CLUSTAL format seed alignment for MF_01039

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GPMA_BORT9        -------MYKLVLVRHGESEWNKENLFTGWTDVKLSEKGISEALEGGRVL-KQEGYS---
GPMA_COPPD        -------MYKVVMIRHGESEWNKLNLFTGWTDVDLSDRGVEEAIWAGKKL-KEEGYT---
GPMA_TERTT        -------MYKLVLIRHGESQWNLENRFTGWHDVDLTDTGREQARNGGRML-KEAGFE---
GPMA_TREPS        --------MKLVLIRHGESEWNRLNLFTGWTDVPLTPRGESEAQEGGRVL-QEAGFD---
GPMA_TREDE        --------MRLVLVRHGESEWNKLNLFTGWTDVDLSEKGVEEAKEGGTYL-KKEGFD---
GPMA_LACP7        --------MKLVLLRHGESEWNKENLFTGWMDVDLSETGKAEAASAGITL-KQKGYD---
GPMA_BDEBA        -------MYKLVLIRHGESVWNQENRFTGWQDVDLSEKGRAEALKGGKAL-REKGFS---
GPMA1_BACTN       -------MKRIVLLRHGESLWNKENRFTGWTDVDLSEKGVEEACKAGDAL-REAGFS---
GPMA_PORG3        -------MKRIVLIRHGESLWNKENRFTGWTDVDLSEKGIEEAKKAGELM-KKEGFQ---
GPMA_DICNV        -------MKKLVLVRHGQSQWNLENLFTGWTDVDLTEQGQKEAATAAQLL-QKEGIF---
GPMA_FUSNN        --------MKLVLIRHGESAWNLENRFTGWKDVDLSPKGMEEAKSAGKIL-KEMNLV---
GPMA_BURP1        -------MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLL-KEAGYT---
GPMA_POLAQ        -------MKQLVLIRHGESAWNLENRFTGWADVDLTPKGAEQALAAGEHL-RKAGYE---
GPMA_BORPD        -------MYKLVLMRHGESQWNLENRFTGWTDVDLTETGREQARKAGELL-KKEGYQ---
GPMA_AROAE        -------MYKIVLLRHGESTWNKDNRFTGWTDVDLTEKGVEEARGAGHLL-KREGYT---
GPMA2_NITEU       -------MKKLVLLRHGESIWNQENRFTGWTDVDLTPKGLKEAEEAGRLL-RENGFS---
GPMA2_NITMU       -------MKKLVLLRHGESTWNKENRFTGWTDVDLTPKGAEEAHNSGRLL-REAGFT---
GPMA_CHLPB        -------MIKLVLLRHGESQWNRENRFTGWYDIGLSEKGETESRAAGELL-KKEGFT---
GPMA_CHLT3        -------MIKLVLLRHGESVWNKENRFTGWKDVDLTEKGVQEAKRAGEFM-KKEGLD---
GPMA_SOLUE        -------MKKLVLIRHGESTWNKENRFTGWTDVDLSDEGRQQATEAAEVL-KREGYV---
GPMA_METHJ        -------MYTLVLIRHGESLWNRENRFTGWRDIDLSPQGIDEARAAGKAL-REQGFE---
GPMA_UNCTG        -------MYKVVLIRHGESVWNKENKFTGWSDVDLSEKGNEEALKAGKQL-KKDGFT---
GPMA_ECOLI        -----MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLL-KEEGYS---
GPMA_HAMD5        -----MTIKKLILVRHGESEWNKENRFTGWADVDLSEKGRVEAQQAGNLL-KKKGFS---
GPMA_BLOFL        -----MHIIKTVLIRHGESQWNKDNRFTGWIDVDLSNQGYSEAKRAGQLL-KKYKFI---
GPMA_BLOPB        -----MHITKLVLIRHGESQWNKENRFTGWVDVDLSEKGRSEAQCAGRIL-KKNGFF---
GPMA_WIGBR        -----MSIIKLVLMRHGSSIWNDQDRFTGWTDIDLSEKGKNEVKYAGKML-KSFGYS---
GPMA_BAUCH        -----MTLNKLVLIRHGESKWNNENRFTGWTDIDLSDQGRIEAKNAGQLL-KQAGFI---
GPMA_BUCAI        -----MKINQVVLIRHGQSEWNTLNKFTGWHDAELDKKGKDEAKFAAILL-KKEKFF---
GPMA_BUCAP        -----MKTNKLVLIRHGQSKWNKLNKFTGWHDIELSDNGINEALKAGSLL-KKEKFF---
GPMA_BUCBP        -----MKVYKLVLMRHGESIWNELNKFTGWHDVDLSNRGVQESLKAAKLL-KKHGFY---
GPMA_BUCCC        -----MKKKKIILMRHGESKWNKLNKFTGWQDIGLTKNGKKEAKLAAKLI-KKNNFI---
GPMA_BACCN        -------MIKLVLIRHGQSLWNLENRFTGWTDVDLSENGLHEARTAGAIL-KKNGYT---
GPMA_CLOB8        -------MIKLVLVRHGESLWNLENRFTGWTDVDLSENGLKEARRAGKIL-KKNGFV---
GPMA_CLOAB        -------MRKLVLLRHGQSEWNKENRFTGWTDVDLSVDGVSEAAQAGRIL-KKNNYT---
GPMA2_BACC1       -------MVKLVLIRHGQSEWNVENRFTGWTDVDLSSKGLEEAREAGVML-KASGFS---
GPMA_CALS4        -------MYKVVLLRHGESIWNMENRFTGWTDVDLSPKGIEEAKQAGKIL-KEKGFT---
GPMA_METI4        --------MKVVFLRHGESIWNRENRFTGWTDVDLSSRGIEEAENAARLL-KEEGFE---
GPMA_NITOC        ----------MILLRHGESVWNLENRFTGWTDVDLSANGVEEARLAGKIL-KNEGYQ---
GPMA_GEOSM        -------MHQLVLLRHGESVWNKENLFTGWTDVELSPSGEEESRKAGLLL-KEHGFV---
GPMA_METPE        -------MYTLVLLRHGESAWNKENRFTGWTDVDLSPQGIEEAHRAATLL-HDGGYS---
GPMA_DESVV        -------MARLILLRHGQSAWNLENRFTGWTDVDLSPAGEAEALAAARLI-RDEGLD---
GPMA_DESVM        -------MHTLVLLRHGQSAWNLENRFTGWTDVDLSPEGEQEARDAARLL-TDEGLT---
GPMA_DESAG        -------MYKLVLVRHGQSTWNLENRFTGWTDVDLTPLGETEAREGARLI-AAAGLT---
GPMA_DESMR        -------MHTLVLVRHGQSVWNLENRFTGWTDVGLTPQGREEAAQAANLL-RDGGYD---
GPMA_RHOCS        -------MTKLVLIRHGQSVWNQQDLFTGWTDVELTEQGVAEAKAAGEKL-LAAGYD---
GPMA_GEOSL        -------MRTLVLIRHGESVWNRENRFTGWTDVGLTDKGAAEALRAGRTL-KNEGFA---
GPMA_ALKEH        -------MKKLVLLRHGQSIWNQENRFTGWHDVDLTEKGREEAQAAGQLM-KRHGLR---
GPMA_HALHL        -------MPKLVLLRHGQSIWNLENRFTGWYDVDLSDQGINEAREAGVAL-REAGIA---
GPMA_MANSM        --------MELVFIRHGLSEWNALNLFTGWRDVNLSEKGVEEAKEAGRKL-KAAGFE---
GPMA_ENTFA        -------MPKLVFSRHGLSEWNALNQFTGWADVDLAPEGVEEAKEGGRKI-KEAGIE---
GPMA2_LACSS       -------MAKLVFIRHGQSEWNLSNQFTGWVDVNLSEEGVRQAQNAGALL-KKEGIL---
GPMA_STRP6        -------MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLI-KEAGIE---
GPMA_LISMF        --------MKLVLIRHGQSEWNKLNLFTGWHDVDLSQEGVVEAMTAGKRI-KEAGLE---
GPMA_STACT        -------MPTLILCRHGQSVWNAENLFTGWTDVDLSDQGVEEATTSGDRL-KQEGIE---
GPMA_CAUSK        -------MPVLVLLRHGQSQWNLENRFTGWVDVDLTAEGEAQARKGGELI-KAAGIN---
GPMA_HYPNA        -------MTKLALIRHGQSAWNLENRFTGWWDADLTAQGEAEARHSGKLL-AEVDAD---
GPMA_SPHWW        -------MPTLVLIRHGQSAWNLENRFTGWWDVNLTDQGIAEAKAAGELM-AAKGLD---
GPMA_ZYMMO        -------MPTLVLSRHGQSEWNLENRFTGWWDVNLTEQGVQEATAGGKAL-AEKGFE---
GPMA_ERYLH        -------MPTLILVRHGQSQWNLENRFTGWWDVDLTEKGVEEAKAAGTLL-KEKGVL---
GPMA_MARMM        -------MPQLALIRHGQSEWNLQNRFTGWVDVDLTDEGVAQARQSGELL-AKAGFE---
GPMA_XYLFT        ------MTRKLVLLRHGQSQWNSMNRFTGWVDIGLTEQGHQEATMAGHLM-KKEGLE---
GPMA_HYDS0        -------MYTLVLLRHGQSLWNLENKFTGWIDVDLSDQGKEEAKNAGKAM-LEAGIT---
GPMA_ARTS2        ------MTYKLILLRHGHSEWNAKNLFTGWVDVDLNDQGREEAARGGELL-VENNVL---
GPMA_NOCSJ        ------MTHTLILLRHGESEWNAKNLFTGWVDVNLTEKGRAEAVRGGELM-REAGVL---
GPMA_LEIXX        ----MSASHALILLRHGNSEWNRQNLFTGWVDVRLSEQGVAEAKRAGELL-AESGLV---
GPMA_BIFLS        ------MTYKLVLLRHGQSAWNKTNQFTGWVDVPLTEQGEAEAKRGGELL-KEKNVL---
GPMA_NOCFA        ------MTYTLVLLRHGESEWNALNLFTGWVDVHLTDKGVAEGKRAGELL-AEHGIL---
GPMA_CORJK        MSEQNNSHGNLILLRHGQSEWNASNQFTGWVDVRLTEKGRAEAVRGGEMI-KEAGLE---
GPMA_MYCLB        --MQQGNTATLILLRHGESDWNARNLFTGWVDVGLTDKGRAEAVRSGELL-AEHNLL---
GPMA_CUTAK        ------MTAKLILLRHGESEWNSKNLFTGWVDVDLNEKGEGEARHAADLL-KQENLL---
GPMA_THEFY        -------MSTLVLLRHGESVWNAEGLFTGWVDVDLSPKGEEEARRGGRLL-AEAGIR---
GPMA_FRAAA        -------MTTLVLLRHGESNWNRENLFTGWVDVDLSEKGLKEATRGGELL-AEAGVL---
GPMA_TROWT        -------MDNLVLLRHGNSLWNQENLFTGWVDVRLSELGEKEAKTAGQLL-REANRY---
GPMA_NAUPA        -------MAKLVLVRHGKSEWNKQNRFTGWVDVDLAPEGIEEAKKAGQKL-KEAGFC---
GPMA1_NITEU       -MNEIQEPIRLVLLRHGQSIWNQDRHFTGWGDIVLSPQGEQEALRAGHLL-KQAGFT---
GPMA1_NITMU       -------MTQLVLLRHGESVSNRDGCFTGWGDAPLTPRGEREAEQAGNLL-KKAGHK---
GPMA1_LACPL       -------MTELVLVRHGESTANRDNTYTGWSDVPLTAVGIAQAHQAGKRL-RATGLQ---
GPMA1_LACSS       -------MANLVIVRHGESVANQLKTYTGWSDVALTAKGRQQAHQVGRQI-KDAGFQ---
GPMA2_LACJO       ---MKRKLAKLVLVRHGESVANRDNVYTGWNDVPLSKKGIAQAKNAGLKVEKIAEFA---
PMG3_YEAST        --MTVTDTFKLFILRHGQSELNSENIFCGWIDAQLTEKGKSQARHSAKLIKQFCDSNNIS
GPMA_PELUB        -------MTHLILVRHGQSEWNLEKRFTGWVDVDLTGQGKLEACKAGEYI-KETKID---
GPMA_AGRVS        ------MTGTLVLVRHGQSDWNLKNLFTGWRDPDLTDLGVQEANAGGKALKDYG-----I
GPMA_CHESB        ------MSGTLILVRHGQSEWNLKNLFTGWRDPGLSELGHEEATSAGRKIKDRG-----L
GPMA_BARBK        ------MRRTLVLVRHGQSEWNIKNLFTGWKDPDLTEKGRTEAITAGKNLKKAG-----L
GPMA_XANP2        -----MSDRILVLVRHGQSEWNLKNLFTGWRDPDLTEQGVSEAKRAGALLKAEG-----L
GPMA_NITWN        -----MSERLLVLVRHGQSEWNLKNLFTGWKDPDLTELGAAEAKDAGRKLKAQG-----F
GPMA_METSB        ------MDRLLVLVRHGQSEWNLQNLFTGWKDPDLTDLGVSEAKAAGRALKTAG-----V
GPMA_METRJ        ------MERLLVLVRHGQSEWNLRNLFTGWRDPDLTERGVAEARAAGRGLKRDG-----Y
GPMA_PARL1        ------MPNLLVLVRHGQSEWNKKNLFTGWRDPGLTEQGMEEAREAGQAIKAKG-----L
GPMA_CHLPN        -------MALLILLRHGQSVWNEKNLFSGWVDIPLSQQGIEEAFSAGRAIQN-------L
GPMA_PARUW        -------MVKLILMRHGQSQWNLANLFTGWVDIPLSFKGIEEAIEAGKQIKN-------Y
GPMA_METAC        -------MSYLIIVRHGESGWNVDGRFGGWVDVPLTGKGIKEALLCAAELEG-------I
GPMA_METMA        ----MIITGHLILVRHGEPGLKPGERLSGWIDIPLSRKGIEEALECAKALEN-------I
GPMA_PSEA6        -------MSLLTLIRHGQSIWNQQNRFTGWVDVSLSQSGVKEAQRAAQMLSQ-------Q
GPMA_CYAP7        -------MSKLILIRHGQSLWNAANKFTGWVDIPLSRRGRAEAMIAASKLQEQG-----Y
GPMA1_GLOVI       -------MAHLILIRHGQSLWNAANKFTGWVDVPLSERGRAEATIASCKLRD-------Y
GPMA_METVS        -------MANLVFLRHGESIWNKMNIFTGWVDVPLSKGGVKEAKIAGKLLKS-------Y
GPMA2_GLOVI       -------MALLVMVRHGQSIWNLENRFTGWTDVPLTEKGRAEARACGELIYC-------V
GPMA_CYTH3        -------MPILVIVRHGQSEWNLKNLFTGWSDVELTPTGEHEAEYAGIVLRP-------Y
C5AXT5_METEA      ---MDSTTHTLVLVRHGQSEDNERELFSGLRDPALTARGVNEARAAGRRLKTLG-----Y
G8PLZ4_PSEUV      -------MGLLVLVRHGQSEWNARRVFSGQGNPDLTPKGIEEAKSAGRALKAHA-----I
GPMA_RHIEC        -------MSTLVIVRHGQSEGNARGEFTGTSDVPLTQEGWSESRRAGSLLANLG-----I
D3LL69_MICLU      ------MTGMLTLLRHGESTANEAGTFTGLLDVPLTHRGERQASAAGQLLRSNH-----I
                              : *** .  :      *  :  *   *  :    .  :          

GPMA_BORT9        -FDIAFSSVLVRANDTLNIILRELGQSY--------------------------------
GPMA_COPPD        -FDVAFTSVLKRAIKTLNLVLEQMNLDW--------------------------------
GPMA_TERTT        -FDLAYSSVLTRAIRTLNLVLEEMGQMW--------------------------------
GPMA_TREPS        -FDLCYTSFLKRAIRTLNFVLQALDREW--------------------------------
GPMA_TREDE        -FDICYTSYLKRAIHTLNYILSQMDREW--------------------------------
GPMA_LACP7        -FDVCYTSYLKRAIHTLNLALDEMDRVW--------------------------------
GPMA_BDEBA        -FDVAYTSVLKRAIKTLNFVLDEVDQVW--------------------------------
GPMA1_BACTN       -FEAAYTSYLKRAVKTLNCVLDRLDKDW--------------------------------
GPMA_PORG3        -FTKAYTSYLKRAVKTLNGVLDVMDLDW--------------------------------
GPMA_DICNV        -FQTAFTSYLKRAIKTLNIILDVMDLDW--------------------------------
GPMA_FUSNN        -FDVAYTSYLKRAIKTLNIVLEEMDELY--------------------------------
GPMA_BURP1        -FDIAYTSVLKRAIRTLWHVQDQMDLMY--------------------------------
GPMA_POLAQ        -FDVAYTSVLRRAIRTLWHVQDAMDLMW--------------------------------
GPMA_BORPD        -FDLAYTSVLKRAIRTLWIALDAMDAMY--------------------------------
GPMA_AROAE        -FDLAYTSVLKRANKTLNIVLEELDSLW--------------------------------
GPMA2_NITEU       -FDIAYTSLLKRAIRTLWIALDEMDQMW--------------------------------
GPMA2_NITMU       -FDIAYTSVLKRAIRTLWIVLDEMDQMW--------------------------------
GPMA_CHLPB        -FDVAFTSVLKRAIGTLWNVLEGMDLMW--------------------------------
GPMA_CHLT3        -FDIAYTSVLKRAIRTLNLALNEMDLQW--------------------------------
GPMA_SOLUE        -FDVAYTSVLKRAIRTLWTVLDGMDLMW--------------------------------
GPMA_METHJ        -FDLAYTSVLKRAIRTLWLIQEEMDLMW--------------------------------
GPMA_UNCTG        -FDLAYTSVLKRAIKTLWNVLNTMDLLW--------------------------------
GPMA_ECOLI        -FDFAYTSVLKRAIHTLWNVLDELDQAW--------------------------------
GPMA_HAMD5        -FDFAYTSVLRRATNTLSLILDVLQQQN--------------------------------
GPMA_BLOFL        -FDYGYTSVLKRTIHTLWVILDQLNQTW--------------------------------
GPMA_BLOPB        -FNYGYTSVLKRAIHTLWIILDQLDQAW--------------------------------
GPMA_WIGBR        -FNFAYTSLLKRAIHSLWVILKEINQSW--------------------------------
GPMA_BAUCH        -FDFAYTSVLKRAIHTLWYILDELDQAW--------------------------------
GPMA_BUCAI        -FDCAHTSLLKRAIHTLQYILDELNQTW--------------------------------
GPMA_BUCAP        -FDYAHTSMLKRAIHTLRYILDTLDQSW--------------------------------
GPMA_BUCBP        -FDYAYSSVLKRSIHTLWNIIKFLDQSW--------------------------------
GPMA_BUCCC        -FDIAYTSILKRAIYTLWIILKKTNQIW--------------------------------
GPMA_BACCN        -FDVAYTSVLKRAIRTLWIILHEMDLAW--------------------------------
GPMA_CLOB8        -FDVAYTSVLKRAIRTLWIILYEMDLAW--------------------------------
GPMA_CLOAB        -FDAAYTSVLKRAIRTLQIVLYEMDLLW--------------------------------
GPMA2_BACC1       -FDIAYTSVLRRAMRTLWITLEEMDLMW--------------------------------
GPMA_CALS4        -FDAAFTSVLKRAIRTLWIVLDELDLMW--------------------------------
GPMA_METI4        -FDVAFCSVLKRAIRTLWIVLDKMDRMW--------------------------------
GPMA_NITOC        -FDKAYTSVLKRAIRTLWIVEEMMDLVW--------------------------------
GPMA_GEOSM        -FDMAFTSLLKRAIKTLWIVLEQMDLMW--------------------------------
GPMA_METPE        -FDLAYTSVLKRAIRTLWIVLDDLDLMY--------------------------------
GPMA_DESVV        -FSVCHTSMLTRAIRTLHLVQHELDRLW--------------------------------
GPMA_DESVM        -FDVCHTSVLTRAIRTLYIVQHEMGLSW--------------------------------
GPMA_DESAG        -FDECHTSVLKRAIRTLNIIQEELDLLW--------------------------------
GPMA_DESMR        -FDACLTSVLSRAVMTLDILLTGLDRLW--------------------------------
GPMA_RHOCS        -FDACHTSVLKRAIKTLNLVLETMDRLW--------------------------------
GPMA_GEOSL        -FDEAFTSVLKRAIKTLWIVLEEMDQMW--------------------------------
GPMA_ALKEH        -FDYAYTSVLKRAIRTLWIGLDELDQMW--------------------------------
GPMA_HALHL        -PQVAYTSVLKRAIRTLWLSLAELDRMW--------------------------------
GPMA_MANSM        -FDIAFTSVLTRAIKTCNLVLEESNQLW--------------------------------
GPMA_ENTFA        -FDVAYTSVLTRAIKTCNYLLEYSDQLW--------------------------------
GPMA2_LACSS       -FDQAYTSVLTRAIKTLHYALEGSDQLW--------------------------------
GPMA_STRP6        -FDLAFTSVLTRAIKTTNLALENAGQLW--------------------------------
GPMA_LISMF        -FDVAFTSVLTRAIKTLNYVLEESDQMW--------------------------------
GPMA_STACT        -IDVAFTSVLQRAIKTTYHLLERSNQLF--------------------------------
GPMA_CAUSK        -LDEAFTSVQTRAIRTGNLALDAAGQSF--------------------------------
GPMA_HYPNA        -FRAGFTSVQTRAIRTMWLALTEMKRVW--------------------------------
GPMA_SPHWW        -FDQCYTSFQTRAIKTLNIALEAMGRLW--------------------------------
GPMA_ZYMMO        -FDIAFTSVLTRAIKTTNLILEAGKTLW--------------------------------
GPMA_ERYLH        -PTVAFTSFQTRAIKTLHLALEEADRLW--------------------------------
GPMA_MARMM        -PTHAFVSVLKRAIKTLNFTLEGLDRLW--------------------------------
GPMA_XYLFT        -FDVAHTSLLKRAIHTLQDALKALDQDW--------------------------------
GPMA_HYDS0        -PKAAFTSYLRRAINTLNIALDTMNLHY--------------------------------
GPMA_ARTS2        -PDVLYTSLLKRAINTANIALDKADRGW--------------------------------
GPMA_NOCSJ        -PDVVHTSVQRRAINTACLALDAADRHW--------------------------------
GPMA_LEIXX        -PDILYTSLLTRAIQTANHALDAADRLW--------------------------------
GPMA_BIFLS        -PDIVFTSLLRRAINTANIALDAADRLW--------------------------------
GPMA_NOCFA        -PDIVYTSLLRRAISTANIALDAADRHW--------------------------------
GPMA_CORJK        -PTILYTSLLRRAITTANIALDAADRHW--------------------------------
GPMA_MYCLB        -PDVLYTSLLRRAITTAHLALDTADWLW--------------------------------
GPMA_CUTAK        -PDIVHTSLLRRAIHTAYLALDGCDRHW--------------------------------
GPMA_THEFY        -PDVVHTSLLKRAIRTANIALEEAGLHW--------------------------------
GPMA_FRAAA        -PDVVHTSLLTRAIRTAWLALDAAGRTW--------------------------------
GPMA_TROWT        -PDVLFTSLLTRSIQTAHIALMEIDRVW--------------------------------
GPMA_NAUPA        -FDICFSSYLKRAIKTGIIILEELDLLF--------------------------------
GPMA1_NITEU       -FDACFCSELQRASDTLAIVQSVMGLNH--------------------------------
GPMA1_NITMU       -FDICFTSELSRANDTLRIVLSVMGQDE--------------------------------
GPMA1_LACPL       -FGAVHTSVLKRAIVTANIMLSEIDQLW--------------------------------
GPMA1_LACSS       -FSHVHTSLLKRAILTSYIVLEELDQLA--------------------------------
GPMA2_LACJO       -PTHIHTSVLSRAIMTANIIADVCSFLY--------------------------------
PMG3_YEAST        LPQIGYTSRLIRTQQTMDVILEELGLKHTNYVITTNTNIKEELQDTRFEGS---------
GPMA_PELUB        -IDYFYSSFQLRAINTLKFIQDTLRDKR--------------------------------
GPMA_AGRVS        QFDIAFTSDLSRAQKTCGIILDNLGQ----------------------------------
GPMA_CHESB        RPDIAFTSVLSRAKVTNTHILEVLGL----------------------------------
GPMA_BARBK        KFDIAYTSALQRAQKTAQHILEQMAQ----------------------------------
GPMA_XANP2        KFDVAFTSDLTRAQKTLGLILGEMGQ----------------------------------
GPMA_NITWN        VFDIAFTSTLIRAQHTLDLVLKELDQ----------------------------------
GPMA_METSB        GFDIGFTSDLLRAQRTMKLLLAEFGQ----------------------------------
GPMA_METRJ        GFDVAFTSALIRAQRTCALVLEEMGL----------------------------------
GPMA_PARL1        VFDVAYTSALSRAQETNRIVLEELGQ----------------------------------
GPMA_CHLPN        PIDCIFTSTLVRSLMTALLAMTNHHS---KKIPYIVHE-DPKAKEMSR------------
GPMA_PARUW        PIDLIFTSSLIRAQMTAMLAMSVHTS---GKVPVILHTGEGRLEEWAS------------
GPMA_METAC        DLDVTFTSKLIRAQETLFLILSKQKK---IGVFVHEEAGTGEDRTEREDGSRKDRKEKRY
GPMA_METMA        EIDIAFASDLVRTQETLFIILSGQKK---TGVVVHEKT---EDKVPPE-------KLDWY
GPMA_PSEA6        RFDLAFTSELLRAQDTLYEILRHNRQ---CHQYVRIHDTGSQWYEHFE------------
GPMA_CYAP7        RIDVCFTSLLIRAMETAIIALTEYEQLCGGKTPIFKHDADDLDWHGWD------------
GPMA1_GLOVI       RVNVCFTSMLMRAIETAVITLTECDDICGGKIPIIKHEADDENWHGWD------------
GPMA_METVS        KFDVAYSSELIRALNTLILVMQENKA----SNFIKINHDSVKMKEWGK------------
GPMA2_GLOVI       PFAVAFTSKLTRAQDTLRLILEAADQ--------------------PD------------
GPMA_CYTH3        HFDIAFTSVLKRAIHTLSIILNQTGA----------------------------------
C5AXT5_METEA      RFDHAFTSRLQRAQHTLALILEELS-----------------------------------
G8PLZ4_PSEUV      QFDLAYSSALTRARKTLEHILEEAE-----------------------------------
GPMA_RHIEC        SFDIAFSSALLRTVDTCRAILNETN-----------------------------------
D3LL69_MICLU      TPDVVVTSTLRRAVRTAELVCDAL------------------------------------
                         *   *:  :                                            

GPMA_BORT9        ----------IDVEKSWRLNERHYGALQGLNKAETAEKYGEDKVLMWRRSYDIPPMPLEE
GPMA_COPPD        ----------IPVYKHWRLNERHYGALQGLNKAEMTERYGEQQVLLWRRSYDVPPPPLEK
GPMA_TERTT        ----------LPVERHWRLNERHYGALTGLDKAETAAKHGDEQVKIWRRSFDVPPPDVDE
GPMA_TREPS        ----------LPVHKSWKLNERHYGDLQGLNKTETAQKYGEQQVRVWRRSFDVAPPPLTV
GPMA_TREDE        ----------LPVIKTWKLNERHYGGLQGLNKAETAEKYGEDQVKIWRRSFDIAPPVLEE
GPMA_LACP7        ----------LPVVKSWKLNERHYGTLQGLNKSETAERYGEEQVKIWRRSYDIAPPLLKE
GPMA_BDEBA        ----------LPVHKDWRLNERHYGALQGLNKAETAARHGEEQVKIWRRSYDTPPPPMEV
GPMA1_BACTN       ----------IPVEKTWRLNEKHYGMLQGLNKSETAVQYGEEQVHIWRRSYDVAPAPVGK
GPMA_PORG3        ----------IPVEKTWRLNEKHYGMLQGLNKAETAEKYGDEQVLIWRRSYDVPPTPMEK
GPMA_DICNV        ----------IDVHKTWRLNEKHYGALQGLNKKETAAQYGQEQVLLWRRSFDTAPAALEY
GPMA_FUSNN        ----------IPVYKSWRLNERHYGALQGLNKAETAKKYGDEQVHIWRRSFDVAPPSIDK
GPMA_BURP1        ----------VPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTPPPALEP
GPMA_POLAQ        ----------LPVVHSWRLNERHYGALTGLNKAETAAQYGDEQVHIWRRSYDIRPPLLEA
GPMA_BORPD        ----------TPVGISWRLNERHYGNLQGLNKAETAAKYGDEQVLIWRRAYAIAPEPLPL
GPMA_AROAE        ----------LPVEHSWRLNERHYGDLQGLNKAETAAKFGDDQVLVWRRSYDTPPPPLPE
GPMA2_NITEU       ----------TPIELNWRLNERHYGALQGLNKAETAKQYGDEQVLVWRRSYDIRPPSITI
GPMA2_NITMU       ----------IPVESSWRLNERHYGALQGLNKLETAVAYGEEQVLIWRRSYDIRPPALTP
GPMA_CHLPB        ----------IPVFKNWRLNERHYGALQGMNKAETAQQHGDEQVLVWRRSYDTPPPPLEK
GPMA_CHLT3        ----------IPVNKTWRLNERHYGALQGLNKSETAEKFGEEQVLIWRRSYDTPPPALEK
GPMA_SOLUE        ----------IPVHRSWRLNERHYGALQGLNKAETAAKFGEDQVKIWRRSYDIPPPVLTA
GPMA_METHJ        ----------IPVIRTWRLNERHYGALTGLNKIETVEKYGEQQVHIWRRSYDIPPPAYTP
GPMA_UNCTG        ----------TPVVKDWRLNERHYGALQGLNKAETAAKYGEEQVKIWRRSYDIAPMALDE
GPMA_ECOLI        ----------LPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFAVTPPELTK
GPMA_HAMD5        ----------LPIEKSWRLNERHYGALQGLNKSETAAKFGSEQVKQWRRGFSTLPPALNL
GPMA_BLOFL        ----------LPIQKVWQLNERHYGALQGLNKNEAIKTYGYDTIQKWRRSFKDIPPKNNK
GPMA_BLOPB        ----------LPIEKSWRLNERHYGALQGLNKDEAIKEYGYKTIQKWRRSFNVIPPNICG
GPMA_WIGBR        ----------IPVEKSWRLNERHYGALQGFSKYEIEKKYGKNQLNEWRRGFSISPPKINE
GPMA_BAUCH        ----------LPVEKSWRLNERHYGALQGLNKKKITVEYGEEQVQQWRRSLNITPPELSD
GPMA_BUCAI        ----------LSVKKSWRLNERHYGALEGLNKDEVIEKYGQKQVLLWRRSFDISPPQINI
GPMA_BUCAP        ----------LPVQKSWRLNERHYGALEGLNKDEMISKYGEEQVNLWRRSFEIIPPQIRL
GPMA_BUCBP        ----------IPVKKSWRLNERHYGALEGLNKDDVIQKYGNDKVQQWRRSFNIAPPKISY
GPMA_BUCCC        ----------IPVYKSWKLNERNYGALEGLNKEKIKKKYGDEQVQLWRRSFTVCPPNLNI
GPMA_BACCN        ----------VPVHKSWKLNERHYGALQGLNKDETAKKYGEEQVHIWRRSTNVRPPALAE
GPMA_CLOB8        ----------IPVFKSWRLNERHYGALQGLNKAETAKKYGEEQVHKWRRFVNVKPPELTK
GPMA_CLOAB        ----------IPVYKSWKLNERHYGALQGLNKDETRDKYGEDQVHLWRRSVEVRPPALEK
GPMA2_BACC1       ----------IPVYKTWKLNERHYGALQGLNKEETARKYGDEQVTLWRRSTNVRPPALTK
GPMA_CALS4        ----------IPVYKSWRLNERHYGALQGLNKAETAKKYGEEQVKLWRRSAEVRPPALTK
GPMA_METI4        ----------IPVEKSWRLNERHYGALQGLNKSEMAKKYGEEQVLLWRRSYDIVPPRLEN
GPMA_NITOC        ----------LPVEKRWELNERHYGNLQGLNKAEMAKQYGAELVHQWRRGYGIEPPPLDN
GPMA_GEOSM        ----------IPERKEWRLNERHYGALQGLNKAQTAEQYGDEQVKLWRRSYKVRPPALAE
GPMA_METPE        ----------LPVHHTWRLNERHYGALQGLDKRETTEKFGKDQVQAWRRGYAVRPPALEE
GPMA_DESVV        ----------TPVRKHWRLNERHYGALQGLDKRETAARHGEDQVFVWRRSYDVPPPVIAP
GPMA_DESVM        ----------LPVHKHWRLNERHYGGLQGLDKAETAARFGEEQVFEWRRSYDTPPPPLPA
GPMA_DESAG        ----------LPVHRHWRLNERHYGALQGLNKKEMSEKYGEEQVFIWRRSFDTPPPALTA
GPMA_DESMR        ----------LPVTKSWRLNERHYGGLQGLNKAEMAAQYGEEQVFVWRRSYDTPPPALDP
GPMA_RHOCS        ----------LPVQKDWRLNERHYGGLQGLNKTQTAAQHGKEQVHIWRRSYDIPPPPLPE
GPMA_GEOSL        ----------IPEHRHWRLNERHYGALQGLNKAETAERHGMEQVHVWRRSYDIPPPPLAA
GPMA_ALKEH        ----------IPVTKAWQLNERHYGALTGLNKAETAEEYGAEQVHIWRRSYDTPPPPLDE
GPMA_HALHL        ----------IPEIKDWRLNERHYGALTGLNKAETAEQYGDEQVHIWRRSYDTPPPALDA
GPMA_MANSM        ----------VPQIKTWRLNERHYGGLQGLNKAEAAAEHGDEQVRIWRRSYDVLPPVLDP
GPMA_ENTFA        ----------VPQIKSWRLNERHYGKLQGLNKKETAEKYGDEQVHIWRRSYDTLPPLMEA
GPMA2_LACSS       ----------IPETKSWRLNERHYGALQGQNKAEAAEKWGDEQVHIWRRSYDTLPPLLDA
GPMA_STRP6        ----------VPTEKSWRLNERHYGALTGKNKAEAAEQFGDEQVHIWRRSYDVLPPAMAK
GPMA_LISMF        ----------VPVHKSWRLNERHYGALQGLNKQETAEKYGADQVQKWRRSYDTLPPLLEE
GPMA_STACT        ----------VPLYKSWRLNERHYGGLQGLNKDAAREEFGEEQVHIWRRSYDIAPPDATA
GPMA_CAUSK        ----------VPVTKDWRLNERHYGGLTGLNKAETAQKHGEEQVTIWRRSYDIPPPPLAP
GPMA_HYPNA        ----------LPIEKDWHLNERHYGGLTGLNKAETAAKHGEDQVHVWRRSYDIPPPPLEV
GPMA_SPHWW        ----------LPVEKDWRLNERHYGGLTGLNKAETAARHGDAQVKVWRRSFDIPPPVLEP
GPMA_ZYMMO        ----------VPTEKDWRLNERHYGGLTGLNKAETAAKHGEEQVHIWRRSYDVPPPPMEK
GPMA_ERYLH        ----------IPETKDWRLNERHYGGLTGLDKQEMRDKHGDEQVHIWRRSFDVPPPDMEP
GPMA_MARMM        ----------IPVDKSWRLNERHYGALAGLDKNETRAKHGDEQVKIWRRSFDTPPPPVAT
GPMA_XYLFT        ----------LPIYKSWRLNERHYGALQGLDKIDTAAKHGEEQVNIWRRSYDIQPPPIDL
GPMA_HYDS0        ----------IDVFKSWRLNERHYGALQGLNKKEMVKIHGEEQVNIWRRNYDVPPPPLPK
GPMA_ARTS2        ----------IPVKRDWRLNERHYGALQGKDKAQTLAEYGEEQFMEWRRSYDTPPPPLDD
GPMA_NOCSJ        ----------IPVRRSWRLNERHYGALQGKNKKETLEAYGEEQFMLWRRSFDVPPPPIEE
GPMA_LEIXX        ----------IPVVRSWRLNERHYGALQGLDKAETLEKYGPEQFQLWRRSFDVPPPPLAD
GPMA_BIFLS        ----------IPVQRDWRLNERHYGALQGKNKTEIREEYGDEKFMLWRRSYATPPPEIDP
GPMA_NOCFA        ----------IPVVRDWRLNERHYGELQGKNKAQIRDKYGEEQFMLWRRSYDTPPPPIEA
GPMA_CORJK        ----------IPVVRDWRLNERHYGALQGLNKAETKDKYGEEQFMAWRRSYDTPPPAIDA
GPMA_MYCLB        ----------IPVRRSWRLNERHYGALQGLDKAVTKARYGEERFMAWRRSYDTPPPPIEK
GPMA_CUTAK        ----------IPVHRSWRLNERHYGALQGLNKAETKEKYGNDQFMAWRRSYDVRPPDLDR
GPMA_THEFY        ----------IPVKRSWRLNERHYGALQGKNKAQTRAEFGDEQFMIWRRSYDTPPPPLAE
GPMA_FRAAA        ----------VPVRRSWRLNERHYGGLQGLNKAETLEKFGEEQFQLWRRSYDTPPPEIG-
GPMA_TROWT        ----------LPTFRSWRLNERHYGSLQGKNKAQVLEEFGEEQFNSWRRGYDTPPPPLH-
GPMA_NAUPA        ----------IDHLKDWRFNERHYGALTGLNKDEVKAEVGEEKFLLYRRSYDVPPPPLSE
GPMA1_NITEU       ----------LSTYRTWRLNERHYGALEGMRPWAAIRKFGIWSTMKSQIRFDAAPPLLMP
GPMA1_NITMU       ----------PVVQRNWRLNERHYGALEGINRWKAIRKYGFCPILSSQCRFDAPPPPLDP
GPMA1_LACPL       ----------LPEYKTWRLNERHYGALRGQNKDVTRQEYGKAQVQQWRRSFYTVPPLLTP
GPMA1_LACSS       ----------LPMTKSWRLNERHYGALRGLNKDTTRTIFGVHQVARWRRSYTALPPLLIR
GPMA2_LACJO       ----------LPITKTWRLNERHYGALRGINKDVSKKIFGTNQVLEWRRGFDSVPPLLTQ
PMG3_YEAST        ----------MPVLQTWRLNERHYGAWQGQRKPDILKEYGKEKYMYIRRDYNGKPPKVNL
GPMA_PELUB        -----------EPVKAWQLNERHYGALTGLNKDEMKEKLGEDKIHAFRRSWDIKPDPLNR
GPMA_AGRVS        --------SGLETIRDQALNERDYGDLSGLNKDDARAKWGEEQVHIWRRSYDIPPP----
GPMA_CHESB        --------PALETIEDVALNERDYGDLSGLNKDDARKKWGEEQVHIWRRSYDIPPP----
GPMA_BARBK        --------PDLQLIKNSALNERDYGDLSGLNKDDARQRWGQEQVHIWRRSYTIAPP----
GPMA_XANP2        --------EGVPTTRNVALNERDYGDLAGLNKDDARAKWGDDQVHIWRRSYDIAPP----
GPMA_NITWN        --------TGIPVRKDQALNERDYGDLSGLNKDEARKKWGDEQVLVWRRSYDVPPP----
GPMA_METSB        --------PDLQVTKNVSLNERDYGDLSGLNKAEAAQQWGDEQVHLWRRSYDVPPP----
GPMA_METRJ        --------SEIPILRERALNERDYGDLSGLNKDEARARWGDAQVHAWRRGYDVRPP----
GPMA_PARL1        --------GDIEIIENEALNERDYGDLSGLNKDDAREKWGEEQVHIWRRSYDIPPP----
GPMA_CHLPN        IYSAEEENNMIPLYQSSALNERMYGELQGKNKKQTAEQFGEERVKLWRRSYKTAPP----
GPMA_PARUW        IYSSESQSQTIPVIRAWELNERMYGELQGINKEEMAKKYGAEQVHIWRRSFDVPPP----
GPMA_METAC        AYPPNTEKNLIPIHSNEALNERYYGILQGKKKDKMKAKYGEEQILHWCRSFDEGPP----
GPMA_METMA        SYPEKLGEDLIPVYTTPALNERYYGKLQGRKKQKMEEKYGAEQVANWRWNFEPGPP----
GPMA_PSEA6        --ASPAEELELRIYVSQQLNERYYGDLQGLNKDKARQLFGDEQVHTWRRSYNVAPP----
GPMA_CYAP7        KYDGDPKE-ELPIFPSQALDERYYGDLQGLNKAQTAQKYGSEQVHEWRRSYFTRPP----
GPMA1_GLOVI       NYDGDPAA-ELPIYPTATLDERYYGDLQGLDKAETTAKYGKEQVQIWRRSYSVRPP----
GPMA_METVS        -VYGAESINYTPVYKSWELNERYYGKLQGLNKERAKEIYGKDDVFLWRRSYETAPP----
GPMA2_GLOVI       ----------VPVIEDQALNERHYGELQGLNKAETAAKYGEETVRQWRRSLEGRPP----
GPMA_CYTH3        ---------TIPIIENEALNERNYGDLQGLNKAEVGEKYGAQQLIAWRRSYTEVPP----
C5AXT5_METEA      -------QTDLPVHADAALNDRDYGALAGLNKTEARARFGVKQVRSWRKSSDAVPP----
G8PLZ4_PSEUV      -------QSHLHVIEDKLFNERAYGELTGKTIEEVCQQHGVEQVYQWRHSLNAVPP----
GPMA_RHIEC        -------GDLLEPIRRTELNERDYGQLTGINKNVARERWGQDVVQVWRRSYSTPPP----
D3LL69_MICLU      -------GTQLPTEAVWQLNERNYGALTGMTKTDARRMLGDDEYVRLRRSRTGTPPPMSL
                                    :::: **   *          *              *     

GPMA_BORT9        -------------SDKRHPIHDLRYRGIPKSE------LPSTECLKDTVARVIPYWTDKI
GPMA_COPPD        -------------TDPRWPGNDPRYALVPEDE------LPLCESLKDTEARVVPYWADMI
GPMA_TERTT        -------------SSEHFPAHDPRYRGIDKNV------LPKAESLKLTIDRVLPYWHDVI
GPMA_TREPS        -------------GDARCPHTQASYRGVCASGR--TPVLPFTESLKDTVARVVPYFEEEI
GPMA_TREDE        -------------GDKRCPYLQEQYRGIEKSE------LPLTESLKDTIARAVPFFEKTI
GPMA_LACP7        -------------EDERNPRFQEQYRQEKCEI------LPLGESLKDTIARVVPYYNEVI
GPMA_BDEBA        -------------SDPRHPSHDPRYKNVDAQL------LPSNESLKDTVARFLPLWDGTI
GPMA1_BACTN       -------------DDPRNPGMDIRYAGVPDSE------LPRTESLKDTIGRVMPYWKCII
GPMA_PORG3        -------------EDPRSPFMDPRYKGVCEKD------LPLTEALCDTVNRILPYWNETI
GPMA_DICNV        -------------SDARAPHNDRRYQRVARQD------LPLTESLKDTIARIMPYWEVVI
GPMA_FUSNN        -------------NSEYYPKSDRRYADLADSD------IPLGESLKDTIARVLPYWHSDI
GPMA_BURP1        -------------GDERAPYADPRYAKVPREQ------LPLTECLKDTVARVLPLWNESI
GPMA_POLAQ        -------------DDERNPKNDSRYAKLNESD------IPLGECLKDNVERVLPLWNESI
GPMA_BORPD        -------------DDERHPRFDSRYAKIPADQ------LPATECLQDTVARVLPYWNDSI
GPMA_AROAE        -------------GDERLTSGDPRYASLPRAQ------FPRTECLKDTVARFVPYWETVI
GPMA2_NITEU       -------------NDERYPGFDLRYRNMSSGD------IPLAESLKDTVARFLPYWNQSI
GPMA2_NITMU       -------------DDPRYPGCDPRYRNLPKQD------IPLTECLQDTVSRFLPYWRESI
GPMA_CHLPB        -------------NDPRFPGNDPRYATLAPEE------VPVTECLKDTVDRFLPLWNDEI
GPMA_CHLT3        -------------SDERYPGHDPRYKDLTEAE------LPLTECLKDTVERFLPYWHETI
GPMA_SOLUE        -------------DDPRFPGHDPRYQSLTKEE------LPLTECLKDTVARFLPLWHDTI
GPMA_METHJ        -------------DNLDNPSYHRRYQEIKRSD------LPMTECLKDTVARFIPYWNDEI
GPMA_UNCTG        -------------NDERYPGKEARYSGLLKGE------IPLAECLKDTVARVVPYWGKEV
GPMA_ECOLI        -------------DDERYPGHDPRYAKLSEKEL------PLTESLALTIDRVIPYWNETI
GPMA_HAMD5        -------------NDPRAPANDSLYATLNKNDL------PLTESLATTVDRVVPYWDEVV
GPMA_BLOFL        -------------NDLFLGTNDIRYKNIETNTL------PNGESLELTANRVIPYWQKYI
GPMA_BLOPB        G------------NNQFIATNDNRYANISTDEL------PSSESLELTLKRVIPYWNQSI
GPMA_WIGBR        -------------KDNYFILNDKRYLNLKTKKL--L---PFSESLKSTIDRIMPYWDGNI
GPMA_BAUCH        -------------NDKRLPIYDIRYAKLSLDQL------PKAESLAMTINRIIPYWKGEI
GPMA_BUCAI        -------------KDKRFPGNDPRYSHLNIHDI------PLGESLEKTAKRVIPYWNKIV
GPMA_BUCAP        -------------NDKRFPGNDIRYSNIDNNEL------PLGESLELTAKRVIPYWNKFI
GPMA_BUCBP        -------------LEKKKLAHDSRYNNINFDIL------PYCESLKLTTQRVLPYWLNEI
GPMA_BUCCC        -------------SNKYHPIYDIKYKKLKKHEL------PTSESLEMTFNRVIPFWEFKI
GPMA_BACCN        -------------DDPRYEVTDPRYKRLKKGEF------PLTECLEDTEKRVLEFWHKEI
GPMA_CLOB8        -------------EDTRYPGNEYKYKDLNEEQI------PLTENLADTERRVLEEWRGNI
GPMA_CLOAB        -------------SDKRYPGNEKKYASLKEEEL------PVTENLEDTEKRVLQDWRELI
GPMA2_BACC1       -------------DDERYEAAHPKYRDIKDYEF------PLTEDLEDTEKRVVSYWNEEI
GPMA_CALS4        -------------DDPRYPGNDPRYADLSEDEI------PLTENLIDTINRVIPYWESTI
GPMA_METI4        -------------DDPRHPRFDPRYRSLPADEL------PAAESLKDTLERTVPYWKERI
GPMA_NITOC        -------------SDPRHPRFDRRYAGLAPEAL------PASESLKKTLKRVIPCWKQHI
GPMA_GEOSM        -------------GDRRHPSFDPRYHSLQGEL------LPSTECLQDTVERVLPFWRQQA
GPMA_METPE        -------------TDPRHPRFDPRYAGLKKDD------LPATESLEDTLARVVPYWNETI
GPMA_DESVV        -------------DDPKHPVHDPRYADVPPDV------LPCGESLEATVARVLPYWYDAI
GPMA_DESVM        -------------DDPRSPAGDARYAGLAPDV------LPASESLKETVARVLPYWHDVI
GPMA_DESAG        -------------DDPRHPAHDRRYASLTARQ------MPLCESLKDTVARVLPYWHETL
GPMA_DESMR        -------------ADERFPGRDRRYATLTDAE------LPRCESLKDTVARVMPFWHDVM
GPMA_RHOCS        -------------GDERLPDGDRRYKGLSKEQ------LPRTESLKDCVARVLPYWHESI
GPMA_GEOSL        -------------GDPRNPARDPRYAELDPAD------IPLTESLKDTVARFLPYWHETI
GPMA_ALKEH        -------------TSPYHPRHDPRYASLKPEQ------LPATESLALTLERVLPYWNERI
GPMA_HALHL        -------------EDERHPRHDPRYAGLDPQQ------LPGTESLKLTLERVLPCWEGEI
GPMA_MANSM        -------------KDPNSAHNDRRYAHLPADV------VPDCENLKVTLERVLPFWEDQI
GPMA_ENTFA        -------------TDEGSAANDRRYAMLDQRD------IPGGENLKVTLERALPFWQDEI
GPMA2_LACSS       -------------SDEGSAANDRRYAHLDPKA------IPGGENLKVTLERVIPFWEDEI
GPMA_STRP6        -------------DDEYSAHKDRRYADLDPAL------IPDAENLKVTLERAMPYWEEKI
GPMA_LISMF        -------------NDERQAKNDRRYQLLDTHA------IPAGENLKVTLERVIPYWMDTI
GPMA_STACT        -------------EQREADLADRKYQGLDERV------IPTSESLKDTLERVIPYWNDAI
GPMA_CAUSK        -------------GGEYDFGKDRRYAGKD---------LPDTESLKTTLTRVLPYWETAI
GPMA_HYPNA        -------------GSTFDLSTDPRYRGID---------IPNTESLKTTLDRVLPYWQQKI
GPMA_SPHWW        -------------GGEFDLSKDRRYAGIA---------IPSTESLKDTIARVLPYWEERI
GPMA_ZYMMO        -------------GSKFDLSGDRRYDGVK---------IPETESLKDTVARVLPYWEERI
GPMA_ERYLH        -------------GHQYDPGADPRYDGID---------VPTTESLKLTIERVLPYWESEI
GPMA_MARMM        -------------DHAYHPLNDHRYADVPREL------LPASESLKSTLDRVEPYWSSSI
GPMA_XYLFT        -------------DDPSHPMRDRRYAALDRKV------LPVRESLKNTLERVLPYWNDAI
GPMA_HYDS0        -------------DDPNHPCNDPRYKHIRCQD------LPSSESLKDTLERTLPYFQDFI
GPMA_ARTS2        -------------DSEFSQAHDPRYADLG-DAL------PRTECLKDVLIRLMPYWESDI
GPMA_NOCSJ        -------------DSEFSQFGLPQYAGLG-DDM------PHTECLKDVIARFLPYWESDI
GPMA_LEIXX        -------------DSEWSQADDPRYADLG-ADL------PRTECLKDVIARMLPFWESDI
GPMA_BIFLS        -------------NDQYAQNNDPRYAG---DPV------PEAECLANVVERVKPYFESAI
GPMA_NOCFA        -------------GNEYSQEGDARYAG---IDI------PKTECLLDVVNRMVPYWESTI
GPMA_CORJK        -------------DNEYAQTNDPRYADL--SEI------PATECLLDVVKRFIPYYEEEI
GPMA_MYCLB        -------------GSEFSQDADPRYTDI--GGG------PLTECLADVVTRFLPYFTDVI
GPMA_CUTAK        -------------DSEFSQFHDPRYADIPASER------PVAECLKDVVARMVPYFTSDI
GPMA_THEFY        -------------DSEFSQHNDPRYATLPPELM------PRTECLADVVRRMLPYWYDAI
GPMA_FRAAA        --------------PEQVSGVDERYADLAPDLI------PRTECLADVVARMLPYWYDAI
GPMA_TROWT        -----------------SQADDPRYEEPP----------PLSESLKDVQNRLLPYWQGVI
GPMA_NAUPA        -------------DDKRHPRFDPHYKNFPVELL------PNTESLKDNQIRAMAAFHERV
GPMA1_NITEU       -------------DDPRAPVNQPRYAAVDRTQ------LPLAESMQQTLERVRPLWQETI
GPMA1_NITMU       -------------ADIRFPGNQACYATIDPGE------LPLGESMRQAFARMLPYWQQTI
GPMA1_LACPL       AE----------------LDHDRRYTKYG-----A-AVEPRGESLKMAYDRIMPYWIDEI
GPMA1_LACSS       S------------------STARRYRLVP-----R-KSRPRGESLAQATQRLLPYWQDQV
GPMA2_LACJO       P------------------VQDRRYQKYD-----M-RLMPQGESLHQTQERLMPYFWDHI
PMG3_YEAST        NLEMVQEENDQGSSTGYDFKEPNRHLKYGPEEKAN-ERLPESESLCEVVVRLKPFLNNVV
GPMA_PELUB        -------------NNPYHPLNIEVYKSIPKEN------IPDTESLKDTYDRVMKFYIDEI
GPMA_AGRVS        ----------------------------------------GGESLRDTGARVWPYYLTEI
GPMA_CHESB        ----------------------------------------GGESLRDTGARVWPYYLREI
GPMA_BARBK        ----------------------------------------NGESLRDTGARVWPYYFHHI
GPMA_XANP2        ----------------------------------------GGESLRDTVARTLPYYVQEI
GPMA_NITWN        ----------------------------------------GGESLKDTLARTLPYFVQEI
GPMA_METSB        ----------------------------------------GGESLKDTVARVLPYYCQEI
GPMA_METRJ        ----------------------------------------GGESLKDTAARVLPCYVATI
GPMA_PARL1        ----------------------------------------GGESLKMTAERVLPYFEKEI
GPMA_CHLPN        ----------------------------------------QGESLYDTKQRTLPYFEKNI
GPMA_PARUW        ----------------------------------------NGESLQMTAARTIPYFENTI
GPMA_METAC        ----------------------------------------EGESLKDIYRRAVPYFEKEI
GPMA_METMA        ----------------------------------------EGESLKAVYERTVPYFRKKV
GPMA_PSEA6        ----------------------------------------NGESLAMTATRAIAYFQSHI
GPMA_CYAP7        ----------------------------------------GGESLEDTQKRVIPYFENRI
GPMA1_GLOVI       ----------------------------------------GGESLEDTRKRVYPYFTNRI
GPMA_METVS        ----------------------------------------NGESLKDTYERTVPYLKRYI
GPMA2_GLOVI       ----------------------------------------GGESLKDTALRSLRYFYEKI
GPMA_CYTH3        ----------------------------------------GGESLENTCQRVIPYYQEKI
C5AXT5_METEA      ----------------------------------------GGESLAMTAARLWPFFERAI
G8PLZ4_PSEUV      ----------------------------------------GGESLEMTANRALGVFRHRV
GPMA_RHIEC        ----------------------------------------GGESIRDISARVLPFLISEV
D3LL69_MICLU      HL-------------------WEELRSSSALRGLPDGALRRTEALSDVIKRVRPVLHDRL
                                                            * :     *         

GPMA_BORT9        ARAIIEGKKV--IIAAHGNSLRALVKYLDNMSDDDILKLNIPTGIPLVYELDRD-LRPIK
GPMA_COPPD        VPAIKEGKKV--LISAHGNSMRAIVKYLDKMSGEEIAKTNIPTGIPLVYELDES-MRPIR
GPMA_TERTT        RPSILGGKRV--IIAAHGNSLRALVKYLDDMSDAEILDLNIPTGVPLVYDLDAD-LRPIK
GPMA_TREPS        KPQMISGQRV--LIVAHGNSLRALMKHIESLDETQIMEVNLPTGVPLVYEFEAD-FTLCG
GPMA_TREDE        KPQMLEGKRI--LITAHGNSLRALVKYFENLSDEEIISVNIPTGVPLVYEFDKN-FKVLS
GPMA_LACP7        LKDMMAGKRV--LIAAHGNSLRALMKYLEDMSPEDILNVNLPTGIPLVYELDEE-GKFIS
GPMA_BDEBA        APAVKSGKNV--LIVAHGNSLRALMQHLEGMTPDEIMGVNMPTGIPMMYELDAN-LKVLK
GPMA1_BACTN       FPALMYKDSL--LVVAHGNSLRGIIKHLKGISDTDISNLNLPTAVPYVFEFDDR-LVLVK
GPMA_PORG3        FPTLKEHDEV--LVAAHGNSLRGIIKVLKNISDEDIISLNLPTAVPYVFEFDDN-LRLVK
GPMA_DICNV        KPVLIAENTV--LIVAHGNSLRAIIKHLKGISETEITDLNLPTGIPYVFEFDDD-MNLCA
GPMA_FUSNN        SKSLQEEKNV--IVAAHGNSLRALIKYLLNISNEDILNLNLVTGKPMVFEIDKD-LKV--
GPMA_BURP1        APAVKAGKQV--LIAAHGNSLRALIKYLDGISDADIVGLNIPNGVPLVYELDES-LTPIR
GPMA_POLAQ        APALKANKRV--LLVAHGNSIRSLIKYLDQMSDEAIMEVNVPNGIPLVYELDDN-LKPIQ
GPMA_BORPD        APAIRAGRRV--LVAAHGNSLRALIKHLDNISDDDIVGLNIPTGQPLVYELDEA-LRPIR
GPMA_AROAE        VPNILAGRRI--LIAAHGNSLRALIKYLDNISDSEIVGLNIPTAQPLVYELDAN-LRPIR
GPMA2_NITEU       APQIKAEKKV--IIAAHGNSLRALIKHLDNISDQDILNCNIPTGIPLVYELDDD-LKPLN
GPMA2_NITMU       APQVKSDKSV--LITAHGNSLRALVMYLDNLSEGEIMELNIPTGIPLVYELDDG-LKPIR
GPMA_CHLPB        APMIRSGKRV--IIAAHGNSLRALVKYLDNISEEDIVGLNIPTGVPLVYELDDD-LKPLK
GPMA_CHLT3        APTIKSGKRV--IIAAHGNSLRSLVKYLDNISDEDIVGLNIPTGMPLVYELDDD-MKPIK
GPMA_SOLUE        APAIRSGQRV--IIAAHGNSLRALVKYLDGVSEADIVELNIPTGMPLVYELDDD-LKPLN
GPMA_METHJ        APVIRSGKRV--LITAHGNSLRALVKHLDNISDTDIPDLNIPTGIPLVYELDDN-LKPVR
GPMA_UNCTG        VPQIKAGKKI--IIAAHGNSLRALVKYLDNISDSNIVNLNIPTAMPLVYELDEN-LKAVK
GPMA_ECOLI        LPRMKSGERV--IIAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDEN-FKPLK
GPMA_HAMD5        KPRIIDGKRV--IIVAHGNSIRALVKYVDHLSEEEIMEINIPTAVPLVYEFNSS-LQPIN
GPMA_BLOFL        EPKIYNNNCI--IIVAHGNSIRAILKFLNQLDDSEIFNIEIPTGIPLIYEFDNN-IKPIR
GPMA_BLOPB        IPHIKKGQTI--IIVAHGNSIRAIIKFLNHLNESEIFQINVPTGVPLIYEFDKK-ANTVQ
GPMA_WIGBR        FPRLQNKEKI--IIVAHGNSIRAIIKILCNLNEKEIIKINIPTGIPLIYEFDYN-MVFKK
GPMA_BAUCH        LPRINNGERV--IIAAHGNSIRAIITLLDQLSENELIQLNIPTGVPIIYEFNSQ-IKTIK
GPMA_BUCAI        YPELKNNKKI--LIVAHGNSLRALIQHLYKIDNKAILDLNIPTAQPIILDFDNE-KNPIK
GPMA_BUCAP        LPQIKKRNRV--LIVAHGNSLRALIQFLNKIDNKKILELNIPTATPIILEFNEE-YNSIK
GPMA_BUCBP        FPRFQKNTKI--IIVAHGNSLRALIKYLNNINDIDILNLNIATGFPIIYEFNSE-FKPIQ
GPMA_BUCCC        LPQLEKNKNI--LIVAHGNSLRALIKYLGNISDSDIIDLDISTGKPLVYEFSNT-NKPLK
GPMA_BACCN        APMLCSNQKV--IISSHGNTIRSLVKYLDHLSDDGVVSLNIPTGIPLVYELDEH-LHPIR
GPMA_CLOB8        AKDLKEGKRV--IISAHGNTLRALVKYLDDIPADNVANLNIPTGIPLVYELDEK-LKPIT
GPMA_CLOAB        APNIKGGKNI--IISAHGNTLRALVKYLDNIPSDGIANLNIPTGTPLVYELDEN-LEPIT
GPMA2_BACC1       APNVKAGKQV--IIAAHGNTIRALVKHLDQISDKDIENVNIPTGTPLVYELDND-LKPIG
GPMA_CALS4        APTIKSGKRV--IIAAHGNSLRGLVKYLDNLSNEEIMELNIPTGIPLVYELDEN-LKPIR
GPMA_METI4        FPAILSGQKV--LVSAHGNSIRALIKYIENMSEKEIVGLNIPTGFPLVYDLDEQ-GNKLA
GPMA_NITOC        LPDIAAGKEL--IIVAHGNSLRALYKHLEGLSDQEVMELNIPTGIPLVFELDSA-FRPTA
GPMA_GEOSM        VPALRQGKRI--LIAAHGNSLRGLIKYLDQVSDEDIVGLEIPTGSPLVYELDSD-LKPMR
GPMA_METPE        VPTLQDGKRI--LIAAHGNSIRALVKYLDGVPDDVITGLNIPTGFPLVYELDDD-LHPIR
GPMA_DESVV        APDLMAGRDV--LVAAHGNSLRALVMHLDGLDREAVSRLDIPTGLPRLYELDAA-LRPVS
GPMA_DESVM        APQVLAGQRV--LVAAHGNSLRALVMHLDGMTPEAVTKLNIPTGLPLVYTLDGT-LRPLA
GPMA_DESAG        APAIQAGRRL--LVAAHGNSLRALVMHLDGMSPDEVTGLNIPTGLPLVYELDSN-LTPLR
GPMA_DESMR        APAIASGTRL--LVAAHGNSLRALVKYLDAIGDDAISECNIPTGVPLIYKLDAS-LKPLE
GPMA_RHOCS        APQIRAGQRV--LISAHGNSLRGLVMYLSGLSEEEITGFEIPTGRPLVYELDDA-LKPTD
GPMA_GEOSL        APRILAGRRL--LIAAHGNSLRALVKYLDGIGDDAIAGLNIPTGIPLVYELEDD-LHPIR
GPMA_ALKEH        VPTLRDCDNV--LIAAHGNSIRALIKHLDGLDDEAIMKVEIATGDPLVYELDDA-LAVVD
GPMA_HALHL        APALRQHDCV--LIAAHGNSLRALVKHLDGLADDAIMKVEIPTGRPLVYELAED-LSVQR
GPMA_MANSM        APAIKAGKRV--LVAAHGNSLRALAKHIEGISDADIMDLEIPTGQPLVYTLDDN-LKVVS
GPMA_ENTFA        APALKDNKTV--LVAAHGNSLRALAKHIEGISDEDIMDLEIPTGKPLVYELNDD-LTVKE
GPMA2_LACSS       APKLIDGQNI--IVAAHGNSLRALTKYIENISDEDIMDVEMATGEPVVYDLDEN-LNVVS
GPMA_STRP6        APALLDGKNV--FVGAHGNSIRALVKHIKGLSDDEIMDVEIPNFPPLVFELDEK-LNIVK
GPMA_LISMF        APEIKEGRRV--VIAAHGNSLRALVKFLEGIGDDEIMDLEIPTGVPLVYELNDD-LKPVN
GPMA_STACT        APELLTGKTV--LVSAHGNSLRALIKHIEGVSDEDIVGYEIKTGAPLIYELDDN-LGFVS
GPMA_CAUSK        APKLKAGETI--LVAAHGNSLRAIVKHLFDVPDDKIVHVEIPTGNPLVIDLDAD-LKPTG
GPMA_HYPNA        APGLIAGTDT--MIAAHGNSLRALVKHLFNVPDETITGLEIPTGNPLLIELDPN-LKPVS
GPMA_SPHWW        APDLKAGKRV--VISAHGNSLRALVKHLSHIPDDEITELEIPTGQPIVYELADD-LTARD
GPMA_ZYMMO        APELKAGKRV--LIGAHGNSLRALVKHLSKLSDEEIVKFELPTGQPLVYELNDD-LTPKD
GPMA_ERYLH        LPVLASGETV--IISAHGNSLRALVKHLSGISDEDITGLEIPTGQPIIYQFDDR-MQPGE
GPMA_MARMM        QPRLAAGETL--IVAAHGNSLRALVKLLFKVSDPDIMEVEVPTGNPLLIDLEDDGITLRS
GPMA_XYLFT        APQLNDNKTV--LISAHGNSLRALYKYLNKESDEKILNVNIPTGIPLLFELSDT-LQVVS
GPMA_HYDS0        APTLFQRGCV--LVAAHGNSLRAIVKYIEDLSKDEIVKLNIPTGIPLVYVVDDN-LNIKS
GPMA_ARTS2        KEDLKAGKTV--LVTAHGNSLRALVKHLDGISDEAIAGLNIPTGIPLVYDLDENFKPLNP
GPMA_NOCSJ        VPDLRAGHTV--LIAAHGNSLRALVKHLDGISDEDIAGLNIPTGMPLVYELDDDFRPTVP
GPMA_LEIXX        TTSLSAGKTV--LVTAHGNSLRALVKHLDGISDDDIAELNIPTGVPLVYKLDDSFKPVEP
GPMA_BIFLS        EPELKAGKTV--LIAAHGNSLRAIVKMLDNLSEEEIAKVNIPTAIPLLYELDENFKPIKP
GPMA_NOCFA        SKDLLAGKTV--LIAAHGNSLRALVKHLDQISDEEIAGLNIPTGIPLRYELDENLRPVRP
GPMA_CORJK        EPRVKNGETV--LVAAHGNSLRALVKHLDKISDEDIAGLNIPTGIPLVYNIDADGKVLNP
GPMA_MYCLB        VPDLRTGRTV--LIVAHGNSLRALVKHLDEMSDDEVVGLNVPTGIPLRYDLDADLRPVVP
GPMA_CUTAK        AADLKDGKTV--LVAAHGNSLRALVKHLDEISDEDIAGLNIPTGIPLFYELDDNLKPVTR
GPMA_THEFY        IPDLAAGRTV--LVAAHGNSLRALVKHLDNIDDKSIAGLNIPTGIPLVYELNDDFTPRKT
GPMA_FRAAA        VPDLRAGRTV--LVAAHGNSLRALVKHLDHISDTDIAGLNIPTGIPLRYELDDDLGVLSS
GPMA_TROWT        LPHLVAGKVV--LVVAHGNSLRALVKHLECISDTDVCQLNIPTGIPLVYSIDPSGCATHP
GPMA_NAUPA        APLLVEGKDV--LITAHGNTIRGMVKELDGISDEDIPKFEIATGIPRVYEFDEA-LHIKN
GPMA1_NITEU       LPEIRQGKRL--LIVSHQNLLKTLVMQLEGLTGAQIMRLSITTGHPLCYELDHS-LVPVK
GPMA1_NITMU       TPEIQRGKRV--LIVAHKHILRGLIMQLDGLSIIQLIKLSVATGRPLIYELDDN-LHPIR
GPMA1_LACPL       APRLLDGQNQ--LVVAHGSTLRAMIKYLEHISDTGIDGVEVANGVPICYHLDRQ-LHVIG
GPMA1_LACSS       VPGLLAGQDQ--LIVAHGSTLRALIKVIEQISDQAIDGVEVANGEALYYQFGTD-LTVLK
GPMA2_LACJO       APELMAGHDQ--LVVAHGSSLRALIKKIEDISNEDIVKVEVPNAEPIVYTFDTD-LHIVK
PMG3_YEAST        LSTANKISQESCVIVGHGSSVRSLLKVLEGISDEDIKDVDIPNGIPLVIELDRD-NYSFV
GPMA_PELUB        QMKLKNDKNI--LISAHGNSIRALCKFLFKLDNQRITLLEIPTGNPLLINLDSK-QNIKE
GPMA_AGRVS        LPRVLRGEKV--LVAAHGNSLRSLVMVLDKLTKEQILSVNLATGVPMVYKLNAD-STVAS
GPMA_CHESB        LPQVLRGKTV--LVSAHGNSLRSLAMVLDGLSGEEIVKMEIATGVPIVYRLNPD-STVAS
GPMA_BARBK        QPHILRSQTV--LIVAHGNSLRALIMVLEGLSSEEIVLQELATGVPIIYEFNAD-STILS
GPMA_XANP2        LPCVLRGQTT--LVAAHGNSLRALIMTLEKLSPEGIMKRELNTGAPIVYKLAAD-STVAE
GPMA_NITWN        LPCVLRGECT--LVAAHGNSLRALVMVLEKLSPEQILARELATGAPVIYRLNAD-ATVAS
GPMA_METSB        LPAVLNGKRT--LVTAHGNSLRALIMVLDKLTPKTIPGMELATGVPIVYRLKAD-STVES
GPMA_METRJ        LPRVMAGQRV--LVAAHGNSLRALVMVLDGLTEAQVPDLQIRTGVPLVYRLNAD-TTVAS
GPMA_PARL1        LPRVLKGERV--LIAAHGNSLRSLVMQLDKLSQEQVLALNIATGAPIVYELDDK-GGVVR
GPMA_CHLPN        LPQLQNGKNV--FVSAHGNSLRSLIMDLEKLSEEEVLSLELPTGKPVVYQWKNH-KIEKH
GPMA_PARUW        VPHLKEKKNI--FIAAHGNSLRSIIMKLDGLTTDQVVKLELATGVPVIYDFNHD-EYIKQ
GPMA_METAC        FPILQDGKNV--IVCAHQNSLRALIKHIEGISNEDIRKIRLANARPVIYTFSGG-RLVRE
GPMA_METMA        MPALEGGKNV--LICAHQSSLRALVKYIEDISDKDIREVRLSTGELAIYHFSEG-KLVRE
GPMA_PSEA6        VPALQQGKNV--LVCAHGNSLRAIIMHIEKMTAAQIAAYELKTASPHIYQCNTA-MDILS
GPMA_CYAP7        LTHIAHGDTV--MVAAHGNSLRAMIMRLENLQPEDVPNLELATGIPLIYEVDQQ-AKVSN
GPMA1_GLOVI       LGHIKQGDNV--LVAAHGNSLRSIIMILETLSEEEVPKVELATGVPIVYELDKA-AHMLS
GPMA_METVS        LPTLTYGKDV--IVTAHGNSLRSIIAYLEKLNSEEVLKLEIPTGVPLVYNLDEK-GLKRL
GPMA2_GLOVI       VPELEAGKNV--LVSAHGNTIRAILMELDHLSPEQVEKVEIEYCVPVAFEHQAD-GTFSQ
GPMA_CYTH3        EPELKDGRNV--LIVAHGNSLRALMMHLEKISPEDIAHVDLATGAPRLYEFSSK-LDLNS
C5AXT5_METEA      APRVRSGKCV--LVVAHGNSLRSLLMRLDHVAPADIEDVNIGTAEMLIYRSNAD-DQTLV
G8PLZ4_PSEUV      LPQLSNGKNI--LISAHRNTIRGLISKLCKLRQEETERLHIATAQPLFFQVNNA-EDIQQ
GPMA_RHIEC        FPPLLRGKSV--LVVAHGNTIRSLKQGIERLTIQDTLAIESPTAAPTVYRIASD-LSIIE
D3LL69_MICLU      LPMVRSGRSV--LVVAHGNSLRALCACIDDLTDPELEQLNLPTGQPVQYHLAPT-GALVP
                              .: .*   :: :   .                                

GPMA_BORT9        HYYLGDEDKIKAAMESVANQGKKK-----
GPMA_COPPD        HYYLADEDFLKAKEQEVANQIYKK-----
GPMA_TERTT        REYLGDPEAIKAMMDAVAKQGQAK-----
GPMA_TREPS        KRFLGNEADVAARAQAVADQGKSN-----
GPMA_TREDE        KRYLGDQEKINAKINAVANQGKKK-----
GPMA_LACP7        KEYLGDAEYVKAKIEKVSAQGKVTIE---
GPMA_BDEBA        KEFIGDPDEVKAAIEAVANQGKAK-----
GPMA1_BACTN       DYYLGNPEEIRKRAEAVAKQGMAKK----
GPMA_PORG3        DYFLGDPEEIKKLMEAVANQGKKK-----
GPMA_DICNV        DYFLGDTEAIKKLQESVAKQSQ-------
GPMA_FUSNN        ---LSSPELF-------------------
GPMA_BURP1        HYYLGDQEAIAKAQAAVAQQGKSAA----
GPMA_POLAQ        HFYLD------------------------
GPMA_BORPD        HYYLGDAAEIEAAMAAVAAQGKAKKD---
GPMA_AROAE        SYYLADADTIRAAEAAVAGQGKAKG----
GPMA2_NITEU       SYYLGDAGQIGEAISAVANQGKSGA----
GPMA2_NITMU       SYYLGDQAKIEQAMQVVANQGKILPNL--
GPMA_CHLPB        SYYLGDQEELQKAIDSVANQGKA------
GPMA_CHLT3        NYYLGDPDDVAKAMASVANQGKAKA----
GPMA_SOLUE        RYYLGDPEKVKAAMEAVAAQGKKK-----
GPMA_METHJ        SYYLGDEEKVKAAMEAVKNQGKAK-----
GPMA_UNCTG        NYYLGDPEAVKKAMETVASQGKVKK----
GPMA_ECOLI        RYYLGNADEIAAKAAAVANQGKAK-----
GPMA_HAMD5        HYYLGNAEEITQKVAAVAAQGKA------
GPMA_BLOFL        YYYLSE-----------------------
GPMA_BLOPB        HYYLK------------------------
GPMA_WIGBR        KYFLFDR----------------------
GPMA_BAUCH        HYYLSIVNKDY------------------
GPMA_BUCAI        WHYLT------------------------
GPMA_BUCAP        WYYL-------------------------
GPMA_BUCBP        YYYLKQ-----------------------
GPMA_BUCCC        YYYL-------------------------
GPMA_BACCN        HYYLNMDGEVQEGVIPKHISF--------
GPMA_CLOB8        HYYLS-DKE--------------------
GPMA_CLOAB        RYYLGMDGKIEDDKFPKKV----------
GPMA2_BACC1       HYYLNREIETLEE---KQV----------
GPMA_CALS4        HYYLADEEELKKKQQEVAEQGKARA----
GPMA_METI4        CYYLGDLEEIEKAQHRVAAQGKASS----
GPMA_NITOC        HYYLAD---SEKSQVVIGDTAH-------
GPMA_GEOSM        HYYLE------------TGKTG-------
GPMA_METPE        HYYLGDEEEIRRATESVASQTATKK----
GPMA_DESVV        YRYLGDPAEAEERARAVAAQGRLEKN---
GPMA_DESVM        HRYLGDPAVAEAKAKAVAAQGAARK----
GPMA_DESAG        RAYLGDAEAAEAKARAVAEQAKAGTTERP
GPMA_DESMR        HFYLGDAEAVARKAAAVAAQGKAKG----
GPMA_RHOCS        RFFL-------------------------
GPMA_GEOSL        SYYLGDPDEVARATQSVADQVKR------
GPMA_ALKEH        KHYLRERD---------------------
GPMA_HALHL        SYYVQD-----------------------
GPMA_MANSM        KRYL-------------------------
GPMA_ENTFA        KYYL-------------------------
GPMA2_LACSS       KKKLN------------------------
GPMA_STRP6        EYYLGGE----------------------
GPMA_LISMF        KYYLDK-----------------------
GPMA_STACT        KHYL-------------------------
GPMA_CAUSK        ARYLDAARAQPLPAVG-------------
GPMA_HYPNA        VRYLDAERAHSLPDLP-------------
GPMA_SPHWW        RYYLSER----------------------
GPMA_ZYMMO        RYFLNER----------------------
GPMA_ERYLH        RYYLKDS----------------------
GPMA_MARMM        ARYLDPVRAKPLPPLPGA-----------
GPMA_XYLFT        YRYLGDPDAAQRAAEMVANQGKAK-----
GPMA_HYDS0        KRYLADEETLKKAIESVANQTKA------
GPMA_ARTS2        GGTYLDPEAAAESIKAVANQGKK------
GPMA_NOCSJ        HGRYLDPEAAAAAAAAVANQGR-------
GPMA_LEIXX        -AAYLDPEAAAVGAAAVAAQGKK------
GPMA_BIFLS        RGEYLDPEAAAAGAAAVAAQGQK------
GPMA_NOCFA        R-EYLDPEAAAAGAAAVASQGGK------
GPMA_CORJK        GGDYLDPEAAAAGAAAVAAQGQAK-----
GPMA_MYCLB        GGTYLDPEAAA----AVISQARP------
GPMA_CUTAK        GGRYLDPEAAAAGAKAVANQGNK------
GPMA_THEFY        GGEYLDPEAAKEAIEAVKNQGK-------
GPMA_FRAAA        G--YLDPDAAASAAAAVAAQGKK------
GPMA_TROWT        G-RYLP-----------------------
GPMA_NAUPA        VYNID------------------------
GPMA1_NITEU       RYYL-------------------------
GPMA1_NITMU       HYYADTGLTGHTG----------------
GPMA1_LACPL       K----------EEY---------------
GPMA1_LACSS       KGRLALGSETDEEKEN-------------
GPMA2_LACJO       K----------EILH--------------
PMG3_YEAST        RKFYLDPESAKVNAQMVRDEGFEKNP---
GPMA_PELUB        CTYLDQDRAKDLLVF--------------
GPMA_AGRVS        KDVLGDMSGAH------------------
GPMA_CHESB        KEILEG-----------------------
GPMA_BARBK        KKIIQS-----------------------
GPMA_XANP2        KRDLVA-----------------------
GPMA_NITWN        KLDLAA-----------------------
GPMA_METSB        KQVLEP-----------------------
GPMA_METRJ        KTVLDQDVDAGR-----------------
GPMA_PARL1        KEMLIEREAH-------------------
GPMA_CHLPN        PEFFG------------------------
GPMA_PARUW        QK---------------------------
GPMA_METAC        NAETDPSVKRNL-----------------
GPMA_METMA        NEELGPELKRNI-----------------
GPMA_PSEA6        KQVLE------------------------
GPMA_CYAP7        KIVLH------------------------
GPMA1_GLOVI       KAVLTN-----------------------
GPMA_METVS        GYLNKKGFDNELI----------------
GPMA2_GLOVI       VLMPRCDIIRPPQPPARSIARL-------
GPMA_CYTH3        VSYIKLPETPLDVSTLL------------
C5AXT5_METEA      RAAAIACSS--------------------
G8PLZ4_PSEUV      IYK--------------------------
GPMA_RHIEC        KTNVLVGTVC-------------------
D3LL69_MICLU      RGGAFLDPVAAQHAAALVAAEGGT-----