOS5       ----G----AMDGDGFFCLNFRADRAREILAGLAQPGFD-------AYDTG---RRPDWS
GPMI_DINSH       ----G----MRDGDGIFCLNFRADRAREILRAMAQPDFD-------AFDPA---GLPDFA
GPMI_PARDP       ----G----AKDGDGFFCLNFRADRAREILAAIGQPDFS-------AFDTG---RRPEWA
GPMI_ROSDO       ----G----AKDNDGFFCLNFRADRAREIMAAIGDPDFT-------AFETG---ARPKWA
GPMI_RUEPO       ----G----MRDGDSLFCLNFRADRAREILRAIGEPGFA-------DFDTG---ARPALS
GPMI_RUEST       ----G----IKEGDGFFCLNFRADRAREILRAIGEPGFA-------EFDTG---PRPALA
GPMI_AGRFC       ----G----FKAGDGLFCLNFRADRAREILLAIGADDFD-------GFAR----EKPVLS
GPMI_RHOPA       ----G----MRDGDGVLCFNFRADRVREILAALLDSAFA-------GFPRK---QVKQIA
GPMI_GLUOX       ----G----MKDGDGILACNFRADRIRQLLDVLVLPDFT-------EYDSG---RKVKFA
GPMI_MAGMM       ----QPIGMINDGDTLICMNFRADRVREISHVFTDTTFE-------PFVRD---GLPKLS
GPMI_LAWIP       ----SSVNCVQDNDAVLFFNFRADRARELVSAFILPDFN-------GFDRG---RVPHLS
GPMI_DESVH       ----SPIGTIRDGDGVFFFNFRADRARQLSHMFVDGTFE-------HGDRG---HVPSLA
GPMI_RHOBA       ----GSPITVQPGDAVLFMNYRGDRTREITKAFTFDDAAWKDIPGGGFDRG---KKIDNL
GPMI_SYNY3       -----GAGAIASGDGVIFYNFRPDRARQLCYALVNPSFD-------GFPRE----RIQPL
GPMI_MICAN       -----APGAIEAGDGVIFYNFRPDRARQLCYALTMPDFE-------DFDRD----LISPL
GPMI_NOSS1       -----APGTVEPGDGVIFFNFRPDRSRQLTQAFVSPEFT-------GFARQ----QIKPL
GPMI_TRIV2       -----APGTVESGDGVIFFNFRPDRSRQLTQAFVSPEFT-------GFARQ----QIKPL
GPMI_TRIEI       -----APGAVEPGDGVIFFNFRPDRARQLTQAFVAPDFN-------GFERQ----TIQPL
GPMI_SYNE7       -----APGAIAPGDGVIFFNFRPDRARQLTYAFVEAEFE-------GFERD----LIQPL
GPMI_SYNP6       -----APGAIAPGDGVIFFNFRPDRARQLTYAFVEAEFE-------GFERD----LIQPL
GPMI_ACAM1       -----APGAIEAGDGVIFFNFRPDRARQLTQAFVDPKFD-------GFERE----QVKPL
GPMI_SYNJA       -----APGAVQSGDAVIFFNFRPDRARQLTQAFVCPDFS-------GFQRR----LIPDL
GPMI_SYNJB       -----APGAVQPGDAVLFFNFRPDRARQLTQAFVCPDFS-------GFQRP----LLPAL
GPMI_THEEB       -----AAGAVEPGDGVVFFNFRPDRARQLTQAFIDPNFS-------GFERA----LITPL
GPMI_GLOVI       -----AAGAVEPGDGVIYFNFRPDRARQLTRAFVQADFD-------GFVRP----YLDPL
GPMI_PROM1       -----SSSFLKDGDGVVFFNFRPDRARQLVKALKLKDFD-------GFERK----NRADI
GPMI_PROMT       -----SSSFLKDGDGVVFFNFRPDRARQLVKALKLKDFD-------GFERK----NKTDI
GPMI_PROM3       -----SNNYFKDGDGLVMFNFRPDRARQLVQSLTLPDFD-------GFPRA----NQPSL
GPMI_PROMM       -----SNNYFKDGDGLVMFNFRPDRARQLVQALTLPDFD-------GFPRA----NQPSL
GPMI_SYNPX       -----SDDVMQDGDSVLVFNFRPDRARQIVQTLCLDDFD-------GFERR----TTPKL
GPMI_PROMA       -----TPSYLKDGDGLIMFNFRPDRARQLIKSITLPSFS-------EFKRK----YQPQL
GPMI_PROMP       -----SKDFLKDEDSLICFNFRPDRARQIIKALSEKEFD-------NFKRK----SIPDV
GPMI_GRATL       -----HKGSIENNDGIIFFNFRPDRMRQLVHAFTKSTFK-------GFNTT----SFHNL
GPMI_ANTSP       -----SMHNIVHNDSLIFFNFRPDRIRQLLHSFAKPNFK-------GFQRK----TIKNL
GPMI_PORPU       -----NTGSIKDGDAIIFFNFRPDRMRQLVQALVQKPFN-------CFLTK----SLSHL
GPMI_PYRYE       -----NLGSIKDNDAIVFFNFRPDRMRQIVQAFVQKPFN-------CFATK----PLYNL
GPMI_NATPD       ----GTDAPLSADDAVVFFNFRADRARQLVRMLADIDP--------DWAFE---TDPPAA
GPMI_HALMA       ----GDHAGLEAGDAVVFFNFRSDRARQLTRMLGDIRPE-------DWGSD---TEPPDT
GPMI_HALSA       ----EGGAALSDGDAVVFANFRADRARQLTRLLADIHPA-------DWDADGIETNPPAV
GPMI_HALWD       ----DNTPAVEDGDAVFVFNFRPDRVRQLVRMLADIDP--------AWSFE---TDPPTT
GPMI_STRCO       ----AGDARVADGDAVLWFNFRSDRIQQFADRLHEHLT----------------ASGRTV
GPMI_FLAJ1       ----KPLATIVEGDVVIFFNFRTDRGRELTEALSQHDFHE-----------QNMHKL-NL
GPMI_FLAPJ       ----NPIATIQEDDVVIFFNFRTDRGRELTEALSQQDFHE-----------QNMHKL-NL
GPMI_BACFR       -------GTIKEGDVVIFFNYRNDRAKELTVVLTQQDMPE-----------AGMHTIPGL
GPMI_BACFN       -------GTIKEGDVVIFFNYRNDRAKELTVVLTQQDMPE-----------AGMHTIPGL
GPMI_BACTN       -------GTIKEGDVVIFFNYRNDRAKELTVVLTQQDMPE-----------AGMHTIPGL
GPMI_BACV8       -------GTIKEGDVVIFFNYRNDRAKELTVVLTQQDMPE-----------QGMHTIPGL
GPMI_PARD8       -----PVAVIEEGDVVIFFNYRNDRAKELTVVLTQQDMPE-----------AGMHTIPGL
GPMI_HELPY       ----KNYCGMQDDESFIFINFRNDRAREIVSALGQKQFSG-------FKRQ----VFKKL
GPMI_HELPH       ----KNYYGMQDDESFIFINFRNDRAREIVSALGQKEFSG-------FKRQ----AFKKL
GPMI_HELPJ       ----KNYCGMQDDESFIFINFRNDRAREIVSALGQKEFNS-------FKRQ----AFKKL
GPMI_HELAH       ----KNYCGMQDDESFIFINFRNDRAREITSALGQKEFNG-------FKRQ----VFKKL
GPMI_HELHP       ----GGFQGMNDDESFVFVNFRSDRAREIVDCLGNPQFKE-------FKRE----RYVKL
GPMI_WOLSU       ----GGYQGFEPSDGFVFANFRSDRAREIVSALGGASFEG-------FDRG----AYQPP
GPMI_ARCB4       ----EGYNGIEKNDGIIFCNFRSDRMREISSVFAKADFNE-------FDT-----FKGSL
GPMI_SULDN       ----DGYDGMSDNDSVLMINFRSDRMREITTAIGESNFSS-------FEK-----SDIKL
GPMI_CAMJ8       ----ENYKGMREEDGIIFINFRNDRMKQLVEVLNSKDFKE-------FER-----EKIFE
GPMI_CAMJR       ----ENYKGMREEDGIIFINFRNDRMKQLVEVLNSKDFKE-------FER-----EKIFE
GPMI_CAMJJ       ----ENYKGMREEDGIIFINFRNDRMKQLVEVLNSKDFKE-------FER-----EKIFE
GPMI_CAMJE       ----ENYKGMREEDGIIFINFRNDRMKQLVEVLNSKDFKE-------FER-----EKIFE
GPMI_CAMJD       ----ENYKGMREEDGIIFINFRNDRMKQLVEVLNSKDFKE-------FER-----EKVFE
GPMI_EHRRW       ----GNYQGMNPTDGFIMTNFRSDRVIQILKMITED-----------QNTN----HITLK
GPMI_EHRRG       ----GNYQGMNPTDGFIMTNFRSDRVIQILKMITED-----------QNTN----HITLK
GPMI_EHRCJ       ----GNYQGMKPQDGFIMTNFRSDRVIQIIKMIIGDI----------KTDN----HITLD
GPMI_EHRCR       ----GDYNGMNPQDGFIMTNFRSDRAIQIIKMIIGDI----------KTDN----HITLE
GPMI_ANAPZ       ----GDYDGMGAEDGVLFTNFRNDRVLQLLGMLLHR-------------------FPEVS
GPMI_ANAMM       ----GDYQGFSPKDGILLTNFRSDRIVQILSMILHR-------------------SQEVS
GPMI_WOLPM       ----GDYQGIKPEDGVLLANFRADRMIQLASILLGKT----------DYAK----VAKFS
GPMI_WOLTR       ----GDYKGIELKDGVLLANFRADRMIQLASILLGKT----------GYTE----VAKFS
GPMI_ONYPE       -----PNGLINDNDAVIFVNFRPDRAMRLATALSNPCATNAFCSE-GKTNFCGTKLLNNL
GPMI_AYWBP       -----PNGLIDDNDAVIFVNFRPDRAMRLATALSNPCATNAFCSE-GKTNFCGNKLVNNL
GPMI_ACHLI       -----DKGLIENDDAVIFANFRPDRAIRIATALSNPSAAKTIYTE-GKPMLNVSKAPKNI
GPMI_MYCGE       -----DQFALNNNDGVIFFNFRPDRARQMSHLIFNSNYYN-------YQPEL--KRKENL
GPMI_MYCPN       -----EQFALKDHDSVIFFNFRPDRARQMSHMLFQTDYYD-------YTPKA--GRKYNL
GPMI_MYCGA       -----DEITIQDNDSVVFANFRPDRARQLSHYVFGSNYYD-------HHPQL--RRK-NL
GPMI_MYCPE       -------VVIKDNDAVIHANFRPDRARQISHLFCGSTVYE-------EKNDH--PLK-NL
GPMI_MYCPU       -----N--FVKDGDSIIFFNFRPDRARQLTHLLIGSSLYD-------FKPKK--PVK-IN
GPMI_MYCS5       -----RY-FLKDNDAVIFFNFRPDRARQLSHLILNSSLYD-------YQPSH--LVK-VS
GPMI_MYCMO       -----KKLNLKDNDAVIFYNFRPDRARQLSHLLIQSNLYN-------YQSKN--QVK-LS
GPMI_MYCHP       ------GVFVKNGDSIIFFNFRPDRARQLSHMFIGSNLYT-------YKPKN--QVQ-ID
GPMI_MYCH7       -----KD-FLADDHPVIFFNFRPDRARQLSHLILQTDLYE-------QKPKN--PIK-TD
GPMI_MYCHJ       -----KD-FLADDHPVIFFNFRPDRARQLSHLILQTDLYE-------QKPKN--PIK-TD
GPMI_MYCH2       -----KD-FLADDHPVIFFNFRPDRARQLSHLILQTDLYE-------QKPKN--PIK-TD
GPMI_UREP2       ------KYNLKPHQKVILANYRSDRMRQLAHLLKPNK-------KFHYNNPF--LVQDVN
GPMI_UREPA       ------KYNLKPHQKVILANYRSDRMRQLAHLLKPNK-------KFHYNNPF--LVQDVN
GPMI_MYCCT       ------NGNLKANDAIIMTNFRPDRAIQISSILTNKNYIAWQS-EAFSDAEF--IGDKIR
                              .  .  *:* **  .:   .                           

GPMI_CLOAB       EFVTMTEYDASFKGV--DVAFGPENITNTLGEYVSNKGLNQLRIAETEKYAHVTFFFNGG
GPMI_CLONN       VFVTMTEYDSTIEGV--EVAFKPESYVNTLGEYVSKQGKKQLRIAETEKYAHVTFFFNGG
GPMI_CLOB1       TYVTVTEYDSTLENV--EVAFPPEHLNNTLGEYVSKNGKKQLRIAETEKYAHVTFFFNGG
GPMI_CLOBL       TYVTMTEYDSTLENV--EVAFPPEHLNNTLGEYVSKNGKKQLRIAETEKYAHVTFFFNGG
GPMI_CLOK5       KFVTMTEYDATLENV--YVAFNNEVYKNTLGEYVSKMEKSQLRIAETEKYAHVTFFFNGG
GPMI_CLOPE       NFVCMTQYDKTLECV--DVAYRPESYTNTLGEYVASKGLNQLRIAETEKYAHVTFFFNGG
GPMI_CLOP1       NFVCMTQYDKTLECV--DVAYRPESYTNTLGEYVASKGLNQLRIAETEKYAHVTFFFNGG
GPMI_CLOPS       NFVCMTQYDKTLECV--DVAYRPENYTNTLGEYVASKGLNQLRIAETEKYAHVTFFFNGG
GPMI_CLOB8       TFVTMTQYDKTLERV--NVAYTPQTLSNTLGEYVSNKGLNQLRIAETEKYAHVTFFFNGG
GPMI_CLOTE       NFITMTQYDKTIENV--RIAYKPQSYKNTLGEYVSSLGLNQLRIAETEKYAHVTFFFNGG
GPMI_CLOD6       FFVCLTEYDITIENV--HIAFGPQSLANTLGEYLAKNGKTQLRAAETEKYAHVTFFFNGG
GPMI_HUNT2       FFVCMTQYDKTFENV--VVAFKPESLENTFGEYISKKGLRQLRIAETEKYAHVTFFFNGG
GPMI_LACP7       TYVCFSEYDVTIPNK--SVAFEKVSITNTFGEYLAEHGKTQARIAETEKYAHVTFFFNGG
GPMI_BACSU       YFVCLTHFSETVDG---YVAFKPINLDNTVGEVLSQHGLKQLRIAETEKYPHVTFFMSGG
GPMI_BACVZ       YFVCLTHFSESVDG---YVAFKPVNLDNTVGEVLAQHGLKQLRIAETEKYPHVTFFMSGG
GPMI_BACP2       HFVCFTHFSETVDG---YVAFKPVNLDNTVGEVLAQNGLKQLRIAETEKYPHVTFFMSGG
GPMI_BACLD       HFVCLTHFSETVDG---YVAFKPVNLDNTVGEVLSQNGLKQLRIAETEKYPHVTFFMSGG
GPMI_GEOSE       FFVCLTHFSETVKG---YVAFKPTNLDNTIGEVLSQHGLRQLRIAETEKYPHVTFFMSGG
GPMI_GEOKA       FFVCLTHFSETVKG---YVAFKPTNLDNTLGEVLSQHGLRQLRIAETEKYPHVTFFMSGG
GPMI_GEOTN       FFVCLTHFSETVKG---YVAFKPTNLDNTIGEVLSQHGLRQLRIAETEKYPHVTFFMSGG
GPMI_BACMQ       HFVCLTHFSETVDG---YVAFKPINLDNTLGEVLSQNNLKQLRIAETEKYPHVTFFMSGG
GPMI_BACAH       EFVCMTHFSETVDG---YVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGG
GPMI_BACC1       EFVCMTHFSETVDG---YVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGG
GPMI_BACCR       EFVCMTHFSETVDG---YVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGG
GPMI_BACHK       EFVCMTHFSETVDG---YVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGG
GPMI_BACCZ       EFVCMTHFSETVDG---YVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGG
GPMI_BACAN       EFVCMTHFSETVDG---YVAFKPMNLDNTLGEVVAQAGLKQLRIAETEKYPHVTFFFSGG
GPMI_BACCN       EFVCMTHFSETVNG---YVAFKPVNLDNTLGEVVSQAGLKQLRIAETEKYPHVTFFFSGG
GPMI_BACHD       YYVCLTHFSETVQG---DVAFKPTNLDNTLGEVLAQQNYKQLRIAETEKYPHVTFFFSGG
GPMI_BACSK       HFVCLTKFSETVKG---FVAFKPTNLDNTLGEVLSQQNYTQLRIAETEKYPHVTFFFSGG
GPMI_OCEIH       DFVMLTNFSETVDG---YVAYQPVNLDNTVGEVLAQNNLNQLRIAETEKYPHVTFFMSGG
GPMI_STAAS       FYATFTKYNDNIDA---AIVFEKVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGG
GPMI_STAAW       FYATFTKYNDNIDA---AIVFEKVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGG
GPMI_STAAC       FYATFTKYNDNIDA---AIVFEKVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGG
GPMI_STAAM       FYATFTKYNDNIDA---AIVFEKVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGG
GPMI_STAAN       FYATFTKYNDNIDA---AIVFEKVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGG
GPMI_STAAR       FYATFTKYNDNIDA---AIVFEKVDLNNTIGEIAQNNNLTQLRIAETEKYPHVTYFMSGG
GPMI_STAEQ       FYATFTKYNDNVDA---EIVFEKVDLNNTIGEVAQDNGLKQLRIAETEKYPHVTYFMSGG
GPMI_STAES       FYATFTKYNDNVDA---EIVFEKVDLNNTIGEVAQDNGLKQLRIAETEKYPHVTYFMSGG
GPMI_STAHJ       FYATFTKYNDNVDT---EVVFEKVDLTNTIGEVAQNNNLKQLRIAETEKYPHVTYFMSGG
GPMI_STAS1       FYATFTKYNDNVNA---EIVFEKVDLTNTIGEVAQDNGLKQLRIAETEKFPHVTYFMSGG
GPMI_LISMF       KFVTMTLYNPSIDA---EVAFEPIEMKNVIGEVLSNEGLSQLRIAETEKYPHVTFFMNGG
GPMI_LISMO       KFVTMTLYNPSIDA---EVAFEPIEMKNVIGEVLSNEGLSQLRIAETEKYPHVTFFMNGG
GPMI_LISIN       KFVTMTLYNPSIDA---EVAFEPIEMKNVIGEVLSNEGLSQLRIAETEKYPHVTFFMNGG
GPMI_LISW6       KFVTMTLYNPSVDA---EVAFEPIEMKNVIGEVLSNEGLSQLRIAETEKYPHVTFFMNGG
GPMI2_METAC      -YVCMAQYDETLD---LPIAFPPEELENVLGEVLSKQGLVQLRIAETEKYAHVTFFLNGG
GPMI_METMA       -YVCMAQYDETLD---LPIAFPPEELTDVLGKVLSDRGLIQLRIAETEKYAHVTFFLNGG
GPMI1_METBF      -YVCMAQYDETLD---LPIAFPPEELENVLGEVLSKQGLAQLRIAETEKYAHVTFFLNGG
GPMI1_METAC      -FVCMARYDEDLD---LPVAFPHEELKNVLGEVLSKQGLTQLRIAETEKYAHVTFFLNGG
GPMI2_METBF      -FVCMTQYDETLE---VPIAFPPIKLENVLGEVLSKHGLIQLRIAETEKYAHVTYFLNGG
GPMI_METBU       -FVCMTEYDEKLE---VPIAFPSEELKNTLGEVLSKEGIKQLRIAETEKYAHVTFFFNGG
GPMI_PSEF5       GFVMLTQYAASIP---APSAFAPGSLENVLGDYLAKNGKTQLRIAETEKYAHVTFFFSGG
GPMI_PSEPF       QYVGLTQYAESIP---APAAFAPGSLENVLGDYLAKNGKTQLRIAETEKYAHVTFFFSGG
GPMI_PSEU2       NYVMLTQYAASIP---APSAFAAGSLKNVLGEYLADNGKTQLRIAETEKYAHVTFFFSGG
GPMI_PSE14       NYVMLTQYAASIP---APSAFAAGSLKNVLGEYLADNGKTQLRIAETEKYAHVTFFFSGG
GPMI_PSESM       NYVMLTQYAASIP---APSAFAAGSLKNVLGEYLADNGKTQLRIAETEKYAHVTFFFSGG
GPMI_PSEP1       AYIGLTQYSAKIP---APAAFAPSSLNNVLGEYLAKNGKTQLRIAETEKYAHVTFFFSGG
GPMI_PSEPK       AYIGLTQYSAKIP---APAAFAPSSLNNVLGEYLAKNGKTQLRIAETEKYAHVTFFFSGG
GPMI_PSEPG       AYIGLTQYSAKIP---APAAFAPSSLNNVLGEYLAKNGKTQLRIAETEKYAHVTFFFSGG
GPMI_PSEE4       AYIGLTQYSAKIP---APAAFAPSSLDNVLGEYLAKNGKTQLRIAETEKYAHVTFFFSGG
GPMI_PSEAB       GFVMLTQYAASIP---APCAFPPEPLTNVLGEYLAKHGKTQLRIAETEKYAHVTFFFSGG
GPMI_PSEAE       GFVMLTQYAASIP---APCAFPPEPLTNVLGEYLAKHGKTQLRIAETEKYAHVTFFFSGG
GPMI_PSEA7       GFVMLTQYAASIP---APCAFPPEPLTNVLGEYLAKHGKTQLRIAETEKYAHVTFFFSGG
GPMI_PSEMY       GFVMLTQYAASIP---APAAFAPEALTNVLGEYLAKNGKTQLRIAETEKYAHVTFFFSGG
GPMI_ACIAD       KFVMLTRYQATID---APVAYMPEALHNSIGEYLSNLGKTQLRIAETEKYAHVTFFFSGG
GPMI_SHEB5       HFVTLTEYAGDIK---APIAYPSENLVNTLGEVLQKQGRTQLRISETEKYAHVTFFFNGG
GPMI_SHEB8       HFVTLTEYAGDIK---APIAYPSENLVNTLGEVLQKQGRTQLRISETEKYAHVTFFFNGG
GPMI_SHEB9       HFVTLTEYAGDIK---APIAYPSENLVNTLGEVLQKQGRTQLRISETEKYAHVTFFFNGG
GPMI_SHEPC       HFVTLTEYAGDIT---APIAYPSENLVNTLGEVLQNRGRTQLRISETEKYAHVTFFFNGG
GPMI_SHESW       HFVTLTEYAGDIT---APIAYPSENLVNTLGEVLQNRGRTQLRISETEKYAHVTFFFNGG
GPMI_SHESR       NFVTLTEYAADIK---APIAYPSENLVNTLGEVLQNRGRTQLRISETEKYAHVTFFFNGG
GPMI_SHESA       NFVTLTEYAADIK---APIAYPSENLVNTLGEVLQNRGRTQLRISETEKYAHVTFFFNGG
GPMI_SHESM       NFVTLTEYAADIK---APIAYPSENLVNTLGEVLQNRGRTQLRISETEKYAHVTFFFNGG
GPMI_SHEON       NFVTLTEYAADIK---APIAYPSDNLVNTLGEVLQNRGRTQLRISETEKYAHVTFFFNGG
GPMI_SHEDO       NFVTLTEYAADIS---APKAFSSSDLVNTLGETLQNLGKTQLRISETEKYAHVTFFFNGG
GPMI_SHEHH       NFVMLTEYAADIK---AAIAYPSSDLVNTLGETLQNRDLTQLRISETEKYAHVTFFFNGG
GPMI_SHEPA       NFVMLTEYAANIK---AAIAYPSSDLVNTLGETLQDRDLTQLRISETEKYAHVTFFFNGG
GPMI_SHELP       NFVMLTEYAADIK---APVAYPSVDLVNTLGEVLQNNGKTQLRISETEKYAHVTFFFNGG
GPMI_SHESH       HFVMLTEYAADIK---AAIAYPSTNLVNTLGEALQDSDKTQLRISETEKYAHVTFFFNGG
GPMI_ECOK1       DFVMLTEYAADIK---TAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_ECOL5       DFVMLTEYAADIK---TAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_ECOL6       DFVMLTEYAADIK---TAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_SHIBS       DFVMLTEYAADIK---TAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_ECO57       DFVMLTEYAADIK---TAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_ECO24       DFVMLTEYAADIK---TAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_ECOHS       DFVMLTEYAADIK---TAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_ECOLC       DFVMLTEYAADIK---TAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_SHISS       DFVMLTEYAADIK---TAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_ECOLI       DFVMLTEYAADIK---TAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_SHIFL       DFVMLTEYAADIK---TAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_SHIDS       DFVMLTEYAADIK---TAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_SALPA       NFVMLTEYAADIK---TAVAYPPASLANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_SALTY       NFVMLTEYAADIK---TAVAYPPASLANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_SALTI       NFVMLTEYAADIK---TAVAYPPASLANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_SALPB       NFVMLTEYAADIK---TAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_SALCH       NFVMLTEYAADIK---TTVAYPPASLANTFGEWMAKNDKTQLRISETEKYAHVTFFFNGG
GPMI_ENT38       NFIMLTEYAADIK---VPCAYPPASLANTLGEWMAKHDKTQLRISETEKYAHVTFFFNGG
GPMI_CROS8       DFVMLTEYAADIR---TACAYPPASLLNTFGEWMAKHNKTQLRISETEKYAHVTFFFNGG
GPMI_YERPA       DFIMLTEYAADIK---VACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAHVTFFYNGG
GPMI_YERPP       DFIMLTEYAADIK---VACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAHVTFFYNGG
GPMI_YERPN       DFIMLTEYAADIK---VACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAHVTFFYNGG
GPMI_YERPE       DFIMLTEYAADIK---VACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAHVTFFYNGG
GPMI_YERPS       DFIMLTEYAADIK---VACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAHVTFFYNGG
GPMI_YERP3       DFIMLTEYAADIK---VACAYPPASLTNTFGEWLMKHDKTQLRISETEKYAHVTFFYNGG
GPMI_YERE8       DFIMLTEYAADIK---VACAYPPASLENTFGEWLMKHDKTQLRISETEKYAHVTFFYNGG
GPMI_SERP5       DFVMLTEYAADIK---APCAYPPASLSNTFGEWLMKHDKTQLRISETEKYAHVTFFFNGG
GPMI_VIBC3       DFVMLTQYAADIP---LQCAFGPASLENTYGEWLSKAGKTQLRISETEKYAHVTFFFNGG
GPMI_VIBCH       DFVMLTQYAADIP---LQCAFGPASLENTYGEWLSKAGKTQLRISETEKYAHVTFFFNGG
GPMI_VIBPA       NFVMLTQYAADIP---LATAFPPASLENTYGEWLSKQGQTQLRISETEKYAHVTFFFNGG
GPMI_VIBCB       NFVMLTQYAADIP---LAIAFPPASLENTYGEWLSKQGQTQLRISETEKYAHVTFFFNGG
GPMI_VIBVU       NFVMLTQYAADIP---LAIAFPPASLENTYGEWLSKQGQTQLRISETEKYAHVTFFFNGG
GPMI_VIBVY       NFVMLTQYAADIP---LAIAFPPASLENTYGEWLSKQGQTQLRISETEKYAHVTFFFNGG
GPMI_ALIF1       DFVMLTQYAADIP---LLCAFAPASLENTYGEWLSKEGKTQLRISETEKYAHVTFFFNGG
GPMI_PHOPR       EFVMLTRYAANIK---LPAAFPPATLKNTLGEWLSKKGKKQLRISETEKYAHVTFFFNGG
GPMI_AERS4       NFVMLTEYAADIK---TACAYPPTALVNTLGEWLAKQGKTQLRISETEKYAHVTFFFNGG
GPMI_PSYIN       HFVTLTEFADDIT---APAAFSSERLTNTLGEWLADHGKTQLRISETEKYAHVTFFFNGG
GPMI_PSEHT       AFVMMTEYAADID---APVAFGPTPLVNVLGEWFEKHGKTQLRISETEKYAHVTFFFSGG
GPMI_PSEA6       AFVMLTQYAESID---APAAYPPVALVNVMGEWLANHGKTQLRISETEKFAHVTFFYSGG
GPMI_COLP3       NFVMLTQYAADID---APSAFAPTPLTNVMGEWLAKHNKTQLRISETEKYAHVTFFFSGG
GPMI_IDILO       EFVMLTQYADTLE---APSAFPPEPLNNVLGEWLAKHDKTQLRISETEKYAHVTFFFSGG
GPMI_HAHCH       DFVMLTEYSANIH---TACAYPATELTNSIGEYMATLHKTQLRIAETEKYAHVTFFFSGG
GPMI_SACD2       DFVMTTEYSADID---TSCAYPPEDLVNSFGEVMAKNGKKQLRIAETEKYAHVTFFFSGG
GPMI_CHRSD       GLVMLTEYAADIP---APVAFPPTDLVNTLGETVAKRGLKQLRIAETEKYAHVTFFFSGG
GPMI_METFK       GFYTLTLYDKAETR--AKPIFAPVEIRNTFGEYVAQHGLKQLRIAETEKYPHVTFFFNGG
GPMI_CHRVO       YYATLTSYGEAYSA--LPVAYAPQKIHNGMGEYLSSKGLKQLRIAETEKYPHVTYFFNGG
GPMI_THIDA       TYCTLTGYSDDFD---VSVAFPPERIKNGLGEYVANLGLRQLRIAETEKYPHVTFFFNGG
GPMI_COXBU       AFVTLTAYAKDIH---AAVAFPPLELHNTLGEYLSARGYRQLRIAETEKYAHVTYFLNGG
GPMI_COXBR       AFVTLTAYAKDIH---AAVAFPPLELHNTLGEYLSARGYRQLRIAETEKYAHVTYFLNGG
GPMI_COXBN       AFVTLTAYAKDIH---AAVAFPPLELHNTLGEYLSARGYRQLRIAETEKYAHVTYFLNGG
GPMI_VESOH       QFVCLTEYKKDFN---LPVAYPSSKLNNVLGKYLSNLGMTQLRIAETEKYAHVTFFLNGG
GPMI_RUTMC       QFICLTEYKKDFN---LPVAYPSSKLNNVLGKYLSNLGMTQLRIAETEKYAHVTFFLNGG
GPMI_NITOC       QFVSLTEYSKEFD---IPVAFPSEKPQNTFGQVLAKLGLHQLRIAETEKYAHVTFFFNGG
GPMI_HYDCU       AFVTLTEYKKNFEKFGALVAYRPTSLRNTFGEYVSKKGLKQLRIAETEKYAHVTFFFNGG
GPMI_FRATF       -FTTLTEYDSKLK---CAVAFPPEQPINTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGG
GPMI_FRATH       -FTTLTEYDSKLK---CAVAFPPEQPINTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGG
GPMI_FRATW       -FTTLTEYDSKLK---CAVAFPPKQPINTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGG
GPMI_FRAT1       -FTTLTEYDSKLK---CAVAFPPEQPINTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGG
GPMI_FRATT       -FTTLTEYDSKLK---CAVAFPPEQPINTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGG
GPMI_FRATN       -FTTLTEYDSKLK---CAVAFPPEQPINTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGG
GPMI_FRAP2       -FTTLTEYDSKLK---CNVAFPPEQPVNTLGEVLMKNHKTQLRIAETEKYPHVTFFFNGG
GPMI_LEGPH       -FVSMTQYDKNLL---TTTAFPPVPLNNTLGEVLSSHGLSQLRIAETEKYAHVTFFFNGG
GPMI_LEGPL       -FVSMTQYDKNLF---TTTAFPPVPLNNTLGEVLSSHGLSQLRIAETEKYAHVTFFFNGG
GPMI_LEGPA       -FVSMTQYDKNLF---TTTAFPPVPLNNTLGEVLSSHGLSQLRIAETEKYAHVTFFFNGG
GPMI_LEGPC       -FVSMTQYDKNLI---TTIAFPPVPLNNTLGEVLSSHGLSQLRIAETEKYAHVTFFFNGG
GPMI_GEOSL       SYVCLTEYDATF-P-LPVAYPPE-SLANILGQVVSRAGLRQLRIAETEKYAHVTFFFNGG
GPMI_PELCD       GYVCLTEYDASF-G-LPMAFPPE-TYPELLGEVVSRAGRKQLRIAETEKYAHVTFFFNGG
GPMI_SYMTH       ELVTMTQYDQTFTD-IPVAFGPQ-FVDVPMGQVVAEAGLRQLRIAETEKYAHVTYFFNGG
GPMI_RHOS1       AFLGMVDYSKEHDR-FMTAAYPKPVIRNTLGEWVASHGLRQFRIAETEKYPHVTFFLNGG
GPMI_RHOS4       AFLGMVDYSKEHDR-FMTTAYPKPVIRNTLGEWVASHGLRQFRIAETEKYPHVTFFLNGG
GPMI_RHOS5       GFLGMVDYSTEHDR-FMTTAYPKQVIRNTLGEWVASHGLRQFRIAETEKYPHVTFFLNGG
GPMI_DINSH       AKLGMVSYSDEHDG-WFDIVFPKREIVNTLGAWVAKQGLRQFRLAETEKYPHVTFFLNGG
GPMI_PARDP       ALLGMVDYSTSHDE-YMQAAYPKRQVVNTLGAWVAARGLRQFRLAETEKYPHVTFFLNGG
GPMI_ROSDO       SLMGMAQYSEAHAN-YMTTMYPKPEIVNTLGDWVAQQGLRQYRLAETEKYPHVTFFLNGG
GPMI_RUEPO       ALLGMVEYSDAHNA-YMTTVFPKRDIVNTLGAWVARHGLRQFRLAETEKYPHVTFFLNGG
GPMI_RUEST       ALLGMVEYSEGHNA-YMTTAYPKRAIVNTLGEWVAKQGKRQFRLAETEKYPHVTFFLNGG
GPMI_AGRFC       ALLGMVEYSTRHSD-FMTTAYPKRDIVNTLGAWVAKQGLTQFRLAETEKYPHVTFFLNGG
GPMI_RHOPA       AAAGMTQYSTALDA-LMGTIFPPQSLVNGLGQVVADAGLHQLRMAETEKYPHVTYFLNGG
GPMI_GLUOX       AVCGMSRYSDHLAP-YMSILFPKVPLDDLLGDVVAKAGRTQLRMAETEKYPHVTYFLNGG
GPMI_MAGMM       AYVCLTQYDVSLQN--VQIAYPPVALTNILGQVMAQHGLTQLRAAETEKYAHVTYFFNGG
GPMI_LAWIP       GIATMTMYDKEF-N-IPVLFNH-ENITKTLGEVVSALGLLQLRIAETEKYAHVTYFFSGG
GPMI_DESVH       GFATMTSYDPAL-G-LPVAFDK-QPLDGTLGEVVANQGLRQLRIAETEKYAHVTYFLNCG
GPMI_RHOBA       YFATMTGYETGL-P-VKVIFEKPAKMPNILGEYVASKGLHQFRCAETEKYPHVTFFFNDY
GPMI_SYNY3       DFVTFTQYDPAL---PVVVAFEPQNLNNILGEIISRQGMKQFRTAETEKYPHVTYFFNGG
GPMI_MICAN       SFVTFTQYDPKL---PVDVAFAPQNLNNILGQVIAQQGLKQFRCAETEKYPHVTYFFNGG
GPMI_NOSS1       SFVTFTQYDSDL---SVSVAFEPQNLTNILGEVIANQGLNQFRTAETEKYAHVTYFFNGG
GPMI_TRIV2       SFVTFTQYDSDL---SVSVAFEPQNLTNILGEVIANQGLNQFRTAETEKYAHVTYFFNGG
GPMI_TRIEI       TFLTFTQYDSSF---PVLVAFEPQNFNNILGQVISQHGLRQFRTAETEKYAHVTYFFNGG
GPMI_SYNE7       TFVTFTQYDANL---NVPVAFEPQNLTNILGEVVANHGLRQFRTAETEKYPHVTYFFNGG
GPMI_SYNP6       TFVTFTQYDANL---NVPVAFEPQNLTNILGEVVANHGLRQFRTAETEKYPHVTYFFNGG
GPMI_ACAM1       HFVTFTQYDSDL---PTDVAFKPQNLDNILGEIVANHGLKQLRLAETEKYAHVTYFFNGG
GPMI_SYNJA       TFITMTQYDPTL---PVQVLFKPQNLDHLLGQVVSEAGLKQLRIAETEKYAHVTYFFNGG
GPMI_SYNJB       TFITMTQYEADL---PVQVLFKPQNLNHLLGQVVSEAGLKQLRIAETEKYAHVTYFFNGG
GPMI_THEEB       DFVTFTQYDASF---NCGVAFPPQNLSHILGEVIAEHGLKQLRAAETEKYAHVTYFFNGG
GPMI_GLOVI       AFLTFTQYDATL---PVAVAFAPQSLDNLLGQVIAHHGLRQFRIAETEKYAHVTYFFNGG
GPMI_PROM1       DVLTFTQYESGL---PVSVAFPPEPLNDLLGQVISDHGLNQYRTAETEKYPHVTYFLNGG
GPMI_PROMT       DVLTFTQYESGL---PVSVAFPPEPLNDLLGQVIADHGLNQYRTAETEKYPHVTYFLNGG
GPMI_PROM3       DVVTFTQYEHDL---PVAVAFPAESLDDLLGQVVSEHGLRQYRTAETEKYPHVTYFMNGG
GPMI_PROMM       DVVTFTQYEHDL---PVGVAFPAESLDDLLGQVVSEHGLRQYRTAETEKYPHVTYFMNGG
GPMI_SYNPX       DVVTFTQVEQDL---PVSVAFPPEPLDDLLGQVVAEAGLRQYRTAETEKYPHVTYFMNGG
GPMI_PROMA       NVVTLTQYEMDL---PVSVVFPPESLDNLLGQVISEHGLLQYRTAETEKYPHVTYFFNGG
GPMI_PROMP       DILTFTQYEANL---PVKIAFPPESLNNFIGQIVSENGLKQYRTAETEKYPHVTYFFNGG
GPMI_GRATL       EILTLTQYDPSL---DIEVAFPAKKNKNFIGEIIAKYGLKQLRLAETEKYAHVTYFFNGG
GPMI_ANTSP       MLTTFTEYDSTL---SIPTVFPNEPKKNFLGQIISNSGLKQLRLAETEKYAHVTYFFNGG
GPMI_PORPU       HVLTFTNYDSSL---NTALAFPPNTLNNFLGETISKYGLKQFRVAETEKYAHVTYFFNGG
GPMI_PYRYE       RVVTFTNYDTSL---NTTIAFHPHILNNFLGEVLYKYGLKQFRVSETEKYAHVTYFFNGG
GPMI_NATPD       ALVTMTEYDETF---DLPVAYPPLAPEQPLGAVLAESDRTQLRMAESEKYAHVTYFLNGG
GPMI_HALMA       RLVTMTQYDETF---DLPVAFPPNQPADVLGEVLSEAGKTQIRLAETEKYPHVTYFLNGG
GPMI_HALSA       PVVTMTEYDETF---DCPVAFPAAEPTDTLGAVLAAHDHTQLRVAESEKYAHVTYFLNGG
GPMI_HALWD       ELATMAQYDETF---SLPVAFPPNEQHDTLGEVIATAGLTQLRIAESEKYAHVTYFLNGG
GPMI_STRCO       NMVSLAQYDTRT---AIPALVKRADASGGLADELQEAGLRSVRIAETEKFEHVTYYINGR
GPMI_FLAJ1       YYVTLTNYDETYQN--VKVVYNKDNITETLGEVLEKAGKKQIRIAETEKYPHVTFFFSGG
GPMI_FLAPJ       YYVTLTNYDETYKN--VKVIYNKDNITQTLGEVLEKAGKKQIRIAETEKYPHVTFFFSGG
GPMI_BACFR       QYYCMTPYDASFKG--VHILFDKENVANTLGEYLAANGKKQLHIAETEKYAHVTFFFNGG
GPMI_BACFN       QYYCMTPYDASFKG--VHILFDKENVVNTLGEYLAANGKKQLHIAETEKYAHVTFFFNGG
GPMI_BACTN       QYYCMTPYDASFKG--VHILFDKENVANTLGEYIASKGLNQLHIAETEKYAHVTFFFNGG
GPMI_BACV8       QFYCMTPYDASFKG--VHILFDKENVQNTLGEYLAANGKTQLHIAETEKYAHVTFFFNGG
GPMI_PARD8       QYFCMTPYDASFKG--VHILFDKENVNNTLGEFLANVGKTQLHIAETEKYAHVTFFFNGG
GPMI_HELPY       HIATMTPYDNTFPY---PVLFPKESVQNTLAEVVSQHNLTQSHIAETEKYAHVTFFINGG
GPMI_HELPH       HIATMTPYDNTFPY---PVLFPKESVQNTLAEVVSQHNLTQSHIAETEKYAHVTFFINGG
GPMI_HELPJ       HIATMTPYDNSFPY---PVLFPKESVQNTLAEVVSQHNLTQSHIAETEKYAHVTFFINGG
GPMI_HELAH       HIATMTPYDKNFPY---PILFPKESIQNTLAEVVSECNLTQSHIAETEKYAHVTFFINGG
GPMI_HELHP       HIATMTEYDATFPY---PILFPKQNVQNTLAEVISSHRLKQFHTAETEKYAHVTFFLNGG
GPMI_WOLSU       KTLAMTSYDDSFPF---PILFPKEKVEPTLAQVISEAGLSQLHVAETEKYAHVTFFFNGG
GPMI_ARCB4       NFASMTQYDKNVFI---PVLFPKDNPKNTLAEVISNAGLSQLHTAETEKYAHVTFFFNGG
GPMI_SULDN       HVATITEYDKNFSY---PVLFKKDSPKNTLSEVISSAGLRQLHTAETEKYAHVTFFFNGG
GPMI_CAMJ8       NLLTMSVYDDKFKL---PVLFEKEKIENTLAQVISKAGLSQLHTAETEKYAHVTFFFNGG
GPMI_CAMJR       NLLTMSVYDDKFKL---PVLFEKEKIENTLAQVISKAGLSQLHTAETEKYAHVTFFFNGG
GPMI_CAMJJ       NLLTMSVYDDKFKL---PVLFEKEKIENTLAQVISKAGLSQLHTAETEKYAHVTFFFNGG
GPMI_CAMJE       NLLTMSVYDDKFKL---PVLFEKEKIENTLAQVISKAGLSQLHTAETEKYAHVTFFFNGG
GPMI_CAMJD       NLLTMSVYDDKFKL---PVLFEKEKIENTLAQVISKAGLSQLHTAETEKYAHVTFFFNGG
GPMI_EHRRW       NTIGMIKYSNELNI---PCLFPNKKISNTLGEIISNQQLHQLRIAETEKYAHVTFFFNGG
GPMI_EHRRG       NTIGMIKYSNELNI---PCLFPNKKISNTLGEIISNQQLHQLRIAETEKYAHVTFFFNGG
GPMI_EHRCJ       NTIGMVKYSDKINI---PCLFPNNNITNTLGEVIANNQLHQLRIAETEKYAHVTFFFNGG
GPMI_EHRCR       NTIGMVKYSESINI---PCLFPNNNITNTLGEVIANHKLHQLRIAETEKYAHVTFFFNGG
GPMI_ANAPZ       NVLGMRQYSEKMRI---ASLFPPREIHRSLGEVISERGLKQLRIAETEKFAHVTFFFNGG
GPMI_ANAMM       NILGMVRYSEKIQV---PSLFPPRNICNTLGEVVSKCGLKQLRIAETEKYAHVTFFFSGG
GPMI_WOLPM       SILSMMKYKEDLKI---PYIFPPTSFADTLGQTIEDNKLRQLRIAETEKYAHVTFFFNCG
GPMI_WOLTR       SILSMMKYKEDLQI---PCLFPPAFFTNTLGEIIADNKLRQLRIAETEKYAHVTFFFNCG
GPMI_ONYPE       FLVTMTKYSAQVKS---VVAFEKITLKNIYGEVIANLGMHQLRIAETEKYPHVTFFFDGG
GPMI_AYWBP       FLVTMTQYNVQVKS---VVAFEKKTLKNIYGEVIANLGMHQLRISETEKYPHVTFFFDGG
GPMI_ACHLI       FLVSMMHYKETVKG---PLAFELQTFDDLYGEVIEKNGFKQIRAAETEKYPHVTFFFDGG
GPMI_MYCGE       FFVTMMNYEGIVP---SEFAFPPQTIKNSLGEVIANNNLKQLRIAETEKYAHVTFFFDGG
GPMI_MYCPN       FFVTMMNYEGIKP---SAVVFPPETIPNTFGEVIAHNKLKQLRIAETEKYAHVTFFFDGG
GPMI_MYCGA       YFVIMMQYEGINP---SAICYPPKIEKNTLGEVLKNANKKQLRIAETEKYAHVTFFFDGG
GPMI_MYCPE       YYAIMMTYEGITP---TSILFPTVVVKNTFGEVVANSGLTQLRIAETEKYAHVTFFFDGG
GPMI_MYCPU       KFCSMMKYEGIE----TLIAFEEMEIKNPIGKVAEKAGLKQLRLAETQKYAHVTYFMDGG
GPMI_MYCS5       DFVSMMKYEGIK----CNIAYEEMLVNNPIGKVFEDANKTQLRVAETQKYAHVTYFMDGG
GPMI_MYCMO       NFTSMMKYEGLD----TNIAYEEMKITNPLGNILAKNGLSQLRIAETQKYAHVTFFFDGG
GPMI_MYCHP       NFVSLMKYEGIN----SKIAFKEMEVVNPLGKVLESNDIKQLRLAETQKYAHVTFFFDGG
GPMI_MYCH7       VFVSMMKYEGIN----CLVAFEEMRVENPLGKLISMAGFRQLRLAETQKYAHVTFFVDGG
GPMI_MYCHJ       VFVSMMKYEGIN----CLVAFEEMRVENPLGKLISMAGFRQLRLAETQKYAHVTFFVDGG
GPMI_MYCH2       VFVSMMKYEGIN----CLVAFEEMRVENPLGKLICMAGFRQLRLAETQKYAHVTFFVDGG
GPMI_UREP2       LITLVPFPDVDAI---ALFEK--QNLNNTLGDVFNKHQIKEARIAETEKYAHISFFFDGG
GPMI_UREPA       LITLVPFPDVDAI---ALFEK--QNLNNTLGDVFNKHQIKEARIAETEKYAHISFFFDGG
GPMI_MYCCT       FVSMMKYSDSVTS---PHIAYPPKPLTNTLGQYLSKLGLKQLRIAETEKIAHVTFFFDGG
                                               .         . : :*::*  *:::: .  

GPMI_CLOAB       VEEPNKNEDRA-----------LISSPK-VATYDLKPEMSAYEVTDELLKRLDEDKYDMV
GPMI_CLONN       VEEPNQNEDRA-----------LIPSPK-VATYDLKPEMSAYEVTDEVLKRIDSDEYDMI
GPMI_CLOB1       VEEPNEGEDRV-----------LIPSPK-VATYDMQPEMNAYEVTDKLLERLDEDKYDMV
GPMI_CLOBL       VEEPNEGEDRV-----------LIPSPK-VATYDMQPEMNAYEVTDKLLERLDEDKYDMV
GPMI_CLOK5       VEAPNRNEDRE-----------LIPSPK-VATYDLKPEMSAREVTSTVLDRLDQDKYDMI
GPMI_CLOPE       VEQPNTNEDRA-----------LIASPK-VATYDLKPEMSAYEVTDELINRLDQDKYDMI
GPMI_CLOP1       VEQPNTNEDRA-----------LIASPK-VATYDLKPEMSAYEVTDELINRLDQDKYDMI
GPMI_CLOPS       VEQPNTNEDRA-----------LIASPK-VATYDLKPEMSAYEVTDELIKRLDEDKYDMI
GPMI_CLOB8       VEKENPGEDRK-----------VIPSPK-VATYDLKPEMSAYEVTDELLNRLDSDKYDMV
GPMI_CLOTE       VETPNKGEDRA-----------LIPSPK-VATYDLKPEMSAFEVKDEVINRIESNKYDMI
GPMI_CLOD6       VEEPNKGEERL-----------LIPSPK-VATYDLKPEMSAYELTDKALDKLGEDKFDFI
GPMI_HUNT2       VEAVYEGEDRI-----------LINSPK-VATYDLKPEMSAYEVTDKVLECINKKEYDVI
GPMI_LACP7       VEAPNEGEDRI-----------LVNSPK-VATYDLQPEMSANAVADKLVEAITSLKYDVI
GPMI_BACSU       REAEFPGEERI-----------LINSPK-VATYDLKPEMSAYEVKDALVKEIEADKHDAI
GPMI_BACVZ       REEEFPGEERI-----------LINSPK-VATYDLKPEMSAYEVKDALVKEIAADKHDAI
GPMI_BACP2       REEEFPGEDRI-----------LINSPD-VATYDLKPEMSAYEVKDALVADINADKHDAI
GPMI_BACLD       REEKFPGEERI-----------LIDSPK-VATYDLKPEMSAYEVKDALVKEIEAEKHNAI
GPMI_GEOSE       REEKFPGEDRI-----------LINSPK-VPTYDLKPEMSAYEVTDALLKEIEADKYDAI
GPMI_GEOKA       REEKFPGEDRI-----------LINSPK-VPTYDLKPEMSAYEVTDALLKEIEADKYDAI
GPMI_GEOTN       REEKFPGEDRI-----------LINSPK-VATYDLKPEMSAYEVTEALLKEIAADKYDAI
GPMI_BACMQ       REAEFPGETRI-----------LIDSPK-VATYDLKPEMSAYEVTDALLAEIEGDKQDAI
GPMI_BACAH       REAEFPGEERI-----------LINSPK-VATYDLKPEMSIYEVTDALVNEIENDKHDVI
GPMI_BACC1       REAEFPGEERI-----------LINSPK-VATYDLKPEMSIYEVTDALVNEIENDKHDVI
GPMI_BACCR       REAEFPGEERI-----------LINSPK-VATYDLKPEMSIYEVTDALVNEIENDKHDVI
GPMI_BACHK       REAEFPGEERI-----------LINSPK-VATYDLKPEMSIYEVTDALVNEIENDKHDVI
GPMI_BACCZ       REAEFPGEERI-----------LINSPK-VATYDLKPEMSIYEVTDALVNEIENDKHDVI
GPMI_BACAN       REAEFPGEERI-----------LINSPK-VATYDLKPEMSIYEVTDALVNEIENDKHDVI
GPMI_BACCN       REAEFPGEERI-----------LINSPK-VATYDLKPEMSIYEVTDALVNEIENDKHDVI
GPMI_BACHD       REEPFPGEERI-----------LIDSPK-VATYDLKPEMSAYEVTDALLNEIEADKHDVI
GPMI_BACSK       REDEFPGEERI-----------LINSPK-VATYDLKPEMSAYEVTDALVKEIEGEKHDVI
GPMI_OCEIH       REKEFPGEKRI-----------LIDSPK-VATYDLKPEMSVYEVTDALLKELDKGEQNAI
GPMI_STAAS       RNEEFKGERRR-----------LIDSPK-VATYDLKPEMSAYEVKDALLEELNKGDLDLI
GPMI_STAAW       RNEEFKGERRR-----------LIDSPK-VATYDLKPEMSAYEVKDALLEELNKGDLDLI
GPMI_STAAC       RNEEFKGERRR-----------LIDSPK-VATYDLKPEMSAYEVKDALLEELNKGDLDLI
GPMI_STAAM       RNEEFKGERRR-----------LIDSPK-VATYDLKPEMSAYEVKDALLEELNKGDLDLI
GPMI_STAAN       RNEEFKGERRR-----------LIDSPK-VATYDLKPEMSAYEVKDALLEELNKGDLDLI
GPMI_STAAR       RNEEFKGERRR-----------LIDSPK-VATYDLKPEMSAYEVKDALLEELNKGDLDLI
GPMI_STAEQ       RNEEFEGERRR-----------LIDSPK-VATYDLKPEMSAYEVKDALLEELDKGDLDLI
GPMI_STAES       RNEEFEGERRR-----------LIDSPK-VATYDLKPEMSAYEVKDALLEELDKGDLDLI
GPMI_STAHJ       RNEEFEGERRR-----------LIDSPK-VATYDLKPEMSAYEVKDALLEELDKGDLDLI
GPMI_STAS1       RNEEFEGERRR-----------LIDSPK-VATYDLKPEMSAYEVKDALIEELNKGDLDLI
GPMI_LISMF       RNEEFPGENRI-----------LINSPK-VETYDLQPEMSAYEVTDALVEDIKNDKHDAI
GPMI_LISMO       RNEEFPGENRI-----------LINSPK-VETYDLQPEMSAYEVTDALVEDIKNDKHDAI
GPMI_LISIN       RNEEFPGENRI-----------LINSPK-VETYDLKPEMSAYEVTDALVEDIKNDKHDAI
GPMI_LISW6       RNEEFPGENRI-----------LINSPK-VETYDLQPEMSAYEVTDALVEDIKNDKHDAI
GPMI2_METAC      QEKCYDGEDRC-----------LIPSPK-VATYDLKPEMSAYEVTDEVIRRIQSGKYDVI
GPMI_METMA       QEKCYSGEDRC-----------LIPSPK-ISTYDLKPEMSAYEVTDEVVKRILSGKYDVI
GPMI1_METBF      QEKCYEGEDRC-----------LIPSPK-IATYDLKPEMSAYEVTEEVIGRIRSGKYDVI
GPMI1_METAC      EEKRYEGEDRC-----------LIPSPK-IATYDLKPEMSAYKITDEVVRRIQSGKYDVI
GPMI2_METBF      EEKRYKDEDRC-----------LIPSPK-IATYDLKPEMSAYEITDEVIRRIQSGKYDVI
GPMI_METBU       VEKQNEGEERC-----------LIPSPK-VATYDLKPEMSAYEVTEELIERIGSGKYDVI
GPMI_PSEF5       REEPFPGEERI-----------LIPSPK-VATYDLQPEMSAPEVTDKIVDAIEHQRYDVI
GPMI_PSEPF       REEPFPGEERI-----------LIPSPK-VATYDLQPEMSAPEVTDRIVEAIENQRYDVI
GPMI_PSEU2       REEPFPGEERI-----------LIPSPK-VATYDLQPEMSAPEVTDKIVDAIEHQRYDVI
GPMI_PSE14       REEPFPGEERI-----------LIPSPK-VATYDLQPEMSAPEVTDKIVDAIEHQRYDVI
GPMI_PSESM       REEPFPGEERI-----------LIPSPK-VATYDLQPEMSAPEVTDKIVDAIEHQRYDVI
GPMI_PSEP1       REEPFEGEERI-----------LIPSPK-VATYDLQPEMSAPEVTDRIVEAIEQQRFDVI
GPMI_PSEPK       REEPFEGEERI-----------LIPSPK-VATYDLQPEMSAPEVTDRIVEAIEQQRFDVI
GPMI_PSEPG       REEPFEGEERI-----------LIPSPK-VATYDLQPEMNAPQVTDRIVEAIEQQRFDVI
GPMI_PSEE4       REEPFEGEERI-----------LIPSPK-VATYDLQPEMNAPEVTDRIVEAIEQQRFDVI
GPMI_PSEAB       REEPYEGEERI-----------LIPSPK-VATYDLQPEMSAPEVTDRIVEAIEQQRYDVI
GPMI_PSEAE       REEPYEGEERI-----------LIPSPK-VATYDLQPEMSAPEVTDRIVEAIEQQRYDVI
GPMI_PSEA7       REEPYEGEERI-----------LIPSPK-VATYDLQPEMSAPEVTDRIVEAIEQQRYDVI
GPMI_PSEMY       REEPFEGEERI-----------LIPSPD-VATYDLKPEMSAPEVTDRIVDAIENQRYDVI
GPMI_ACIAD       REDEYPGEKRI-----------LIPSPN-VATYDLKPEMSAYEVTDQLVNAIDSGEFDLL
GPMI_SHEB5       KEEPFEGEDRI-----------LINSPK-VATYDLQPEMSSAELTDKLVAAIESTKYDVI
GPMI_SHEB8       KEEPFEGEDRI-----------LINSPK-VATYDLQPEMSSAELTDKLVAAIESTKYDVI
GPMI_SHEB9       KEEPFEGEDRI-----------LINSPK-VATYDLQPEMSSAELTDKLVAAIESTKYDVI
GPMI_SHEPC       KEEPFEGEDRI-----------LINSPK-VATYDLQPEMSSTELTDKLVAAIESTKYDVI
GPMI_SHESW       KEEPFEGEDRI-----------LINSPK-VATYDLQPEMSSTELTDKLVAAIESTKYDVI
GPMI_SHESR       KEEPFNGEDRI-----------LINSPK-VATYDLQPEMSSTELTDKLVAAIESAQYDVI
GPMI_SHESA       KEEPFNGEDRI-----------LINSPK-VATYDLQPEMSSTELTDKLVAAIESAQYDVI
GPMI_SHESM       KEEPFNGEDRI-----------LINSPK-VATYDLQPEMSSTELTDKLVAAIESAQYDVI
GPMI_SHEON       KEEPFNGEDRI-----------LINSPK-VATYDLQPEMSSTELTDKLVAAIESTKYDVI
GPMI_SHEDO       KEDPFKGEDRI-----------MIPSPK-VATYDLQPEMNSTELTDKLVEAIESAKYDVV
GPMI_SHEHH       KEEPFKGEDRI-----------LVQSPK-VATYDLQPEMSSVELTDKLVEAIESTQYDVI
GPMI_SHEPA       KEEPFKGEDRI-----------LIQSPK-VATYDLQPEMSSTELTDKLVAAIESTEYDVI
GPMI_SHELP       KEEPFEGEDRI-----------LIQSPK-VATYDLQPEMSSTELTDKLVEAIESTQYDVI
GPMI_SHESH       KEEPFKGEDRI-----------LIQSPK-VATYDLQPEMSSAELTDKLVEAIESTKYDVI
GPMI_ECOK1       VEESFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIKSGKYDTI
GPMI_ECOL5       VEESFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIKSGKYDTI
GPMI_ECOL6       VEESFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIKSGKYDTI
GPMI_SHIBS       VEESFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIKSGKYDTI
GPMI_ECO57       VEESFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIKSGKYDTI
GPMI_ECO24       VEESFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIKSGKYDTI
GPMI_ECOHS       VEESFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIKSGKYDTI
GPMI_ECOLC       VEESFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIKSGKYDTI
GPMI_SHISS       VEESFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIKSGKYDTI
GPMI_ECOLI       VEESFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIKSGKYDTI
GPMI_SHIFL       VEESFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIKSGKYDTI
GPMI_SHIDS       VEESFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIKSGKYDTI
GPMI_SALPA       VEEPFAGEERI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIESGKYDTI
GPMI_SALTY       VEEPFAGEERI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIESGKYDTI
GPMI_SALTI       VEEPFAGEERI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIESGKYDTI
GPMI_SALPB       VEEPFAGEERI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIESGKYDTI
GPMI_SALCH       VEEPFAGEERI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAIESGKYDTI
GPMI_ENT38       VEEPFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVAAITSGKYDTI
GPMI_CROS8       VEEPFPGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVGAINSGKYDAI
GPMI_YERPA       VEEPFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVSAIGSGKYDVI
GPMI_YERPP       VEEPFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVSAIGSGKYDVI
GPMI_YERPN       VEEPFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVSAIGSGKYDVI
GPMI_YERPE       VEEPFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVSAIGSGKYDVI
GPMI_YERPS       VEEPFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVSAIGSGKYDVI
GPMI_YERP3       VEEPFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVSAIGSGKYDVI
GPMI_YERE8       VEEPFKGEDRI-----------LINSPK-VATYDLQPEMSSAELTEKLVGAIASGKYDVI
GPMI_SERP5       VEEPFTGEDRV-----------LINSPK-VATYDLQPEMSAAELTDKLLAAIASGKYDAI
GPMI_VIBC3       VENEFPGEERQ-----------LVASPK-VATYDLQPEMSSKELTDKLVAAIKSGKYDAI
GPMI_VIBCH       VENEFPGEERQ-----------LVASPK-VATYDLQPEMSSKELTDKLVAAIKSGKYDAI
GPMI_VIBPA       VENEFEGEERQ-----------LVASPK-VATYDLQPEMSSPELTEKLVAAIKSGKYDTI
GPMI_VIBCB       IENEFEGEERQ-----------LVASPK-VATYDMQPEMSSPELTEKMVAAIKSGKYDTI
GPMI_VIBVU       VETEFAGEERQ-----------LVASPK-VATYDLQPEMSSTELTEKMVAAIKSGKYDTI
GPMI_VIBVY       VETEFAGEERQ-----------LVASPK-VATYDLQPEMSSTELTEKMVAAIKSGKYDTI
GPMI_ALIF1       IEDEFEGEERQ-----------LVASPK-VATYDLQPEMSAPELTEKLVAAIKSGKYDAI
GPMI_PHOPR       VEDEFDGETRS-----------LVASPK-VATYDLQPEMSAPELTEKLVAAIKGGEFDTI
GPMI_AERS4       EESCFTGEDRE-----------IVASPK-VATYDLQPEMSSEELTDKLVAAIKSGKYDTI
GPMI_PSYIN       VESEFKGEDRT-----------LIKSPS-VATYDMQPEMSSIELTEKLVSAIKSTKYDVI
GPMI_PSEHT       REDEFNGETRE-----------LIPSPQ-VATYDLQPEMNSEMLTDKLVAAIKSGKYDAI
GPMI_PSEA6       KEDLYEGEERI-----------LIPSPK-VATYDLQPEMNSTELTDKLVEAIESGKFDAI
GPMI_COLP3       KEDMFTGEERI-----------LVPSPD-VATYDLQPEMNSTLLTDKLVGAIESGKYDFI
GPMI_IDILO       REQEFEGEKRV-----------LIPSPK-VKTYDLQPEMSSEQLTDELVAAIESQAFDVV
GPMI_HAHCH       KEALFEGEERI-----------LIPSPD-VATYDLKPEMSAPEVTDKLVEAIKSGKFDLI
GPMI_SACD2       QESLYEGEDRI-----------LVPSPQ-VETYDEQPEMSAPEVTAKLVDAIENGGYDAI
GPMI_CHRSD       REDEFEGEHRE-----------LIPSPQDVKTYDEKPEMSAYELTDKLVAAIDAGTYDLI
GPMI_METFK       EEQVFAGEDRI-----------LVPSPK-VATYDLQPEMSAYEVTDRLEAAILSRKYDAI
GPMI_CHRVO       EEQVYPGEDRI-----------LVPSPK-VATYDLQPEMSAGEVTDKIVAAIQSGQYQAI
GPMI_THIDA       EEVSFPGEDRI-----------LVSSPD-VATYDLKPEMSAFEVTEKLLAAIGSKQYDLI
GPMI_COXBU       QEAPFNGEDRL-----------LIPSPK-VATYDLQPEMSAVEMTNKLVEIIQNDDYDLI
GPMI_COXBR       QEAPFNGEDRL-----------LIPSPK-VATYDLQPEMSAVEMTNKLVEIIQNDDYDLI
GPMI_COXBN       QEAPFNGEDRL-----------LIPSPK-VATYDLQPEMSAVEMTNKLVEIIQNDDYDLI
GPMI_VESOH       IEQAFNGEERV-----------LIPSPD-VATYDLQPEMSAFELTDALVENIESQKYDLI
GPMI_RUTMC       VEQAFNGEDRI-----------LIPSPD-VATYDLQPEMSAFELTDALIESIESQKYDLI
GPMI_NITOC       REQPFEGEDRI-----------LIPSPQ-VDTYDQKPEMSAVEVTDNIVKAIESDKYDVI
GPMI_HYDCU       VEEPNDNEVRI-----------LINSPQ-VATYDLQPEMSLPELKEKLIDAIKSGEYDTF
GPMI_FRATF       REEQFEGEDRI-----------LIPSPK-VATYDLQPEMSAPEVTDKLVAAINSGKYDCI
GPMI_FRATH       REEQFEGEDRI-----------LIPSPK-VATYDLQPEMSAPEVTDKLVAAINSGKYDCI
GPMI_FRATW       REEQFEGEDRI-----------LIPSPK-VATYDLQPEMSAPEVTDKLVAAINSGKYDCI
GPMI_FRAT1       REEQFEGEDRI-----------LIPSPK-VATYDLQPEMSAPEVTDKLVAAINSGKYDCI
GPMI_FRATT       REEQFEGEDRI-----------LIPSPK-VATYDLQPEMSAPEVTDKLVAAINSGKYDCI
GPMI_FRATN       REEQFEGEDRI-----------LIPSPK-VATYDLQPEMSAPEVTDKLVAAINSGKYDCI
GPMI_FRAP2       KEDQFEGEDRI-----------LIPSPK-VATYDLQPEMSAPEVTDKLVDAINNGKYDCI
GPMI_LEGPH       CESVFTNEERI-----------MVPSPQ-VATYDLQPEMSAHELTKTLIAAINSQDYHVI
GPMI_LEGPL       CESVFTNEERI-----------MVPSPQ-VATYDLQPEMSAHELTKTLIAAINSQDYHVI
GPMI_LEGPA       CESVFTNEERI-----------MVPSPQ-VATYDLQPEMSAHELTKTLIAAINSRDYHVI
GPMI_LEGPC       CESVFTNEERI-----------MVPSPQ-VATYDLQPEMSAPELTKTLIAAINSRDYHVI
GPMI_GEOSL       VEEPFPGEERI-----------LIPSPKEVATYDQKPEMSAPLVTDALLKRIDEGVDDVV
GPMI_PELCD       SEEPFDGEDRV-----------LIPSPKEVATYDLKPEMSAPAVTDAMLERVASGRYDLI
GPMI_SYMTH       EERVFPGEERV-----------LVPSPK-VATYDLKPEMSAYEVAREAVKWIEEDRTDFI
GPMI_RHOS1       REAPETGEDRY-----------MANSPK-VATYDLQPEMSAPDVSDHLVEAIGAG-YDLI
GPMI_RHOS4       REAPETGEDRY-----------MANSPK-VATYDLQPEMSAPDVSDHLVEAIGAG-YDLI
GPMI_RHOS5       KEVPEAGEDRY-----------MANSPK-VATYDLKPEMSAPDVSDHLVQAIGEG-YDLI
GPMI_DINSH       QETPETGEDRF-----------MPDSPK-VATYDLQPEMSAEEVSDSFVAAIEAG-YDLI
GPMI_PARDP       KETPEEGEDRF-----------MPASPK-VATYDLAPEMAAPEVSAKLVEAIEAG-YDLI
GPMI_ROSDO       EEVSFDGEDRL-----------MPKSPD-VATYDLQPEMSSKEVTDAFVAAIEEG-YDLI
GPMI_RUEPO       KEEAEPGEDRF-----------MPKSPK-VATYDMQPEMSAPEVTDKFVEAIGAG-YDLI
GPMI_RUEST       KETPEVGEDRF-----------MPKSPK-VATYDLQPEMSAPEVTAKFVEAIRAG-YDLI
GPMI_AGRFC       KEEPEVGEDRF-----------MPKSPK-VATYDLQPEMSAAEVTEKFVEVIGKG-YDLI
GPMI_RHOPA       EEVPYPGEDRI-----------MVPSPK-VATYDLQPEMSAPELGDKAVAAIESGKYDLI
GPMI_GLUOX       REVQFDGEERI-----------LVPSPK-VATYDLQPEMSAPELTDKAVAAIESGKFDMI
GPMI_MAGMM       QEQPGEGEDRL-----------LVASPK-VATYDMQPAMSAAELTDRVIEKIQSTPYDLV
GPMI_LAWIP       REEVFTGEERI-----------LVQSPRDVATYDLKPEMSVMEVTDRLLTAWNSKKFSLI
GPMI_DESVH       REEPFPGEERR-----------LLPSPRDVATYDLKPEMSAEAVTDTLLEEWAGGGYTLA
GPMI_RHOBA       RDNPFEEEEWG-----------MAPSPRDVSTYDQKPEMSAEDITEKVLKQIKSGKCDMI
GPMI_SYNY3       LEQPFAGEDRE-----------LIQSPM-VSTYDKAPQMSAKAVTDAVCRAMEKGIYSLV
GPMI_MICAN       LEKPFEGEVRE-----------LIPSPK-VATYDQAPAMSAAAVTTSVCGAIEQGIYSLV
GPMI_NOSS1       LEEPFAGEDRE-----------LVSSPM-VATYDKAPAMSATAVTDTAIAAIQKGIYSLI
GPMI_TRIV2       LEEPFAGEDRE-----------LVSSPM-VATYDKAPAMSATAVTDTAIAAIQKGIYSLI
GPMI_TRIEI       LEQPFEGEDRE-----------LVQSPM-VSHYDEAPEMSAEDLTEVAIAAVKKQIYSLI
GPMI_SYNE7       IEEPFPGEDRE-----------LIPSPM-VATYDRAPKMSAQAVTDAAIAAIDKGIYSLV
GPMI_SYNP6       IEEPFPGEDRE-----------LIPSPM-VATYDRAPKMSAQAVTDAAIAAIDKGIYSLV
GPMI_ACAM1       IEDPLPGEDRI-----------LVPSPM-VSTYDQDPPMSAAKVTEEAIAALDKRIYSLM
GPMI_SYNJA       IEQPFPGEDRI-----------LVQSPL-VATYDQMPEMSAVEVTDKAIEAIARREYSLV
GPMI_SYNJB       IEQPFPGEDRI-----------LVQSPL-VTTYDQAPEMSAVEVTDKAIEAIARREYSLV
GPMI_THEEB       LEEPFPGEDRI-----------LIPSPM-VTTYDQAPAMSALAVTQAVKKAIEKQEYALV
GPMI_GLOVI       IETPLPGEERS-----------MIQSPL-VPTYDLKPEMAAREVTDHAVAAIETRQYSLI
GPMI_PROM1       IEKPLKGEVRH-----------LVPSPR-VATYDLQPEMSADELTDSCIKAIDSGIYSLV
GPMI_PROMT       IEKPLKGEVRH-----------LVPSPR-VATYDLQPEMSADELTESCIQAIDTGIYSLV
GPMI_PROM3       IEQPLAGEERH-----------LVPSPR-VATYDLAPAMSADTLTESCVKAIESGVYSLV
GPMI_PROMM       IEQPLAGEERH-----------LVPSPR-VATYDLAPAMAADTLTESCVNAIESGVYSLV
GPMI_SYNPX       IEQPLPGEERH-----------LVPSPR-VATYDLSPAMSADQLTDSCIDAIDQGTYSLI
GPMI_PROMA       IEQPLPGEKRH-----------LVPSPR-VATYDLSPEMSAEKLTKSCQEAIESGIYSLI
GPMI_PROMP       VEVPSPGEQRH-----------LIPSPR-VATYDMAPEMSAEELTISCSNAIKTGQYSFV
GPMI_GRATL       IEEPFAGEDRQ-----------LIPSPK-VETYDLDPEMSATKLTESAINAINKNTYKFI
GPMI_ANTSP       IEEPFPGENRE-----------LIASPK-VETYDLPPEMSAYQLTNSLIEAINKQLYQFI
GPMI_PORPU       AEEPFSGEDRE-----------LVSSPS-VTTYDLSPDMSAELVTQKSISAINKGIYSCI
GPMI_PYRYE       AEEPFPGEDRE-----------LVSSPD-VTTYDLSPDMSAELVTQKSISAIKKAIYSCI
GPMI_NATPD       REVAFEGERRD-----------IVDSPD-VPTYDEQPAMSAPELTDAAIDHIGADAPDVL
GPMI_HALMA       REVAFDGESRE-----------IVDSPD-VATYDLQPEMSAPELADTAIEFIETEDPSAM
GPMI_HALSA       REVAFDGETRT-----------IVDSPD-VPTYDEQPAMSAPAVTDTVLDALAGDDPDVL
GPMI_HALWD       REIAFEDERRE-----------IIKSPD-VSTYDQQPSMSSNEVTDTAIEQINTTDPDVL
GPMI_STRCO       DATVRDGEEHV-----------RITGEG-KADYVAHPHMNLDRVTDAVVEAAGRVDVDLV
GPMI_FLAJ1       REIPFEGESRI-----------LRNSPK-VATYDLQPEMSAYELADALVPELNKGEVDFV
GPMI_FLAPJ       REQPFLGESRI-----------LKNSPK-VATYDLQPEMSAYELTEALIPEIEKTEADFI
GPMI_BACFR       RETPYDNEDRI-----------LVPSPK-VATYDLKPEMSAYEVKDKLVAAINENKYDFI
GPMI_BACFN       RETPYDNEDRI-----------LVPSPK-VATYDLKPEMSAYEVKDKLVAAINENKYDFI
GPMI_BACTN       RETPFDNEDRI-----------LVPSPK-VATYDLKPEMSAYEVKDKLVDAINENKYDFI
GPMI_BACV8       RETPYDAEERI-----------LVPSPK-VATYDLKPEMSAYEVKDKLVEAIKTQKFDFI
GPMI_PARD8       RETPFDSEERI-----------LVPSPK-VATYDLKPEMSAFEVKDKLVDAINTKKFDFI
GPMI_HELPY       VETPFKNENRV-----------LIQSPK-VTTYDLKPEMSAKEVTLAVLEQMK-LGTDLI
GPMI_HELPH       VETPFKNENRV-----------LIPSPK-VTTYDLKPEMSAKEVTLAVLEQMK-LGTDLI
GPMI_HELPJ       VETPFKNENRV-----------LIQSPK-VTTYDLKPEMSAKGVTLAVLEQMR-LGTDLI
GPMI_HELAH       VETPFKNENRV-----------LIQSPK-VTTYDLKPEMSAKEVTLAVLEQMR-LGTDLI
GPMI_HELHP       REEAFIGEERV-----------LIPSPN-VKTYDLQPQMNASAVGDAVIKAVE-QGYDFV
GPMI_WOLSU       IETPWENESRV-----------LIPSPS-VATYDLKPEMSAPEVAEATLSGMR-QGYDFI
GPMI_ARCB4       VEEPVLNESRV-----------LIPSPQ-VATYDLKPEMSAPEVGSAVRTAMN-NNIDFI
GPMI_SULDN       IDEPYENETRV-----------LIPSPN-VRTYDEKPQMSAKEVGEVVLKGMD-EAYDFI
GPMI_CAMJ8       KEELLENETRV-----------LIPSPK-VKTYDEKPQMSAFEVCDAVKKGIE-KGEDFI
GPMI_CAMJR       KEELLENETRV-----------LIPSPK-VKTYDEKPQMSAFEVCDAVKKGIE-KGEDFI
GPMI_CAMJJ       KEELLENETRV-----------LIPSPK-VKTYDEKPQMSAFEVCDAVKKGIE-KGEDFI
GPMI_CAMJE       KEELLENETRV-----------LIPSPK-VKTYDEKPQMSAFEVCDAVKKGIE-KGEDFI
GPMI_CAMJD       KEELLENETRV-----------LISSPK-VKTYDEKPQMSAFEVCDAVKKGIE-KGEDFI
GPMI_EHRRW       REEVFENEERI-----------IIPSPS-VTTYDLVPEMSAYEITDTLIKKINLQKYSLI
GPMI_EHRRG       REEVFENEERI-----------IIPSPS-VTTYDLVPEMSAYEITDTLIKKINLQKYSLI
GPMI_EHRCJ       KEDMFENEDRI-----------IIPSPS-VATYNLTPEMSAEKVTDTIIEKIKLQKYSLI
GPMI_EHRCR       REDTFENEDRI-----------IIPSPS-VTTYNLMPEMSAKEVTNTVIERIKLQKYSLI
GPMI_ANAPZ       REEPFTGEDRI-----------IIPSPD-VSTYDLKPEMSAVEITDSLVERINSQQYALT
GPMI_ANAMM       KEEPFPGEDRV-----------IIPSPQ-VSTYDLQPEMSAFPMTEVLVERIESRQYSLI
GPMI_WOLPM       KEEPFSGEERI-----------LIPSPK-VQTYDLQPEMSAFELTEKLVEKIHSQEFALI
GPMI_WOLTR       KEEPFSNEERI-----------LIPSPK-VETYDLQPEMSAFELTEKLVGKIRSQEFTLI
GPMI_ONYPE       KELQLKNADRI-----------LIPSPK-VKTYDLKPEMSALEITTHAKTAILSGKYDTL
GPMI_AYWBP       KELQLKNADRI-----------LIPSPK-VKTYDLKPEMSALEITNAAKTAIFSRKYDTL
GPMI_ACHLI       KEVPLANSTRI-----------LAESPK-VPTYDLKPEMSAYELTDKVIAALKTGEYQTM
GPMI_MYCGE       FEVNLSNETKT-----------LIPSLK-VATYDLAPEMSCKAITDALLEKLN--NFDFT
GPMI_MYCPN       VEVDLPNETKC-----------MVPSLK-VATYDLAPEMACKGITDQLLNQIN--QFDLT
GPMI_MYCGA       VEVEYQNEDKV-----------LVPSRKDVKTYDLAPEMSAAAIVDQLLKVYT--KYDLT
GPMI_MYCPE       VEVDLKNESKI-----------LVDSKK-VKTYDEVPAMSAVEITDKLIENLD--KFDVI
GPMI_MYCPU       VDIEYKNSKRI-----------MVESQK-VRSYADHPEMSAKGITDELIKNAK--DFDLT
GPMI_MYCS5       VDVEYKNSKRI-----------MVDSLK-VESYADTPQMSAEEITSQVISHAK--DFDLT
GPMI_MYCMO       NDVLYENEERI-----------LIDSVK-ADSFADYPEMSAAGITDTLIANLG--KYDVI
GPMI_MYCHP       VDIEYKNENRI-----------LVDSLK-VDSFADYPHMSAKEITDSLLNNIE--KNDFI
GPMI_MYCH7       VELELENSDRI-----------LIDSLK-VQSYADFPQMSAVEITDKLLEVGQ--NYDFI
GPMI_MYCHJ       VELELENSDRI-----------LIDSLK-VQSYADFPQMSAVEITDKLLEVGQ--NYDFI
GPMI_MYCH2       VELELENSDRI-----------LIDSLK-VQSYADFPQMSAVEITDKLLEVGQ--KYDFI
GPMI_UREP2       VNKYYSTKTQY-----------LIPSQK-VATYDLCPQMSAHLITKTIIDHYF--DHDVF
GPMI_UREPA       VNKYYSTKTQY-----------LIPSQK-VATYDLCPQMSAHLITKTIIDHYF--DHDVF
GPMI_MYCCT       NDYFKNGLAKNDEITLANAYIDLIPSAK-VATYDLKPQMSAVEITDKLLEEIKKDEFDFI
                                          .      :   * *    :                

GPMI_CLOAB       ILNFANPDMVGHTGILEAAKKAVETVDECLGKIVDKVLK--LDGSVFITADHGNSEQMI-
GPMI_CLONN       ILNYANPDMVGHTGVIDAAVKAVETVDECLGKVMDKILE--KNGALFITADHGNCEQMI-
GPMI_CLOB1       ILNFANPDMVGHTGVFEAAKKAIETVDECVGKIVNKVLE--KDGTAFITADHGNSEEMI-
GPMI_CLOBL       ILNFANPDMVGHTGVFEAAKKAIETVDECVGKIVNKVLE--KDGTAFITADHGNSEEMI-
GPMI_CLOK5       ILNFANPDMVGHTGIFQAAKKAIEVVDECLGRIVSKILE--KNGTVFITADHGNSEQMV-
GPMI_CLOPE       ILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLE--KEGTLFITADHGNAEVMI-
GPMI_CLOP1       ILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLE--KEGTLFITADHGNAEVMI-
GPMI_CLOPS       ILNFANPDMVGHTGVQEAAVKAIEAVDECLGKVADKVLE--KEGTLFITADHGNAEVMI-
GPMI_CLOB8       ILNFANPDMVGHTGVVEAAVKAIETVDECVGKIADKILE--KNGCLFITADHGNAETMI-
GPMI_CLOTE       ILNFANPDMVGHTGVFDAAKTAIEVVDKCVGEISDKILE--KEGTVFITADHGNSEQMI-
GPMI_CLOD6       VLNFANPDMVGHTGSIEAAIKAVETVDTCVGKLIDKIVE--LGGSAIITADHGNAEYML-
GPMI_HUNT2       ILNYANPDMVGHTGVFEAAKAAIEAIDECLGKVVPAVLE--QNGVVLITADHGNSEQMI-
GPMI_LACP7       IVNFANPDMVGHTGISDAAIKAVEAVDACVGRAYDALLS--VDGQMFICADHGNAEQLV-
GPMI_BACSU       ILNFANPDMVGHSGMVEPTIKAIEAVDECLGEVVDAILA--KGGHAIITADHGNADILI-
GPMI_BACVZ       ILNFANPDMVGHSGMVEPTIKAIEAVDECLGEVVDAIIA--KGGHAIITADHGNADILI-
GPMI_BACP2       ILNFANPDMVGHSGMLEPTIKAIEAVDECLGAVVDAILA--KGGHAIITADHGNADVLI-
GPMI_BACLD       ILNFANPDMVGHSGKVEPTVKAIEAVDECLGEVVDAILA--KGGYAIITADHGNADVLI-
GPMI_GEOSE       ILNYANPDMVGHSGKLEPTIKAVEAVDECLGKVVDAILA--KGGIAIITADHGNADEVL-
GPMI_GEOKA       ILNYANPDMVGHSGKLEPTIKAVEAVDECLGKVVDAILA--KGGIAIITADHGNADEVL-
GPMI_GEOTN       ILNYANPDMVGHSGMLEPTIKAVEAVDECLGKVVDAILE--KGGIAIITADHGNADEVL-
GPMI_BACMQ       LLNFANPDMVGHSGMLEPTVKAIETVDECLGKIVDAILA--KGGTAIITADHGNADEVI-
GPMI_BACAH       ILNFANCDMVGHSGMMEPTIKAVEATDECLGKVVEAILA--KDGVALITADHGNADEEL-
GPMI_BACC1       ILNFANCDMVGHSGMMEPTIKAVEATDECLGKVVEAILA--KDGVALITADHGNADEEL-
GPMI_BACCR       ILNFANCDMVGHSGMMEPTIKAVEATDECLGKVVEAILA--KDGVALITADHGNADEEL-
GPMI_BACHK       ILNFANCDMVGHSGMMEPTIKAVEATDECLGKVVEAILA--KDGVALITADHGNADEEL-
GPMI_BACCZ       ILNFANCDMVGHSGMMEPTIKAVEATDECLGKVVEAILA--KDGVALITADHGNADEEL-
GPMI_BACAN       ILNFANCDMVGHSGMMEPTIKAVEATDECLGKVVEAILA--KDGVALITADHGNADEEL-
GPMI_BACCN       ILNFANCDMVGHSGMMEPTIKAVEATDECLGKVVEAILA--KDGVAIITADHGNADEEL-
GPMI_BACHD       ILNFANPDMVGHSGMLEPTIKAVEAVDECLGKVVDAILA--KGGAAVITADHGNADEVV-
GPMI_BACSK       ILNFANPDMVGHSGMLEPTVKAIEAVDECLGRVVDALLQ--KGGAAIITADHGNADEVV-
GPMI_OCEIH       ILNFANPDMVGHSGKLQPTIDAIEAVDECLGKVIDKITE--LGGHAIITADHGNSDEVM-
GPMI_STAAS       ILNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKILD--MDGYAIITADHGNSDQVL-
GPMI_STAAW       ILNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKILD--MDGYAIITADHGNSDQVL-
GPMI_STAAC       ILNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKILD--MDGYAIITADHGNSDQVL-
GPMI_STAAM       ILNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKILD--MDGYAIITADHGNSDQVL-
GPMI_STAAN       ILNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKILD--MDGYAIITADHGNSDQVL-
GPMI_STAAR       ILNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKILD--MDGYAIITADHGNSDQVL-
GPMI_STAEQ       LLNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKIID--MGGHAIITADHGNSDQVL-
GPMI_STAES       LLNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKIID--MGGHAIITADHGNSDQVL-
GPMI_STAHJ       ILNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKILD--MNGYAIITADHGNSDQVL-
GPMI_STAS1       LLNFANPDMVGHSGMLEPTIKAIEAVDECLGEVVDKITE--MGGHAIITADHGNSDMVL-
GPMI_LISMF       ILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILE--KGGSAIIFADHGNSETMS-
GPMI_LISMO       ILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILE--KGGSAIIFADHGNSETMS-
GPMI_LISIN       ILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILE--KGGSAIIFADHGNSETMS-
GPMI_LISW6       ILNFANPDMVGHSGMLEPTIKAIEAVDENLGRVVDLILE--KGGSAIIFADHGNSETMS-
GPMI2_METAC      VLNFANMDMVGHTGIFEAAVQAVEAVDTCVGRIIEALKK--AGGVALITADHGNAEQME-
GPMI_METMA       ILNFANMDMVGHTGDFEAAVKAVETVDNCVGRIVEALRT--AGGAALITADHGNAEQME-
GPMI1_METBF      VLNFANMDMVGHTGIFEAAVKAVEAVDSCVGKIATVLKE--VGGVAIITADHGNAEQME-
GPMI1_METAC      VLNFANMDMVGHTGIFEAAVKAVEAVDKCIGRIVEALKE--IGGVALITADHGNAEQMI-
GPMI2_METBF      VLNFANMDMVGHTGIFEAAVKAVEAVDKCIGRIVEVLKE--KGGVALITADHGNAEEMI-
GPMI_METBU       VLNLANMDMVGHSGIMEAAVKAVEVVDDCVGKIITAIKE--VGGEAMVMADHGNAEKMVE
GPMI_PSEF5       IVNYANGDMVGHSGVFEAAVKAVECLDLCVGRIVDALEK--VGGEALITADHGNVEQMS-
GPMI_PSEPF       VVNYANGDMVGHSGVFEAAVKAVECLDTCVGRIVEALEK--VGGEALITADHGNVEQMA-
GPMI_PSEU2       VVNYANGDMVGHSGIMEAAIKAVECLDVCVGRIAEALEK--VGGEALITADHGNVEQMT-
GPMI_PSE14       IVNYANGDMVGHSGIMEAAIKAVECLDVCVGRITAALEK--VGGEALITADHGNVEQMT-
GPMI_PSESM       IVNYANGDMVGHSGIMEAAIKAVEYLDVCVGRITDALEK--VGGEALITADHGNVEQMT-
GPMI_PSEP1       VVNYANGDMVGHTGVFEAAVKAVEALDTCVGRIVDALEK--VGGEALITADHGNVEQME-
GPMI_PSEPK       VVNYANGDMVGHTGVFEAAVKAVEALDTCVGRIVDALDK--VGGEALITADHGNVEQME-
GPMI_PSEPG       VVNYANGDMVGHTGVFEAAVKAVEALDTCVGRIVDALEK--VGGEALITADHGNVEQME-
GPMI_PSEE4       VVNYANGDMVGHTGVFEAAVKAVEALDSCVGRIVEALGK--VGGEALITADHGNVEQME-
GPMI_PSEAB       VVNYANGDMVGHTGVFEAAVKAVECLDTCMGRIVEALDK--VGGEALITADHGNVEQME-
GPMI_PSEAE       VVNYANGDMVGHTGVFEAAVKAVECLDTCMGRIVEALDK--VGGEALITADHGNVEQME-
GPMI_PSEA7       VVNYANGDMVGHTGVFEAAVKAVECLDTCMGRIVEALDK--VGGEALITADHGNVEQME-
GPMI_PSEMY       IVNYANGDMVGHTGVFEAAVKAVETLDTCVGRITEALQK--VGGEALITADHGNVEQME-
GPMI_ACIAD       VVNYANGDMVGHTGIFDAAVKAVEAVDTCLGRVYQAVMA--KHGHMIITADHGNVEQMQ-
GPMI_SHEB5       ICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVDALAK--VGGECIITADHGNAEQMT-
GPMI_SHEB8       ICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVDALAK--VGGECIITADHGNAEQMT-
GPMI_SHEB9       ICNYPNGDMVGHTGNFDAAVKACEAVDACIGCVVDALAK--VGGECIITADHGNAEQMT-
GPMI_SHEPC       ICNYPNGDMVGHTGNFDAAVKACEAVDTCIGRVVEALAK--VGGECIITADHGNAEQMT-
GPMI_SHESW       ICNYPNGDMVGHTGNFDAAVKACEAVDTCIGRVVEALAK--VGGECIITADHGNAEQMT-
GPMI_SHESR       ICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVDALAK--VGGECIITADHGNAEQMT-
GPMI_SHESA       ICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVDALAK--VGGECIITADHGNAEQMT-
GPMI_SHESM       ICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVDALAK--VGGECIITADHGNAEQMT-
GPMI_SHEON       ICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVEALAK--VGGECIITADHGNAEQMT-
GPMI_SHEDO       ICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVAALAK--VNGECLITADHGNAEQMT-
GPMI_SHEHH       ICNYPNGDMVGHTGNFDAAVKACEAVDSCIGRIVEALEK--VGGECLITADHGNAEQMT-
GPMI_SHEPA       ICNYPNGDMVGHTGNFDAAVKACEAVDTCIGRVVEALEK--VGGECLITADHGNAEQMT-
GPMI_SHELP       ICNYPNGDMVGHTGNFDAAVKACEAVDACIGRVVEALAK--VDGECLITADHGNAEQMT-
GPMI_SHESH       ICNYPNGDMVGHTGSFDAAVKACEAVDTCIGRVVDALAK--VDGECLITADHGNAEQMT-
GPMI_ECOK1       ICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVES--VGGQLLITADHGNAEQMR-
GPMI_ECOL5       ICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVES--VGGQLLITADHGNAEQMR-
GPMI_ECOL6       ICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVES--VGGQLLITADHGNAEQMR-
GPMI_SHIBS       ICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVES--VGGQLLITADHGNAEQMR-
GPMI_ECO57       ICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVES--VGGQLLITADHGNAEQMR-
GPMI_ECO24       ICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVES--VGGQLLITADHGNAEQMR-
GPMI_ECOHS       ICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVES--VGGQLLITADHGNAEQMR-
GPMI_ECOLC       ICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVES--VGGQLLITADHGNAEQMR-
GPMI_SHISS       ICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVES--VGGQLLITADHGNAEQMR-
GPMI_ECOLI       ICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVES--VGGQLLITADHGNAEQMR-
GPMI_SHIFL       ICNYPNGDMVGHTGVMEAAVKAVEALDHCVEEVAKAVES--VGGQLLITADHGNAEQMR-
GPMI_SHIDS       ICNYPNGDMVGHTGVMEAAVKAVEALDHCVDEVAKAVES--VGGQLLITADHGNAEQMR-
GPMI_SALPA       ICNYPNGDMVGHTGVMEAAIKAVEALDNCIEQVTKAVES--VGGQLLITADHGNAEQMR-
GPMI_SALTY       ICNYPNGDMVGHTGVMEAAIKAVEALDNCIEQVTKAVES--VGGQLLITADHGNAEQMR-
GPMI_SALTI       ICNYPNGDMVGHTGVMEAAIKAVEALDNCIEQVTKAVES--VGGQLLITADHGNAEQMR-
GPMI_SALPB       ICNYPNGDMVGHTGVMEAAIKAVEALDNCIEQVTKAVES--VGGQLLITADHGNAEQMR-
GPMI_SALCH       ICNYPNGDMVGHTGVMEAAIKAVEALDNCIDQVTKAVES--VGGQLLITADHGNAEQMR-
GPMI_ENT38       ICNYPNGDMVGHTGVMEAAVKAVETLDHCVEQVAKAVES--VGGQLLITADHGNAEQMR-
GPMI_CROS8       ICNYPNGDMVGHTGVFDAAVAAVEALDNCIAQVTRAVEA--AGGQMLITADHGNAEQMR-
GPMI_YERPA       ICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKA--ADGQLLITADHGNAEQMR-
GPMI_YERPP       ICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKA--ADGQLLITADHGNAEQMR-
GPMI_YERPN       ICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKA--ADGQLLITADHGNAEQMR-
GPMI_YERPE       ICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKA--ADGQLLITADHGNAEQMR-
GPMI_YERPS       ICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKA--ADGQLLITADHGNAEQMR-
GPMI_YERP3       ICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVKA--ADGQLLITADHGNAEQMR-
GPMI_YERE8       ICNYPNGDMVGHTGDYDAAVKAVETLDNCIEQVVAAVQA--VDGQLLITADHGNAEQMR-
GPMI_SERP5       ICNYPNGDMVGHTGVYDAAVKAVETLDNCIAQVVEAVKA--VDGQLLITADHGNAEQMR-
GPMI_VIBC3       ICNYPNGDMVGHTGVYEAAVKACEAVDECIGRVVEAIKE--VDGQLLITADHGNAEMMI-
GPMI_VIBCH       ICNYPNGDMVGHTGVYEAAVKACEAVDECIGRVVEAIKE--VDGQLLITADHGNAEMMI-
GPMI_VIBPA       ICNYPNADMVGHTGVYEAAEKAIEALDESVGKVVEAIKE--VGGQLLITADHGNAEMMI-
GPMI_VIBCB       ICNYPNADMVGHTGVYEAAEQAIEALDESVGKVVEAIKE--VSGQMLITADHGNAEMMI-
GPMI_VIBVU       ICNYPNADMVGHTGVYEAAEKAIEALDASVGQVVEAIKE--VGGQLLITADHGNAEMMV-
GPMI_VIBVY       ICNYPNADMVGHTGVYEAAEKAIEALDASVGQVVEAIKE--VGGQLLITADHGNAEMMV-
GPMI_ALIF1       VCNFPNCDMVGHTGVYDAAVKAVESLDECIGKVVEAIKE--VDGQLLITADHGNAEMMI-
GPMI_PHOPR       ICNYPNGDMVGHTGVYDAAVKACEALDGCIGQVVEAIKS--VGGQLLITADHGNAEMMI-
GPMI_AERS4       ICNYPNGDMVGHTGVFDAAVKACEAVDHCVGRVTEALAE--VGGECLITADHGNAEKML-
GPMI_PSYIN       ICNYPNGDMVGHTGVYDAAVKACEAVDSCVGKVVAALKE--VDGECLITADHGNAEQMI-
GPMI_PSEHT       ICNYPNGDMVGHSGVFAAAVKACEAVDHCIGRVVAALNK--YGGEALITADHGNAEQMA-
GPMI_PSEA6       ICNYPNGDMVGHTGNFDAAVKACEAVDTCIGRVVEAIKK--VGGDCLITADHGNAEKMA-
GPMI_COLP3       VCNYPNGDMVGHTGSFDAAVKACEAVDTCVGRVVKAAQD--NGGECLITADHGNAEQMQ-
GPMI_IDILO       ICNYPNGDMVGHTGNFDAAVKACEAVDHSVGRVVSALEA--VGGECLITADHGNAEQMS-
GPMI_HAHCH       VCNYANGDMVGHSGVYDAAMKAAECIDQCLKRIAEALNE--VGGQCLITADHGNAEQMV-
GPMI_SACD2       ICNYANCDQVGHTGDFDASVKAVEAVDAALAEVFAALER--VGGEALITADHGNVELMY-
GPMI_CHRSD       VCNYANGDMVGHSGNFDAAVKAIEAVDDCLGRVIEAIER--AGGECLVTADHGNAEQMV-
GPMI_METFK       ICNYANCDMVGHSGDLSASIKAVETIDTCIARIVKAMES--IGGQMIITADHGNVEQMR-
GPMI_CHRVO       FCNYANGDMVGHSGVFDAAVKAVEALDGCIERCVDAMLA--AGGEVLITADHGNCEQMY-
GPMI_THIDA       VCNYANPDMVGHTGNLEAAIKAIETVDTCLGRVVEAQLA--RGGEVLITADHGNAELML-
GPMI_COXBU       VCNFANPDMVGHTGDETATREAIQVIDDCLKRIITALQS--VGGEALITADHGNAEKMF-
GPMI_COXBR       VCNFANPDMVGHTGDETATREAIQVIDDCLKRIITALQS--VGGEALITADHGNAEKMF-
GPMI_COXBN       VCNFANPDMVGHTGDETATREAIQVIDDCLKRIITALQS--VGGEALITADHGNAEKMF-
GPMI_VESOH       ICNFANTDMVGHSGKLDATIKAVEAVDTCLGIIYKAMFA--IGGEMLITADHGNAEQMI-
GPMI_RUTMC       ICNFANTDMVGHSGKLNATIKAVETIDSCLGIIHKAMFA--ISGEILITADHGNAEQMI-
GPMI_NITOC       ICNYANPDMVGHTGDFNATVKAIETIDQCLGRVWAALQS--AGGELIITADHGNAEKMY-
GPMI_HYDCU       ICNIANPDMVGHTGDFNACVQAAEAVDEALGEILATIKA--VDGEAIVTADHGNMEMLF-
GPMI_FRATF       VCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILE--HDGNMFITADHGNADMMV-
GPMI_FRATH       VCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILE--HDGNMFITADHGNADMMV-
GPMI_FRATW       VCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILE--HDGNMFITADHGNADMMV-
GPMI_FRAT1       VCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILE--HDGNMFITADHGNADMMV-
GPMI_FRATT       VCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILE--HDGNMFITADHGNADMMV-
GPMI_FRATN       VCNYANSDMVGHTGNYEAAMQAIEYLDKCIARLKDAILE--HDGNMFITADHGNADMMV-
GPMI_FRAP2       VCNYANSDMVGHTGNYEAAMQAIEYLDKCLARLKDAILE--HDGNMFITADHGNADMMV-
GPMI_LEGPH       ICNYANADMVGHTGNFEATVQAIECLDQCMQQVWQALKN--NGGKLLITADHGNAEEMF-
GPMI_LEGPL       ICNYANADMVGHTGNFEATVQAIECLDQCMQQVWQALKN--NGGKLLITADHGNAEEMF-
GPMI_LEGPA       ICNYANADMVGHTGNFEATVQAIECLDQCMQQVWQALKN--NGGKLLITADHGNAEEMF-
GPMI_LEGPC       ICNYANADMVGHTGNFEATVQAIECLDQCMHQVWQALKN--NGGKLLITADHGNAEEMF-
GPMI_GEOSL       VVNFANADMVGHTGILDAAVRAIETVDECVGRVAATVLE--KGGALIITADHGNAEMMVD
GPMI_PELCD       VLNFANPDMVGHTGVESAAIAAMETVDACVGRVVDAVLN--AGGSLLITADHGNCEQMAD
GPMI_SYMTH       VLNFANPDMVGHTGVLEAAIRAVEAVDECLGQVVDALLA--KGGAAVIIADHGNCDQMVD
GPMI_RHOS1       VVNYANPDMVGHTGDLKAAMAAVEEVDRGLGRAVEAVTT--AGGAMIVTADHGNCETMVD
GPMI_RHOS4       VVNYANPDMVGHTGDLKAAMAAVEEVDRGLGRAVEAVTK--AGGAMIVTADHGNCETMVD
GPMI_RHOS5       VVNYANPDMVGHTGDLRAAMAACEEVDRGLGRAVEAVRQ--AGGAMIVTADHGNCETMID
GPMI_DINSH       VVNYANPDMVGHTGDLEAAKAACTAVDTGLGRALAALEV--AGGAMIVTADHGNCETMID
GPMI_PARDP       VVNYANPDMVGHTGSLPAAIRACEAVDKGLGMMLEALEK--AGGAAVVIADHGNCETTID
GPMI_ROSDO       VVNYANPDMVGHTGDLQAAMKACEAVDQGLGRVLAALEK--AGGAMIVTADHGNCDVMID
GPMI_RUEPO       VTNYANPDMVGHTGDLKAAIKACEAVDQGLSRVIAALEQ--AGGAMIVTADHGNCEMMID
GPMI_RUEST       VTNYANPDMVGHTGDLDAAIKACEAVDQGLGEVVAALKD--AGGAMIVTADHGNCELMVD
GPMI_AGRFC       VTNYANPDMVGHTGDLQAAIKACEAVDRGLGAVVAALEK--VGGAMLVIADHGNCETMVD
GPMI_RHOPA       VLNFANPDMVGHTGSLPAAIKAVETVDTQLGHIVAAIRK--AGGALLVTADHGNCEMMRD
GPMI_GLUOX       VLNFANPDMVGHTGSLSAAIKACETVDQGLGRINDAIVK--AGGVLLVTADHGNCETMRD
GPMI_MAGMM       VVNYANPDMVGHTGVYEAAVQAIETVDTQLGRLTDAIVQ--MGGEVLITADHGNADQMVD
GPMI_LAWIP       VCNLANPDMVGHTGNIKASISALEAVDNCVGRIEKAVAE--QHGCFILTADHGNVEEMLD
GPMI_DESVH       VCNVANLDMVGHTGVIPAAVRACETVDACVRRIADAVLA--SGGRLVITADHGNAEELLD
GPMI_RHOBA       IVNYANGDMVGHTGVLEAAIKAVEKVDACVGRVVDATLA--AGGSLVVTADHGNCEQMID
GPMI_SYNY3       VVNYANPDMVGHTGKLKEAIQAIETVDLNLGRLLASAAK--VGGTVLITADHGNAEYMSD
GPMI_MICAN       VVNYANPDMVGHTGILDAAMKAVETVDLCLAKLLSSVNK--LGGTVLITADHGNAETMVD
GPMI_NOSS1       VINYANPDMVGHTGQIEPTIKAIETVDRCLGRLLEGVSK--AGGTTIITADHGNAEYMLD
GPMI_TRIV2       VINYANPDMVGHTGQIEPTIQAIETVDRCLGRLLEGVSK--AGGTTIITADHGNAEYMLD
GPMI_TRIEI       VINYANPDMVGHTGAMDAAVNAVQTVDHCLGKLLQGISK--VGGTAIIIADHGNAEYMWD
GPMI_SYNE7       VINYANPDMVGHTGKMGATVEAIETVDRCLGRLVSAINR--AGGTALITADHGNAEYMWD
GPMI_SYNP6       VINYANPDMVGHTGKMGATVEAIETVDRCLGRLVSAINR--AGGTALITADHGNAEYMWD
GPMI_ACAM1       VINYANTDMVGHTGMMDATIQAVETVDGCLGKLLNQVIN--VGGTLLITADHGNAERMWD
GPMI_SYNJA       VLNYANPDMVGHTGNFKATVRALETVDRCLGRLLAAVVD--VGGTTLIVADHGNAELMWD
GPMI_SYNJB       VLNYANPDMVGHTGNYEATIRALETVDRCLGRLLAAVVD--AGGTTLILADHGNAELMWD
GPMI_THEEB       VVNFANSDMVGHTGKLAATIQAIETVDRCVGVLVEAATK--VGGTLLITADHGNAEYMID
GPMI_GLOVI       VINYANPDMVGHTGNFDATVKAVETVDACIGRLVEACVR--AGGTMLLTADHGNAELMWD
GPMI_PROM1       VINFANPDMVGHSGIMTAAIKANEKVDSCVGKLLNSIGK--LGGSLLITADHGNSEMMIG
GPMI_PROMT       VINFANPDMVGHSGIMKAAIKANEKVDSCIGKLLNSIGK--LGGSLLITADHGNSEMMIG
GPMI_PROM3       IINYANPDMVGHTGVMGAAQEAISTVDRCIGRLLDSTGR--MGGTLLITADHGNAELMQG
GPMI_PROMM       VINYANPDMVGHTGVMGAAQEAISTVDRCIGRLLDSTGR--MGGTLLITADHGNAELMQG
GPMI_SYNPX       VINYANPDMVGHTGVMDAATEAIATVDRCIGRLLDAVGR--RGGTMLITADHGNAELMQG
GPMI_PROMA       VINYANPDMVGHTGIHAATKKAISTVDKCIGKILDSTGK--MSGTLLITADHGNAELMKG
GPMI_PROMP       VINFANPDMVGHTGNMAAAIKAIETVDRCIGKIVNATGE--MGGSILITADHGNAELMKG
GPMI_GRATL       VINYANPDMVGHTGNLDATIHAIQKIDKCIKKIWLACQA--MNSTLIITSDHGNADYMLD
GPMI_ANTSP       VINYANPDMIGHTGNMNATIEAIEIVDQCIEKVLHTIED--TNNILIITSDHGNADYMLT
GPMI_PORPU       VINYANADMLGHTGKLKETIRSIETVDNCIALLFDAVSQ--SNGTLIITADHGNAECMLT
GPMI_PYRYE       VINYANADMLGHTGKLKETIQSIETVDRCITELLDAVSK--LNGTLIITADHGNAECMFT
GPMI_NATPD       VLNYANPDMVGHTGDFEAAKAAIEAVDEQLGRLESAIRE--AGGHLFVTADHGNADDMGT
GPMI_HALMA       VLNFANPDMVGHTGDFDAAVTAVEAVDEQLGRLVETIGA--AGGHALICADHGNADDMGT
GPMI_HALSA       VLNYANPDMVGHTGDFDAAIEAVEAVDRELGRLVPALND--AGAHAFLTADHGNADDLGT
GPMI_HALWD       ILNYANPDMVGHTGDFTAAIEAIESVDTQLDRLLETIYA--AGGHVIVTADHGNADNMGT
GPMI_STRCO       IANLANIDVVGHTGNLAATVTACEATDAAVDQILQAARN--SGRWVVAVGDHGNAERMTK
GPMI_FLAJ1       CLNFANGDMVGHTGIMEAAIKACEAVDACAKKVIDAALA--NDYTTIVIADHGNCETMIN
GPMI_FLAPJ       CLNFANGDMVGHTGIMSAAIKACQAVNKCVEKVITAALA--HNYTTIVIADHGNCETMIN
GPMI_BACFR       VVNYANGDMVGHTGIYEAIEKAVVAVDACVKDTIEAAKA--QGYEAIIIADHGNADHALN
GPMI_BACFN       VVNYANGDMVGHTGIYEAIEKAVVAVDACVKDTIEAAKA--QGYEAIIIADHGNADHALN
GPMI_BACTN       VVNFANGDMVGHTGIYEAIEKAVVAVDACVKDVIEAAKA--QDYEAIIIADHGNADRALN
GPMI_BACV8       VVNYANGDMVGHTGIYDAIEKAVKAIDECVKDTVEAAKA--NDYEVIIIADHGNADHALN
GPMI_PARD8       VVNYANGDMVGHTGIYKAIEKAVVTIDACLHDTVEAAKA--NDYEVIIIADHGNADHALN
GPMI_HELPY       IVNFANGDMVGHTGNFEASVKAVEAVDACLGEILSLAKK--LDYAMLLTSDHGNCERMK-
GPMI_HELPH       IVNFANGDMVGHTGNFEASVKAVEAVDACLGEILSLAKK--LDYAMLLTSDHGNCEHMK-
GPMI_HELPJ       IVNFANGDMVGHTGNFEASIKAVEAVDACLGEILSLAKE--LDYAMLLTSDHGNCERMK-
GPMI_HELAH       IVNFANGDMVGHTGNFEASVKAVEAVDTSLGEILSLAKE--LNYAMLLTSDHGNCEHMK-
GPMI_HELHP       VVNFANGDMVGHTGNLEAAIKAVEAVDKELGRIVESAQK--HHYALFITSDHGNCEEMK-
GPMI_WOLSU       VVNFANGDMVGHTGNTEAAISAVESVDRELGRLLEEAKK--SGYAVILTSDHGNCEEMR-
GPMI_ARCB4       VVNFANGDMVGHTGVFEAAVKAVEAVDFELGQIFELAKK--QNYNIILTSDHGNCEMMK-
GPMI_SULDN       VVNFANGDMVGHTGNLEAAKIAVNTVDSELGKILQKAKE--MDYSVLITSDHGNCEEMR-
GPMI_CAMJ8       VVNFANGDMVGHTGDFNAAIKAVEAVDTCLGEIVECAKK--HDYAFIITSDHGNCEAMQ-
GPMI_CAMJR       VVNFANGDMVGHTGDFNAAIKAVEAVDTCLGEIIECAKK--HDYAFIITSDHGNCEAMQ-
GPMI_CAMJJ       VVNFANGDMVGHTGDFNAAIKAVEAVDTCLGEIVECAKK--HDYAFIITSDHGNCEAMQ-
GPMI_CAMJE       VVNFANGDMVGHTGDFNATIKAVEAVDTCLGEILECAKK--HDYAFIITSDHGNCEAMQ-
GPMI_CAMJD       VVNFANGDMVGHTGDFNAAIKAVEAVDTCLGEIVECAKK--HDYAFIITSDHGNCEAMQ-
GPMI_EHRRW       IINYANADMVGHTGNIEATKKAITTLDQCLGKILKCIHN--TNYILVITADHGNAEEMF-
GPMI_EHRRG       IINYANADMVGHTGNIEATKKAITTLDQCLGKILKCIHN--TNYILVITADHGNAEEMF-
GPMI_EHRCJ       IVNYANADMVGHTGNIDATKQAITTIDQCLSKILNCIQN--TNYVLVITSDHGNAEEMF-
GPMI_EHRCR       ILNYANADMVGHTGNIEATKQAITALDQCLNKILNCIQG--TNYVLVITADHGNAEEMF-
GPMI_ANAPZ       VVNYANADMVGHTGNMEAAKKAVTTVDSCLQRVFYAAVN--AGAVMLITADHGNAEKMF-
GPMI_ANAMM       VVNYANADMVGHTGNLEAVKKAISVIDACLQMVFNAAKK--AGATMLITADHGNAEKMF-
GPMI_WOLPM       VVNYANPDMVGHTGNIKAAEKAVLAVDDCLAKVLNAVKKS-SNTALIVTADHGNVECMF-
GPMI_WOLTR       VANYANPDMVGHTGNMEAAKKAVLAVDDCLAKVLNTVKEI-NDAVLIVTADHGNVECMF-
GPMI_ONYPE       ILNFANPDMVGHTGFLDATIKAIQTVDSCLKEVLNAIF-A-VKGKACIVADHGNAEQMT-
GPMI_AYWBP       ILNFANPDMVGHTGFLDATIKAVQTVDSCLKEVLNAIF-A-VKGKACIVADHGNAEKMK-
GPMI_ACHLI       ILNFANPDMVGHTGNIEATKKAVEVTVECVGKVTDFIINE-LGGVAIILADHGNAEQMR-
GPMI_MYCGE       VLNFANPDMVGHTGNYQACIKALEALDVQIKRIVDFCKAN--QITMFLTADHGNAEVMI-
GPMI_MYCPN       VLNFANPDMVGHTGNYAACVQGLEALDVQIQRIIDFCKAN--HITLFLTADHGNAEEMI-
GPMI_MYCGA       VLNFANPDMVGHTGNYEATLKGLEALDHEIGRLLADAKKN--NITVFFTADHGNAEEMI-
GPMI_MYCPE       VLNFANADMVGHTGKYNEAVLAIEALDSQLARIDQKIKEL--NGTMFITADHGNAEVML-
GPMI_MYCPU       ILNYANPDMVGHTGVLTSTIKAVEILDYELSRLVDFAQKN--NITVFITADHGNAEVTE-
GPMI_MYCS5       ILNYANPDMVGHTGVLESTLVALEVLDKQLSRLVKWAEKN--KITVFITADHGNAEVML-
GPMI_MYCMO       ILNYANPDMVGHTGNLKATIKALEFLDFQYGKILKAIEKT--NHTLFITADHGNAEITE-
GPMI_MYCHP       IMNYANPDMVGHTGNLNATIEAIEFLDSQFQRILEYVSLNHENVTWFITADHGNAEITE-
GPMI_MYCH7       IMNFANPDMVGHTGDLKATIKAVEILDFQIGRICKWAEEK--NFDFFITADHGNAELTE-
GPMI_MYCHJ       IMNFANPDMVGHTGDLKATIKAVEILDFQIGRICKWAEEK--NFDFFITADHGNAELTE-
GPMI_MYCH2       IMNFANPDMVGHTGDLKATIKAVEILDFQIGRICKWAEEK--NFDFFITADHGNAELTE-
GPMI_UREP2       IVNYANPDMVGHSGNMQQTIEAILSVDHEIRKLYDFFE-KN-NGVLMITGDHGNAEMML-
GPMI_UREPA       IVNYANPDMVGHSGNMQQTIEAILSVDHEIRKLYDFFE-KN-NGVLMITGDHGNAEMML-
GPMI_MYCCT       VLNFANCDMVGHTGNNKATEIACKTLDDQLKRIHDEFVLKH-NGIMVITADHGNAEIMI-
                   * .* * :**:*       .                           .**** :    

GPMI_CLOAB       --DYSNGKPMTAHTVNPVPFVYVSNHTEA--------KKL-NEGVLADIAPTMLQE-MGL
GPMI_CLONN       --DYSTGNPMTAHTTNLVPFAYIANDAKE--------KELREEGILADIAPTMLQS-MGL
GPMI_CLOB1       --DYSTGKPMTAHTTNPVPFMYVSKNS----------KELREGGKLADIAPTMLQL-MNL
GPMI_CLOBL       --DYSTGKPMTAHTTNPVPFMYVSNDS----------KELREGGKLADIAPTMLQL-MNL
GPMI_CLOK5       --DYSTGNPMTAHTTNSVPFLYVSKNS----------TELRKDGILADISPTILQV-MGL
GPMI_CLOPE       --DYSTGKPMTAHTSDPVPFLWVSKDAEG--------KSLKDGGKLADIAPTMLTV-MGL
GPMI_CLOP1       --DYSTGKPMTAHTSDPVPFLWVSKDAEG--------KSLKDGGKLADIAPTMLTV-MGL
GPMI_CLOPS       --DYSTGKPMTAHTSDPVPFLWISKDAEG--------KSLKDGGKLADIAPTMLTV-MGL
GPMI_CLOB8       --DFSTGNPYTAHTTHEVPFVWVANDTEG--------KKLSNG-KLADIAPTMLVQ-LGL
GPMI_CLOTE       --DYSTGKPMTAHTTNEVPFVYVSKDAKD--------KRLKSEGILADIAPTMLTE-MGV
GPMI_CLOD6       --DPETGKTVTAHSINPVPFIVVGQEYES--------AKLLDGGRLSDIAPTILDM-MKL
GPMI_HUNT2       --DYETGGPFTAHTTNPVPLIVIGLGDV----------KLREG-RLADLAPTMLDI-LGF
GPMI_LACP7       --DYTNGEPFTAHTTNPVPFILINYDDSY---------TLREGGCLADIIPTLIEM-MKM
GPMI_BACSU       --TES-GEPHTAHTTNPVPVIVTKEGI-----------TLREGGILGDLAPTLLDL-LGV
GPMI_BACVZ       --TET-GEPHTAHTTNPVPVIVTKEGV-----------TLREGGILGDLAPTLLDL-LGV
GPMI_BACP2       --TEE-GKPHTAHTTNPVPVIVTKKGA-----------TLREGGILADLSPTLLDL-LGV
GPMI_BACLD       --TEE-GKPHTAHTTNPVPVIVTKEGV-----------TLREGGILGDLAPTLLDL-LGV
GPMI_GEOSE       --TPD-GKPQTAHTTNPVPVIVTKKGI-----------KLRDGGILGDLAPTMLDL-LGL
GPMI_GEOKA       --TPD-GKPQTAHTTNPVPVIVTKKGI-----------KLRDGGILGDLAPTMLDL-LGL
GPMI_GEOTN       --TPE-GKPQTAHTTNPVPVIVTKHGI-----------ELRKDGILGDLAPTMLDL-LGL
GPMI_BACMQ       --TLE-GNPMTAHTTNPVPVIVTKQGL-----------ELREDGILGDLAPTMLTL-LDV
GPMI_BACAH       --TSE-GEPMTAHTTNPVPFIVTKNDV-----------ELREGGILGDIAPTMLTL-LGV
GPMI_BACC1       --TSD-GEPMTAHTTNPVPFIVTKNDV-----------ELREGGILGDIAPXMLTL-LGV
GPMI_BACCR       --TSE-GEPMTAHTTNPVPFIVTKNDV-----------ELREDGILGDIAPTMLTL-LGV
GPMI_BACHK       --TSE-GEPMTAHTTNPVPFIVTKNDV-----------ELREDGILGDIAPTMLTL-LGV
GPMI_BACCZ       --TSE-GEPMTAHTTNPVPFIVTKNDV-----------ELREDGILGDIAPTMLTL-LGV
GPMI_BACAN       --TSE-GEPMTAHTTNPVPFIVTKNDV-----------ELREDGILGDIAPTMLTL-LGV
GPMI_BACCN       --TPD-GAPMTAHTTNPVPFIVTKKDV-----------ELREGGILGDIAPTMLTL-LGV
GPMI_BACHD       --TLE-GKPMTAHTTNKVPVIVTEEGL-----------NLREDGILADLSPTVLDL-LGG
GPMI_BACSK       --TLD-GKPMTAHTTNKVPVIVTEKGI-----------TLREDGILADLAPTVLDL-LGA
GPMI_OCEIH       --TLE-DKPMTAHTTNPVPVIVTKDDI-----------ELRDGGILADLSPTLLDL-LNV
GPMI_STAAS       --TDD-DQPMTTHTTNPVPVIVTKEGV-----------TLRETGRLGDLAPTLLDL-LNV
GPMI_STAAW       --TDD-DQPMTTHTTNPVPVIVTKEGV-----------TLRETGRLGDLAPTLLDL-LNV
GPMI_STAAC       --TDD-DQPMTTHTTNPVPVIVTKEGV-----------TLRETGRLGDLAPTLLDL-LNV
GPMI_STAAM       --TDD-DQPMTTHTTNPVPVIVTKEGV-----------TLRETGRLGDLAPTLLDL-LNV
GPMI_STAAN       --TDD-DQPMTTHTTNPVPVIVTKEGV-----------TLRETGRLGDLAPTLLDL-LNV
GPMI_STAAR       --TDD-DQPMTTHTTNPVPVIVTKEGV-----------TLRETGRLGDLAPTLLDL-LNV
GPMI_STAEQ       --TDD-DQPMTTHTTNPVPVIVTKEGV-----------TLRETGRLGDLAPTLLDL-LNV
GPMI_STAES       --TDD-DQPMTTHTTNPVPVIVTKEGV-----------TLRETGRLGDLAPTLLDL-LNV
GPMI_STAHJ       --TDD-DQPMTTHTTNPVPVIVTKEGV-----------TLRETGRLGDLAPTLLDL-LNV
GPMI_STAS1       --TDD-DQPMTTHTTNPVPVIVTKDGV-----------TLRETGRLGDLAPTLLDL-LNV
GPMI_LISMF       --TPE-GKPHTAHTTVPVPVIVTKKGV-----------TLREGGRLADVAPTMLDL-LGV
GPMI_LISMO       --TPE-GKPHTAHTTVPVPVIVTKKGV-----------TLREGGRLADVAPTMLDL-LGV
GPMI_LISIN       --TPE-GKPHTAHTTVPVPVIVTKKGV-----------TLREGGRLADVAPTMLDL-LGV
GPMI_LISW6       --TPE-GKPHTAHTTVPVPVIVTKKGV-----------KLREGGRLADVAPTMLDL-LGV
GPMI2_METAC      --NQHTGEPHTAHTSNPVRCIYAGK--GE--------VKALENGKLSDLAPTLLDL-LGV
GPMI_METMA       --NSHTGEPHTAHTSNPVKCIYTGN--GE--------VKALENGKLSDLAPTLLDL-LEI
GPMI1_METBF      --NPTTEEPHTAHTSNPVKCIYFGN--DE--------VKGLKNGKLCDLAPTLLEL-LKI
GPMI1_METAC      --DSKTGEPHTAHTSNPVRCIYFGN--GE--------VKALKKGKLCDLAPTLLEL-IGI
GPMI2_METBF      --DLKTGEPHTAHTSNPVKCIYFGN--SE--------IKALRNGKLCDVAPTILEL-LGI
GPMI_METBU       FCNNTERQCYTAHTSNPVRCIYVTQ--EK--------RVELQKGRLSDVAPTILKI-MGI
GPMI_PSEF5       --DESTGQAHTAHTTEPVPFIYVGK--RA--------LKVREGGVLADVAPTMLKL-LGL
GPMI_PSEPF       --DESTGQAHTAHTTEPVPFIYVGK--RD--------LKVREGGVLADVAPTMLKL-LGL
GPMI_PSEU2       --DDSTGQAHTAHTSEPVPFVYVGK--RQ--------LKVRQGGVLADVAPTMLHL-LGM
GPMI_PSE14       --DDSTGQAHTAHTSEPVPFVYVGK--RP--------LKVREGGVLADVAPTMLHL-LGM
GPMI_PSESM       --DDATGQAHTAHTSEPVPFVYVGK--RQ--------LKVREGGVLADVAPTMLQL-LGM
GPMI_PSEP1       --DECTGQAHTAHTTEPVPFIYVGK--RN--------VKVREGGVLADVAPTMLKL-LGL
GPMI_PSEPK       --DECTGQAHTAHTTEPVPFIYVGK--RN--------VKVREGGVLADVAPTMLKL-LGL
GPMI_PSEPG       --DECTGQAHTAHTTEPVPFIYVGK--RN--------LKVRDGGVLADVAPTMLQL-LGL
GPMI_PSEE4       --DECTGQAHTAHTSEPVPFIYVGK--RK--------VTVREGGVLADVAPTMLKL-LGL
GPMI_PSEAB       --DESTGQAHTAHTCEPVPFVYVGK--RK--------LSIREGGVLADVAPTMLTL-MGL
GPMI_PSEAE       --DESTGQAHTAHTCEPVPFVYVGK--RK--------LSIREGGVLADVAPTMLTL-MGL
GPMI_PSEA7       --DESTGQAHTAHTCEPVPFVYVGK--RK--------LSIREGGVLADVAPTMLTL-MGL
GPMI_PSEMY       --DECTGQAHTAHTCEPVPFIYVGK--RP--------ARIREGGVLADVAPTLLTL-MGL
GPMI_ACIAD       --DYQSGQVHTQHTTELVPFIYVGP--TQ--------AVIAEGGVLADVAPTLLNL-MQL
GPMI_SHEB5       --DETTGQAHTAHTSELVPFVFVG---RN--------ATIDEGGKLSDVAPTILTL-IGE
GPMI_SHEB8       --DETTGQAHTAHTSELVPFVFVG---RN--------ATIDEGGKLSDVAPTILTL-IGE
GPMI_SHEB9       --DETTGQAHTAHTSELVPFVFVG---RD--------ATIDEGGKLSDVAPTILTL-IGE
GPMI_SHEPC       --DETTGQAHTAHTSELVPFIFVG---RD--------ATIDKGGKLSDVAPTILQL-IGE
GPMI_SHESW       --DETTGQAHTAHTSELVPFIFVG---RD--------ATIDKGGKLSDVAPTILQL-IGE
GPMI_SHESR       --DETTGQAHTAHTSELVPFVFVG---RD--------ATIDEGGKLSDVAPTILHL-MGE
GPMI_SHESA       --DETTGQAHTAHTSELVPFVFVG---RD--------ATIDEGGKLSDVAPTILHL-MGE
GPMI_SHESM       --DETTGQAHTAHTSELVPFVFVG---RD--------ATIDEGGKLSDVAPTILHL-MGE
GPMI_SHEON       --DETTGQAHTAHTSELVPFVFVG---RD--------ATIDKGGKLSDVAPTILHL-MGE
GPMI_SHEDO       --DESTGQAHTAHTSELVPFIYVG---RD--------ASIKDGGRLSDIAPTMLSL-MGQ
GPMI_SHEHH       --DESTGQAHTAHTSELVPLIYVG---RD--------AEIEKGGRLSDLAPTMLTL-MGQ
GPMI_SHEPA       --DESTGQAHTAHTSELIPLIYVG---RD--------AEIENGGRLSDLAPTMLTL-MGQ
GPMI_SHELP       --DEQTGQAHTAHTSELVPLIYVG---RK--------GEIAPNGRLSDLAPTMLTL-MGQ
GPMI_SHESH       --DEQTGQAHTAHTSELVPLIYVG---RN--------GSIENDGRLSDLAPTMLTL-MGE
GPMI_ECOK1       --DPATGQAHTAHTNLPVPLIYVGD--KN--------VKAVEGGKLSDIAPTMLSL-MGM
GPMI_ECOL5       --DPATGQAHTAHTNLPVPLIYVGD--KN--------VKAVEGGKLSDIAPTMLSL-MGM
GPMI_ECOL6       --DPATGQAHTAHTNLPVPLIYVGD--KN--------VKAVEGGKLSDIAPTMLSL-MGM
GPMI_SHIBS       --DPATGQAHTAHTNLPVPLIYVGD--KN--------VKAVAGGKLSDIAPTMLSL-MGM
GPMI_ECO57       --DPATGQAHTAHTNLPVPLIYVGD--KN--------VKAVAGGKLSDIAPTMLSL-MGM
GPMI_ECO24       --DPATGQAHTAHTNLPVPLIYVGD--KN--------VKAVAGGKLSDIAPTMLSL-MGM
GPMI_ECOHS       --DPATGQAHTAHTNLPVPLIYVGD--KN--------VKAVAGGKLSDIAPTMLSL-MGM
GPMI_ECOLC       --DPATGQAHTAHTNLPVPLIYVGD--KN--------VKAVAGGKLSDIAPTMLSL-MGM
GPMI_SHISS       --DPATGQAHTAHTNLPVPLIYVGD--KN--------VKAVAGGKLSDIAPTMLSL-MGM
GPMI_ECOLI       --DPATGQAHTAHTNLPVPLIYVGD--KN--------VKAVEGGKLSDIAPTMLSL-MGM
GPMI_SHIFL       --DPATGQAHTAHTNLPVPLIYVGD--KN--------VKAVAGGKLSDIAPTMLSL-MGM
GPMI_SHIDS       --DPATGQAHTAHTNLPVPLIYVGD--KN--------VKAVEGGKLSDIAPTMLSL-MGM
GPMI_SALPA       --DPATGQAHTAHTNLPVPLIYVGE--KN--------VKAVEGGKLSDIAPTMLSL-MGM
GPMI_SALTY       --DPATGQAHTAHTNLPVPLIYVGE--KN--------VKAVEGGKLSDIAPTMLSL-MGM
GPMI_SALTI       --DPATGQEHTAHTNLPVPLIYVGE--KN--------VKAVEGGKLSDIAPTMLSL-MGM
GPMI_SALPB       --DPATGQAHTAHTNLPVPLIYVGE--KN--------VKAVEGGKLSDIAPTMLSL-MGM
GPMI_SALCH       --DPATGQAHTAHTNLPVPLIYVGE--KN--------VKAVEGGKLSDIAPTMLSL-MGM
GPMI_ENT38       --DPSTGQAHTAHTNLPVPLIYVGE--KS--------LKAVEGGKLSDIAPTMLTL-MGM
GPMI_CROS8       --DPATGQAHTAHTNLPVPLIYVGD--KA--------VKAVDGGKLSDIAPTLLTL-MGM
GPMI_YERPA       --DPATGQAHTAHTSLPVPLIYVGN--KA--------VKAVEGGKLSDIAPTMLSL-MEM
GPMI_YERPP       --DPATGQAHTAHTSLPVPLIYVGN--KA--------VKAVEGGKLSDIAPTMLSL-MEM
GPMI_YERPN       --DPATGQAHTAHTSLPVPLIYVGN--KA--------VKAVEGGKLSDIAPTMLSL-MEM
GPMI_YERPE       --DPATGQAHTAHTSLPVPLIYVGN--KA--------VKAVEGGKLSDIAPTMLSL-MEM
GPMI_YERPS       --DPATGQAHTAHTSLPVPLIYVGN--KA--------VKAVEGGKLSDIAPTMLSL-MEM
GPMI_YERP3       --DPATGQAHTAHTSLPVPLIYVGN--KA--------VKAVEGGKLSDIAPTMLSL-MEM
GPMI_YERE8       --DPATGQAHTAHTSLPVPLIYVGN--KE--------VKAVEGGKLSDIAPTMLSL-MEM
GPMI_SERP5       --DPATGQAHTAHTSLPVPLIYIG---KP--------ASAVNGGKLSDIAPTMLAL-MGM
GPMI_VIBC3       --DPETGGVHTAHTSLPVPLIYVGN--KA--------ISLKEGGKLSDLAPTMLAL-SDL
GPMI_VIBCH       --DPETGGVHTAHTSLPVPLIYVGN--KA--------ISLKEGGKLSDLAPTMLAL-SDL
GPMI_VIBPA       --DPETGGVHTAHTNLPVPLIYVGD--KA--------VEFKEGGKLSDLAPTMLSL-AGL
GPMI_VIBCB       --DPETGGVHTAHTNLPVPLIYVGD--KA--------VEFKEGGKLSDLAPTMLSL-AGL
GPMI_VIBVU       --DPETGGIHTAHTSLPVPLIYVGD--KA--------VEFKEGGKLSDLAPTMLSL-AGL
GPMI_VIBVY       --DPETGGIHTAHTSLPVPLIYVGD--KA--------VEFKEGGKLSDLAPTMLSL-AGL
GPMI_ALIF1       --DPETGGVHTAHTNLPVPLIYVGS--KA--------VEFKEGGKLSDLAPTMLAL-TDT
GPMI_PHOPR       --NPETGGVHTAHTNLPVPLIYVGD--KS--------LTLKDGGKLSDLAPTMLSL-SDI
GPMI_AERS4       --DEETGQAHTAHTNLPVPLIYFGR--KA--------EVLE-GGKLSDLAPTMLTL-MGL
GPMI_PSYIN       --DPVTGGIHTAHTNLPVPFIYVGR--NA--------EMAS-GGRLCDIAPTMLNL-MDM
GPMI_PSEHT       --NLKTGQAHTAHTSEPVPFIYVG---RD--------ATASEGKALSDVAPTMLHL-MGM
GPMI_PSEA6       --DETTGQAHTAHTSELVPFWHVG---QK--------TTARSGGTLSDVAPTMLHL-MGM
GPMI_COLP3       --DPVSGQAHTAHTCEPVPLIYVG---RN--------ASPAASGTLSDISPSVLHL-MGM
GPMI_IDILO       --DATTGQAHTAHTNELVPFIYVG----R--------PAKARNGRLSDVAPTILHL-IGM
GPMI_HAHCH       --DENGQP-HTQHTTGPVPLIYIGP--KN--------ISLKEDGRLCDIAPSLLDL-MEL
GPMI_SACD2       --DDEAQQLHTQHTTLPVPLVYVGK--RD--------ISLEQGGSLADIAPTMLAL-LDV
GPMI_CHRSD       --HPETGNPQTAHTTFQVPLIYVTPR-QG--------ATLADDGSLCDLAPTLLTM-MHE
GPMI_METFK       --DYENNQPHTQHTTNQVPLFFIGKP-AT--------LAAPGTGSLCDLAPSLLAM-MGL
GPMI_CHRVO       --DGEHHQPHTQHTTNQVPFLYIGRP-AK--------IRA--GGSLRDISPSLLAM-MGL
GPMI_THIDA       --DAETGQAHTAHTMNLVPVIFVGRR-HA--------SLAE-TGALEDVSPTLLRM-MGL
GPMI_COXBU       --DEKTNQPHTAHTSNLVPLIYVGREAQF--------CK--EVGALDDVAPTLLYL-MGL
GPMI_COXBR       --DEKTNQPHTAHTSNLVPLIYVGREAQF--------CK--EVGALDDVAPTLLYL-MGL
GPMI_COXBN       --DEKTNQPHTAHTSNLVPLIYVGREAQF--------CK--EVGALDDVAPTLLYL-MGL
GPMI_VESOH       --NPQTNEVHTAHTNNPVPLIFVSNRKAD--------IMKPGKGALSDIAPTLLAM-MDI
GPMI_RUTMC       --NPKTHEVHTAHTNNPVPLIFVSERKAD--------ISEPEKGALSDIAPTLLAM-MDI
GPMI_NITOC       --NAQYQQPHTAHTHNAVPFIFVSERAAI--------AS--ANGSLADVTPTMLYL-MNI
GPMI_HYDCU       --NEETGKPLTSHTTFPVPFVYFGKKGYP--------LK--DGGALCDVIPTLLDM-MGI
GPMI_FRATF       --NPETQKPHTAHTTNLVPFIYVGHK-KA--------QVALEHGKLSDIAPTLLNV-MGI
GPMI_FRATH       --NPETQKPHTAHTTNLVPFIYVGHK-KA--------QVALEHGKLSDIAPTLLNV-MGI
GPMI_FRATW       --NPETQKPHTAHTTNLVPFIYVGHK-KA--------QVALEHGKLSDIAPTLLNV-MGI
GPMI_FRAT1       --NPETQKPHTAHTTNLVPFIYVGHK-KA--------QVALEHGKLSDIAPTLLNV-MGI
GPMI_FRATT       --NPETQKPHTAHTTNLVPFIYVGHK-KA--------QVALEHGKLSDIAPTLLNV-MGI
GPMI_FRATN       --NPETQKPHTAHTTNLVPFVYVGHK-KA--------QVALEHGKLSDIAPTLLNV-MGI
GPMI_FRAP2       --NPKTQKPHTAHTTNLVPFVYVGHK-KA--------QVALEHGKLSDIAPTILNV-MNI
GPMI_LEGPH       --SEATNQAHTAHTSEPVPFLYVGGG-WH--------FTHSE-GSLIDIAPSLLAL-LGI
GPMI_LEGPL       --SEATNQAHTAHTSEPVPFLYVGGG-WH--------FTHSE-GSLIDIAPSLLAL-LGI
GPMI_LEGPA       --SEATNQAHTAHTSEPVPFLYVGGG-WH--------FTHSE-GSLIDIAPSLLAL-LGI
GPMI_LEGPC       --SEATNQAHTAHTSEPVPFLYVGGG-WH--------FTHAE-GSLIDIAPSLLAL-LGI
GPMI_GEOSL       -ETG---GPHTAHTNERVPLILVDDSRKG--------ARLRPG-TLADIAPTMLGL-LGI
GPMI_PELCD       -AKG---APHTAHTSNPVPVILVDPDRTG--------VKLRNG-ILADLAPTLLEL-MGI
GPMI_SYMTH       YETG---APHTNHTLNPVPCILVDDQRLD--------AKLKPG-VLANVAPTLLEI-IGL
GPMI_RHOS1       PETG---GPHTAHTTNPVPVILVNG-PAG--------ARLHAG-RLADLAPTLLQL-MQL
GPMI_RHOS4       PETG---GPHTAHTTNPVPVILVNG-PAG--------ARLHAG-RLADLAPTLLQL-MQL
GPMI_RHOS5       PETG---GPHTAHTTNPVPVILVGG-PAG--------ARLRAG-RLADLAPTLLEL-MGL
GPMI_DINSH       PETG---GTHTAHTLNPVPVILVGG-PEG--------ATLAPG-RLADLAPTILHL-MHL
GPMI_PARDP       PETG---GPHTAHTTNPVPVIVFGG-PEG--------AKLRNG-RLADVAPTVLDL-MGL
GPMI_ROSDO       PETG---GPHTAHTLNPVPVVVVGA-PDG--------ATLRDG-RLADLAPTILHL-MGL
GPMI_RUEPO       PETG---GPHTAHTLNPVPVALVGG-PAG--------VTLRDG-RLSDLAPTVLAL-MGL
GPMI_RUEST       PETG---GAHTAHTTNLVPVALVGG-PEG--------TALKDG-RLADLAPTLLAL-MGL
GPMI_AGRFC       PVTG---GPHTAHTTNPVPVILFGG-PEG--------AKVHDG-ILADVAPTLLQL-MNV
GPMI_RHOPA       PETG---GPHTAHTTNPVPVLLVG--DNG---------PLADG-QLSDLAPTLLKL-MEL
GPMI_GLUOX       PVTG---GAHTSHTLNVVPVILAH--ARG--------ETIHDG-RLADLAPTMLAL-MGV
GPMI_MAGMM       -EQG---TAHTAHTLNPAPLIYLG---RD--------AQLHDG-RLSDVAPTLLAL-MGL
GPMI_LAWIP       -KSG---QPQTAHSCNPVPLIAIYDGKP---------LNLKESGKLGDIAPTILSI-WDV
GPMI_DESVH       -ESG---NPQTAHSMNRVPFTVVEQGRV---------HTFREGGVLGDIAPTILGL-WGV
GPMI_RHOBA       PETG---GPHTAHTTYQVPLIVVDPEFVG--------KPLREGGRLADIAPTVLAL-MGL
GPMI_SYNY3       ESG----NPWTAHTTNPVPFILVEGEGRKIPGHGGEVKLRE-GGKLADIAPTILDI-LQL
GPMI_MICAN       ESG----NPWTAHTTNPVPLILIEGEGRKIPGHGGDVQLRD-DGRLADIAPTILEI-LSI
GPMI_NOSS1       EAG----NSWTAHTTNPVPLILVEGEKVKIPGYGTNVELRS-DGKLADIAPTILDI-LQL
GPMI_TRIV2       EAG----NSWTAHTTNPVPLILVEGEKVKIPGYGTNVELRS-DGKLADIAPTILDI-LQL
GPMI_TRIEI       EDG----NPWTAHTTNLVPFILIEGEVSKIPGHGTKVPLRE-NGCLADIAPTILEI-LNL
GPMI_SYNE7       ENG----EPWTAHTTNLVPFIVVEGERRKLPGFGTEIPLRE-DGRLSDIAPTILQL-LGL
GPMI_SYNP6       ENG----EPWTAHTTNLVPFIVVEGERRKLPGFGTEIPLRE-DGRLSDIAPTILQL-LGL
GPMI_ACAM1       ETG----NPWTAHTTNPVPFILVEGEGRKIPAHGTDVQLRA-DGRLADIAPTILDI-LQL
GPMI_SYNJA       EQG----NPWTAHTNNPVPCILVEGERRKIPGRGGDVKLRS-GGTLADVGPTLLEI-LGL
GPMI_SYNJB       ENG----NPWTAHTTNPVPCILVEGERRKIPGCGGDVKLRS-NGTLADVAPTLLEI-LGL
GPMI_THEEB       EDG----NPWTAHTTNPVPFILVEGEKRKVPGHGGHVILRK-DGCLADIAPTILEI-LEL
GPMI_GLOVI       EQG----NPWTAHTTNPVPFILIESEGLKIPGWGTDVQLRA-GGSLGDIAPTILEI-LGL
GPMI_PROM1       PDG----QPWTAHTTNPVPVILIEGEKRKLSGYGNDIKLRQSGGGLADLAPTLLHL-LNL
GPMI_PROMT       PDG----QPWTAHTTNPVPVILIEGEKRKLSGYGNDIKLRESGGGLADLAPTLLHL-LNL
GPMI_PROM3       SDG----QAWTAHTTNPVPVILVEGEKRKLSGYGNDIQLRA-GGGLADIAPTLLQL-LDL
GPMI_PROMM       SDG----QAWTAHTTNPVPVILVEGEKRKLAGYGNDIQLRE-GGGLADIAPTLLQL-LDL
GPMI_SYNPX       PDG----QAWTAHTTNPVPCILVEGEQRKLPGHGNDISLRE-DGGLADIAPTLLQI-LNL
GPMI_PROMA       PDG----EPWTAHTTNPVPVILIEGEKRKISGQGNQIRLRE-GGGLADIAPTLLEV-LSL
GPMI_PROMP       PDG----EPWTAHTINKVPLIFIEGEKRKIPNMGNEIYLRE-NAGLADIAPTLLQL-LNL
GPMI_GRATL       ENN----EPCTSHSTNPVPFILAEPTN------IHTYHLRK-NGNLADIAPTILQL-LNL
GPMI_ANTSP       DEN----KPCTSHSINPVPFILINNRQ------KKQTNLHS-HGSLADIAPTILDI-LNI
GPMI_PORPU       NEG----TSCTSHTTNLVPFILIEGEQATISGHGGQVEFRK-NGSLADVAPTILDI-LNL
GPMI_PYRYE       DEG----NPCTAHTTNLVPLILIEGEQEAISGHGGQVKLRN-NGSLADIAPTILDI-LHL
GPMI_NATPD       PE-----APHTAHTTNPVPFVYCTPDGTDGG-----YTVRD-GGTLADIAPTLLST-IGV
GPMI_HALMA       ED-----DPHTAHTTNPVPFIYLSPDGTAGG-----RTARD-GGTLADLAPTMLTL-MGI
GPMI_HALSA       PA-----DPHTAHTFNPVPFVSLPP-ASGDT-----AAVRD-GGALRDIAPTLLDV-LGI
GPMI_HALWD       AA-----NPHTAHTTNPVPIVYTRPDGNGDG-----DTIRD-GGSLCDIAPTVLEL-LSV
GPMI_STRCO       QAPDGSVRPYGGHTTNPVPLVIVPNRTDTPA-----PTLPG-TATLADVAPTILHL-LGH
GPMI_FLAJ1       ----PDGSPNTAHTTNPVPIILVD-----------KQLKNIQDGVLGDIAPTILEL-MGV
GPMI_FLAPJ       ----PDGTPNTAHTTNPVPIILVD-----------KELKTIHDGVLGDIAPTILDL-MGI
GPMI_BACFR       ----EDGTPNTAHSLNPVPCVYVTE----------NKEAKVADGRLADVAPTILHI-LDM
GPMI_BACFN       ----EDGTPNTAHSLNPVPCVYVTE----------NKEAKVADGRLADVAPTILHI-LDM
GPMI_BACTN       ----EDGTPNTAHSLNPVPCVYVTG----------NKAAKVEDGRLADVAPTILKI-MGL
GPMI_BACV8       ----EDGTPNTAHSLNPVPFVYVTE----------NKNAKVENGVLADVAPSILHI-LGM
GPMI_PARD8       ----EDGTPNTAHSLNPVPFVYVTA----------NKDAKVEDGILADVAPSILHI-LGL
GPMI_HELPY       --DENQ-NPLTNHTAGSVYCFVL--GDGVK--------SIKNG-ALNNIASSVLKL-MGL
GPMI_HELPH       --DENQ-NPLTNHTAGSVYCFVL--GDGVR--------SIKNG-ALNNIASSVLKL-MGL
GPMI_HELPJ       --DENQ-NPLTNHTAGSVYCFVL--GNGVK--------SIKNG-ALNNIASSVLKL-MGI
GPMI_HELAH       --DENQ-NPLTNHTAGSVYCFVL--GNGIK--------SIKNG-ALNNIASSVLKL-MGI
GPMI_HELHP       --DEKG-NMLTNHTVGQVWCFGM--IEGVS--------KIENG-GLNNIAPSVLKA-MNL
GPMI_WOLSU       --DERG-SMLTNHTVGEVWCFIL--AQGVT--------EIREG-GLNQVAPTVLKI-MGL
GPMI_ARCB4       --DDEG-NILTNHTVGDVYCFVY--SPKVK--------EVKTG-SLNNIAPTVLKL-MNL
GPMI_SULDN       --DDDG-NILTNHTAGKVWCFVE--AEGVS--------RVEDG-GLNNIAPTILKL-MGL
GPMI_CAMJ8       --DEKG-NLLTNHTTFDVFVFVQ--AKGVS--------KIKDNMGLSNIAASVLKI-LDL
GPMI_CAMJR       --DEKG-NLLTNHTTFDVFVFVQ--AKGVS--------KIKDNMGLSNIAASVLKI-LDL
GPMI_CAMJJ       --DEKG-NLLTNHTTFDVFVFVQ--AKGVS--------KIKDNMGLSNIAASVLKI-LDL
GPMI_CAMJE       --DEKG-NLLTNHTTFDVFVFVQ--ARGVS--------KIKDNMGLSNIAASVLKI-LDL
GPMI_CAMJD       --DEKG-NLLTNHTTFDVFVFVQ--ASGVS--------KIKANMGLSNIAASVLKI-LDL
GPMI_EHRRW       --DVQNNMPYTAHTLNPVPFVVC-NYPKKI--------KLKNG-RLSDVAPTILEI-LNI
GPMI_EHRRG       --DVQNNMPYTAHTLNPVPFVVC-NYPKKI--------KLKNG-RLSDVAPTILEI-LNI
GPMI_EHRCJ       --DVKNNMPYTAHTLNPVPFIIC-NYNKKI--------RLKNG-RLCDVAPTILEI-LNL
GPMI_EHRCR       --DVKNNMPYTAHTLNPVPFIIC-NYSKQI--------RLKNG-RLCDVAPTILEI-LNI
GPMI_ANAPZ       --DVQNDSPFTAHTSSMVPFVVC-NADGDI--------SLSDG-RLCDVAPTVLDL-MNI
GPMI_ANAMM       --DMRG-TPFTAHTSNTVPLVLC-NCDKRF--------GLVDG-RLCDVAPTILEL-MEI
GPMI_WOLPM       --DEENNTPHTAHTLNKVPFIV---SCDNL--------KLRDG-RLSDIAPTILQL-LGI
GPMI_WOLTR       --DEKNNTPHTAHTLNKVPFIIYPNSCNNL--------KLKDG-RLSDIAPTILQL-LGI
GPMI_ONYPE       ---DNQGNPHTAHTTNLVPFIVTDK------------NVVLKPGSLCDVAPTMLDL-LEI
GPMI_AYWBP       ---DNQGNPHTAHTTNLVPFIVTDK------------NVVLKPGSLCDVAPTMLDL-LEI
GPMI_ACHLI       ---DQEGKPHTAHTTNLVPVVVTKK------------GIKLNSGALCDVAPTLLDL-LGI
GPMI_MYCGE       ---DNNNNPVTKHTINPVPFVCTDKNVNFNQ-----------TGILANIAPTILEY-LNL
GPMI_MYCPN       ---DSNNNPVTKHTVNKVPFVCTDTNIDLQQD----------SASLANIAPTILAY-LGL
GPMI_MYCGA       ---DENNQKVTKHTTNVVPFSITDPNVKFTKK----------EGILANVAPTILKY-LEI
GPMI_MYCPE       ---DDDNNPVTKHTTNPVIFISNNKDVKFNK-----------PGSLGNVAPTILDF-MGL
GPMI_MYCPU       ---DDKGNPQTKHTSNPVMLITSDKNLKLKD------------GKLANISPTILDY-LDI
GPMI_MYCS5       ---DENNKPVTKHTSSPVMLVTSDKSLKLKP------------GKLANIAPTVLDY-MGM
GPMI_MYCMO       ---DENGNPATKHTTSPVMLIVTDKNLKLNS------------GTLANIAPTILDY-LKI
GPMI_MYCHP       ---DENNKPATKHTTSPVMFICTDKNVNLGN------------GSLCDVAPTILDY-LKI
GPMI_MYCH7       ---DENGNPSTKHTTFPVMLISSDKTIKLKS------------GKLANIAPTILDY-LGL
GPMI_MYCHJ       ---DENGNPSTKHTTFPVMLISSDKTIKLKS------------GKLANIAPTILDY-LGL
GPMI_MYCH2       ---DENGNPSTKHTTFPVMLISSDKTIKLKS------------GKLANIAPTILDY-LGL
GPMI_UREP2       ---DDQKQVITSHSVNDVWFIITDNKVILNSTQ---------KFSLANIAPTILEY-LNI
GPMI_UREPA       ---DDQKQVITSHSVNDVWFIITDNKVILNSTQ---------KFSLANIAPTILEY-LNI
GPMI_MYCCT       ---DKDDQVNKKHTTSLVPIIITDKNIKLKQND---------P-AIAKVAPTILDL-MNI
                             *:                               : .: . ::      

GPMI_CLOAB       EKPEEMTGKSLFE-------------------
GPMI_CLONN       EVPKEMTGKSLFK-------------------
GPMI_CLOB1       PKPSEMTGNSLIK-------------------
GPMI_CLOBL       PKPSEMTGNSLIK-------------------
GPMI_CLOK5       EKPKEMTGKSLIK-------------------
GPMI_CLOPE       EVPSEMTGTCLLNK------------------
GPMI_CLOP1       EVPSEMTGTCLLNK------------------
GPMI_CLOPS       EVPSEMTGTCLLNK------------------
GPMI_CLOB8       EVPTEMTGENLIVNK-----------------
GPMI_CLOTE       KIPEEMTGRNLIEGK-----------------
GPMI_CLOD6       EKPEEMTGHSLISK------------------
GPMI_HUNT2       EKPKEMTGESLIVK------------------
GPMI_LACP7       EQPKEMTGKSLLIKK-----------------
GPMI_BACSU       EKPKEMTGTSLIQK------------------
GPMI_BACVZ       EKPKEMTGTSLIQK------------------
GPMI_BACP2       EKPKEMTGTSLIQK------------------
GPMI_BACLD       EKPKEMTGSSLIQK------------------
GPMI_GEOSE       PQPKEMTGKSLIVK------------------
GPMI_GEOKA       PQPKEMTGKSLIVK------------------
GPMI_GEOTN       PQPKEMTGKTLIVK------------------
GPMI_BACMQ       AQPKEMTGKTLIK-------------------
GPMI_BACAH       EQPKEMTGKTIIK-------------------
GPMI_BACC1       EQPKEMTGKTIIK-------------------
GPMI_BACCR       EQPKEMTGKTIIK-------------------
GPMI_BACHK       EQPKEMTGKTIIK-------------------
GPMI_BACCZ       EQPKEMTGKTIIK-------------------
GPMI_BACAN       EQPKEMTGKTIIK-------------------
GPMI_BACCN       EQPKEMTGKTIIK-------------------
GPMI_BACHD       KQPAEMTGKTLIK-------------------
GPMI_BACSK       DKPKEMTGKTLKQ-------------------
GPMI_OCEIH       EKPKEMTGNSLIKK------------------
GPMI_STAAS       EQPEDMTGESLIKH------------------
GPMI_STAAW       EQPEDMTGESLIKH------------------
GPMI_STAAC       EQPEDMTGESLIKH------------------
GPMI_STAAM       EQPEDMTGESLIKH------------------
GPMI_STAAN       EQPEDMTGESLIKH------------------
GPMI_STAAR       EQPEDMTGESLIKH------------------
GPMI_STAEQ       KQPSEMTGESLIKH------------------
GPMI_STAES       KQPSEMTGESLIKH------------------
GPMI_STAHJ       GQPSDMTGESLIKH------------------
GPMI_STAS1       DQPEDMTGESLINH------------------
GPMI_LISMF       KKPAEMTGESLIQK------------------
GPMI_LISMO       KKPAEMTGESLIQK------------------
GPMI_LISIN       KKPAEMTGESLIQK------------------
GPMI_LISW6       KKPAEMTGESLIQK------------------
GPMI2_METAC      PKPEEMKGKSLILNE-----------------
GPMI_METMA       PKPEKMTGRSLIVRK-----------------
GPMI1_METBF      RKPEEMTGESLIIK------------------
GPMI1_METAC      PKPQEMTGKSLLVKE-----------------
GPMI2_METBF      PKPQEMTGKSLLVKD-----------------
GPMI_METBU       EKPPEMTGVPLIKNT-----------------
GPMI_PSEF5       PKPAEMTGTSILVDPAH---------------
GPMI_PSEPF       EKPAEMTGTSILV-------------------
GPMI_PSEU2       EKPQEMTGHSILVAE-----------------
GPMI_PSE14       EKPQEMTGHSILVAK-----------------
GPMI_PSESM       EKPQEMTGHSILVEE-----------------
GPMI_PSEP1       EKPVEMTGTSILVDA-----------------
GPMI_PSEPK       EKPVEMTGTSILVDA-----------------
GPMI_PSEPG       EKPVEMTGTSILVDA-----------------
GPMI_PSEE4       EKPAEMTGTSILVDA-----------------
GPMI_PSEAB       EQPAEMTGRSIVTLG-----------------
GPMI_PSEAE       EQPAEMTGRSIVTLG-----------------
GPMI_PSEA7       EQPAEMTGRSIVILD-----------------
GPMI_PSEMY       PQPAEMTGKTIVELE-----------------
GPMI_ACIAD       PVPAEMQGRNLITLSS----------------
GPMI_SHEB5       AIPAEMTGKPLIHIKE----------------
GPMI_SHEB8       AIPAEMTGKPLIHIKE----------------
GPMI_SHEB9       AIPAEMTGKPLIHIKE----------------
GPMI_SHEPC       TIPAEMTGKPLIHIKE----------------
GPMI_SHESW       TIPAEMKGKPLIHIKE----------------
GPMI_SHESR       TIPAEMTGKPLIHVKE----------------
GPMI_SHESA       TIPAEMTGKPLIHVKE----------------
GPMI_SHESM       TIPAEMTGKPLIHVKE----------------
GPMI_SHEON       SIPAEMTGKPLIHVKE----------------
GPMI_SHEDO       PVPAEMTGRCIIDLKE----------------
GPMI_SHEHH       EVPAEMTGRSIIQLKE----------------
GPMI_SHEPA       DVPEEMTGRSIIKLKE----------------
GPMI_SHELP       TVPSEMTGHSIITLSE----------------
GPMI_SHESH       EVPSEMTGRSIIKLDE----------------
GPMI_ECOK1       EIPQEMTGKPLFIVE-----------------
GPMI_ECOL5       EIPQEMTGKPLFIVE-----------------
GPMI_ECOL6       EIPQEMTGKPLFIVE-----------------
GPMI_SHIBS       EIPQEMTGKPLFIVE-----------------
GPMI_ECO57       EIPQEMTGKPLFIVE-----------------
GPMI_ECO24       EIPQEMTGKPLFIVE-----------------
GPMI_ECOHS       EIPQEMTGKPLFIVE-----------------
GPMI_ECOLC       EIPQEMTGKPLFIVE-----------------
GPMI_SHISS       EIPQEMTGKPLFIVE-----------------
GPMI_ECOLI       EIPQEMTGKPLFIVE-----------------
GPMI_SHIFL       EIPQEMTGKPLFIVE-----------------
GPMI_SHIDS       EIPQEMTGKPLFIVE-----------------
GPMI_SALPA       EIPQEMTGKPLFIVE-----------------
GPMI_SALTY       EIPQEMTGKPLFIVE-----------------
GPMI_SALTI       EIPQEMTGKPLFIVE-----------------
GPMI_SALPB       EIPQEMTGKPLFIVE-----------------
GPMI_SALCH       EIPQEMTGKPLFIVE-----------------
GPMI_ENT38       EIPKEMTGKPLFIVE-----------------
GPMI_CROS8       EIPQEMTGKPLFIVE-----------------
GPMI_YERPA       EIPQEMTGKPLFIVE-----------------
GPMI_YERPP       EIPQEMTGKPLFIVE-----------------
GPMI_YERPN       EIPQEMTGKPLFIVE-----------------
GPMI_YERPE       EIPQEMTGKPLFIVE-----------------
GPMI_YERPS       EIPQEMTGKPLFIVE-----------------
GPMI_YERP3       EIPQEMTGKPLFIVE-----------------
GPMI_YERE8       EIPQEMTGKPLFIVE-----------------
GPMI_SERP5       EIPQEMTGKPLFIVE-----------------
GPMI_VIBC3       DIPADMSGQVLYS-------------------
GPMI_VIBCH       DIPADMSGQVLYS-------------------
GPMI_VIBPA       EIPAEMSGDVLVK-------------------
GPMI_VIBCB       EIPAEMSGEVLVK-------------------
GPMI_VIBVU       EIPAEMTGQVLVK-------------------
GPMI_VIBVY       EIPAEMTGQVLVK-------------------
GPMI_ALIF1       AIPAEMSGEVLFK-------------------
GPMI_PHOPR       EIPAEMTGQVLFDLK-----------------
GPMI_AERS4       PVPPEMTGKPLMILK-----------------
GPMI_PSYIN       EIPAEMTGTPLITLK-----------------
GPMI_PSEHT       EQPTEMTGKPIMTLK-----------------
GPMI_PSEA6       EQPAEMTGKPIVTLVK----------------
GPMI_COLP3       EQPQEMTGSVLMQLIK----------------
GPMI_IDILO       EQPDEMTGTSLMTLEQD---------------
GPMI_HAHCH       EKPREMTGESLIVQN-----------------
GPMI_SACD2       PQPTEMNGRNLVKFSK----------------
GPMI_CHRSD       PVPEEMTGRVLIGNT-----------------
GPMI_METFK       KQPPEMTGKSLVAFQAA---------------
GPMI_CHRVO       EQPAEMTGQSLIDFQ-----------------
GPMI_THIDA       PQPPEMSGESLLAFE-----------------
GPMI_COXBU       EKPREMTGRNLITLK-----------------
GPMI_COXBR       EKPREMTGRNLITLK-----------------
GPMI_COXBN       EKPREMTGRNLITLK-----------------
GPMI_VESOH       EKPDEMTGNSLLTFK-----------------
GPMI_RUTMC       EKPNEMTGNSLLTFK-----------------
GPMI_NITOC       KPPPEMSEHRLIELSSP---------------
GPMI_HYDCU       EKPEEMTGTSLIDKA-----------------
GPMI_FRATF       AQPKEMTGKTIFNFEK----------------
GPMI_FRATH       AQPKEMTGKTIFNFEK----------------
GPMI_FRATW       AQPKEMTGKTIFNFEK----------------
GPMI_FRAT1       AQPKEMTGKTIFNFEK----------------
GPMI_FRATT       AQPKEMTGKTIFNFEK----------------
GPMI_FRATN       AQPKEMTGKTIFNFEK----------------
GPMI_FRAP2       AQPQEMTGKTIFKFEK----------------
GPMI_LEGPH       TPPPEMTGRILLEKNHAHP-------------
GPMI_LEGPL       TPPPEMTGRILLEKNHAHA-------------
GPMI_LEGPA       TPPPEMTGRILLEKNHAHA-------------
GPMI_LEGPC       TPPPEMTGRILLEKNHAHV-------------
GPMI_GEOSL       PQPPEMTGKSLLVATE----------------
GPMI_PELCD       DKPAAMTGRSLLEPS-----------------
GPMI_SYMTH       PKPPQMDADSLLVSNAEGA-------------
GPMI_RHOS1       PQPEEMTGRSLIDA------------------
GPMI_RHOS4       PQPEEMTGRSLIDA------------------
GPMI_RHOS5       PQPEEMTGRSLIEA------------------
GPMI_DINSH       PQPVEMTGRSLIR-------------------
GPMI_PARDP       DLPPEMTGTSLIGRA-----------------
GPMI_ROSDO       ESPKEMTGKCLIS-------------------
GPMI_RUEPO       PKPPEMTGESLIT-------------------
GPMI_RUEST       DQPEEMTGESLLV-------------------
GPMI_AGRFC       PLPPEMTGKSLIDL------------------
GPMI_RHOPA       PQPAEMTGKSLIG-------------------
GPMI_GLUOX       KQPDAMTGVSLLESA-----------------
GPMI_MAGMM       PQPLEMDGVSLVQFTQPAVA------------
GPMI_LAWIP       SIPNEMTGNNLLSSE-----------------
GPMI_DESVH       PASAGMTGTSLITE------------------
GPMI_RHOBA       EVPPEMTGRPLMETQTA---------------
GPMI_SYNY3       PVPAEMTGKTLIDQPLVEIKANRTPVNLSR--
GPMI_MICAN       PVPVEMTGRSLIKPAEVEIKASRTPVRISL--
GPMI_NOSS1       PQPPEMTGRSLLQPAEYEVELSRTPIPVGLN-
GPMI_TRIV2       PQPPEMTGRSLLQPAEYDVQSPRTRIPVGLN-
GPMI_TRIEI       PQPAEMTGKSIIKKAEYELKPNRTPVRVGL--
GPMI_SYNE7       PQPVEMTGRSMIEPAAYEVKQGRTPVKVGV--
GPMI_SYNP6       PQPVEMTGRSMIEPAAYEVKQGRTPVKVGV--
GPMI_ACAM1       PKPEEMTGSTLIQAAGFEVRQNKSPVRIHR--
GPMI_SYNJA       PQPPEMTGQSLLQPAEYTI-LQRQPAPVGR--
GPMI_SYNJB       PQPPEMTGRSLLQPAEYTI-LQRQPSPVGR--
GPMI_THEEB       PQPLEMTGRSLIVSAPYEMRLNRTPVSLKI--
GPMI_GLOVI       PQPAEMTGRSLLGESEIEIRTPRSPLRVGL--
GPMI_PROM1       PKPKAMTGKTLIEPINLPKKP---NLIPQPAY
GPMI_PROMT       PKPKAMTGKTLIEPINLPKKP---NLIPQPAY
GPMI_PROM3       PKPDAMSGLTLIQAIESPTPS---ARLPQPV-
GPMI_PROMM       PKPDAMSGLSLIQAIDSPTPS---ARLPQPV-
GPMI_SYNPX       EQPAAMTGRSLIEPVSNVDPSPLSARLPLPV-
GPMI_PROMA       PKPDAMTGSSLIETIQTNSKT---NLVQQHV-
GPMI_PROMP       PIPKEMTGKSLIKEIELKGFN----KVVQHV-
GPMI_GRATL       NIPNEMNGISLLETKAKNKI------------
GPMI_ANTSP       NIPNEMNGKSLIT-------------------
GPMI_PORPU       KKPPEMTGKSLIINSKYETRNLDKTFIEL---
GPMI_PYRYE       KKPPEMTGKSLIINSRYETRNIEKTSIEL---
GPMI_NATPD       DIPETMTGESLLER------------------
GPMI_HALMA       DRPDAMTGTPLVE-------------------
GPMI_HALSA       DRPTVMTGASLLE-------------------
GPMI_HALWD       EQPAAMTGSSLIE-------------------
GPMI_STRCO       KPGPAMTGRPLL--------------------
GPMI_FLAJ1       QQPNAMTCHSLL--------------------
GPMI_FLAPJ       KKPEVMTRNSLL--------------------
GPMI_BACFR       VQPAEMTGCNLIK-------------------
GPMI_BACFN       VQPAEMTGCNLIK-------------------
GPMI_BACTN       EAPADMNGQILIK-------------------
GPMI_BACV8       PQPADMTGRDLIK-------------------
GPMI_PARD8       KQPKEMTGKSLIK-------------------
GPMI_HELPY       KAPATMDEPLF---------------------
GPMI_HELPH       KAPATMDEPLF---------------------
GPMI_HELPJ       KAPATMDEPLF---------------------
GPMI_HELAH       KAPATMDEPLF---------------------
GPMI_HELHP       PIPPEMDKPLF---------------------
GPMI_WOLSU       PTPKEMDSPLF---------------------
GPMI_ARCB4       EIPKEMDEPLI---------------------
GPMI_SULDN       EIPKEMDHSLV---------------------
GPMI_CAMJ8       EIPKEMNEALF---------------------
GPMI_CAMJR       EIPKEMNEALF---------------------
GPMI_CAMJJ       EIPKEMNEALF---------------------
GPMI_CAMJE       EIPKEMNEALF---------------------
GPMI_CAMJD       EIPKEMNEALF---------------------
GPMI_EHRRW       KQPEEMTGISLIDTSN----------------
GPMI_EHRRG       KQPEEMTGISLIDTSN----------------
GPMI_EHRCJ       AKPKEMTGVSLIEQV-----------------
GPMI_EHRCR       EKPKEMTGISLIEYI-----------------
GPMI_ANAPZ       PQPSDMTGCSLITRNS----------------
GPMI_ANAMM       AKPDEMTGSSLLTPE-----------------
GPMI_WOLPM       KKPNEMTGSSLISCITLCHSS-----------
GPMI_WOLTR       KKPDEMTGSSLIV-------------------
GPMI_ONYPE       KKPQEMTGNSLIKKLV----------------
GPMI_AYWBP       KKPQEMTGNSLIKKLV----------------
GPMI_ACHLI       EKPKAMTGTSLIEKI-----------------
GPMI_MYCGE       SKPKEMTAKSLLKNNN----------------
GPMI_MYCPN       KQPAEMTANSLLISKK----------------
GPMI_MYCGA       QIPEEMDQEPLI--------------------
GPMI_MYCPE       EIPADMDKKSLLKK------------------
GPMI_MYCPU       EKHEDMNEESLIIK------------------
GPMI_MYCS5       AKPKEMNENSLLDK------------------
GPMI_MYCMO       PKPKNMLDSLIMNNKRTSK-------------
GPMI_MYCHP       NKPKEMTGKSLLK-------------------
GPMI_MYCH7       DKHPDMDHDSLIIKDK----------------
GPMI_MYCHJ       DKHPDMDHDSLIIKDK----------------
GPMI_MYCH2       DKHPDMDHDSLIIKDK----------------
GPMI_UREP2       AQPIQMTATSMIKKICE---------------
GPMI_UREPA       AQPIQMTATSMIKKICE---------------
GPMI_MYCCT       EIPKEMELESMIDHN-----------------
                      *    .