CLUSTAL format seed alignment for MF_01043

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PLSY_AYWBP       ---------------MKKLSFLFLFLFFYILGSIPTGLVIGKLTQQKDLRNKGSGNIGAT
PLSY_ONYPE       ---------------MENLSFLFLFLFFYILGSIPTGLVIGKLVQQKDLRNTGSGNIGAT
PLSY_PHYAS       ---------------MVSIYFFFFFLLFYALGSFPTGLIIGKLTQKKDLRLVGSRNVGAT
PLSY_ACHLA       -------------MNMQILWIIIAIICSYLIGAIPFGYIIPKLFKGIDIREHGSKNVGST
PLSY_CLOAB       -----------------MIIVIITVMVSFLCGSIPTGYLITKKLSGIDVRTKGSGNIGST
PLSY_GEOMG       -----------------MLIEILLLAGAYLLGSIPTGLLLAKAAGV-DIRTTGSGNIGAT
PLSY_GEOSL       -----------------MLNELILTAVAYIVGSIPTGLLLARASGV-DIRATGSGNIGAT
PLSY_GEODF       -----------------MTSEIVLIIGAYLLGSIPTGLLLAKAVGV-DIRTTGSGNIGAT
PLSY_GEOLS       -----------------MTAGLFWIAGAYLLGSIPTGLLLGKLYGI-DVRNEGSGNIGAT
PLSY_PELCD       -----------------MTSFYIMLLAAYLIGAIPTGVVLTRLVGASDIRNSGSGNIGAT
PLSY_KORVE       -----------------MKTFVPIALLAYLCGSIPFGFILVKLFLKADVRQTGSGNIGAT
PLSY_FUSNN       ------------------MAFFCFIVLTYFIGAIPSGVWIGKAFKGVDVRDYGSKNSGAT
PLSY_UNCTG       -----------------MLIKILYIIITYLCGSIPSAYIVAKANGKVDIRTVGSGNSGAT
PLSY_DESAD       ------------------MLWIFWLVFAYFLGSIPFGLFIGKICCNCDIRTEGSKSTGAT
PLSY_DESMR       ------------------MAATAFLVLTYLLGAFPFGLVVALVGRGIDPRLAGSRNTGAT
PLSY_DESAG       ------------------MGYLLWLVTAYVIGSVPFGLVIARTFCSVDPRTGGSRNVGAT
PLSY_DESVH       ------------------MGSLLWLAVAYVMGSIPFGLLFAKMFCGTDPRTGGSRNVGAT
PLSY_DESDA       ------------------MLEILWIALAYVLGSAPWGLVIARTFCGIDPRESGSRNTGAT
PLSY_LAWIP       -----------------MIIDLIWIITSYVIGSIPFGVLFANIFCGIDPRTLGSGNVGAT
PLSY_LEPBJ       ------------------MNFAIFAFLSFISGSIPFGYWIALRFGKMDIRKFGSKNIGAT
PLSY_LEPBL       ------------------MNFAIFAFLSFISGSIPFGYWIALRFGKMDIRKFGSKNIGAT
PLSY_LEPIC       ------------------MNFPIFALFSFISGSIPFGYWIALRFAGVDIRKLGSKNIGAT
PLSY_LEPIN       ------------------MNFPIFALFSFVSGSIPFGYWIALRFAGVDIRKLGSKNIGAT
PLSY_DESPS       ------------------MDF-IFPLISYLLGAIPFGLLIG-KLAGRDVRLEGSKNIGAT
PLSY_ECOLI       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_SHIB3       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_SHISS       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_SHIBS       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_SHIDS       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECO24       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECO27       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECO45       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECO55       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECO57       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECO5E       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECO7I       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECO81       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECO8A       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECOBW       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECODH       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECOHS       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECOK1       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECOL5       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECOL6       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECOLC       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECOLU       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECOSE       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECOSM       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ECOUT       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_SHIF8       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_SHIFL       -------------MSAIAP---GMILIAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_ESCF3       -------------MSAIAP---GMILFAYLCGSISSAILVCRLCGLPDPRTSGSGNPGAT
PLSY_SALSV       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_SALTI       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_SALTY       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_SALA4       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_SALCH       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_SALDC       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_SALEP       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_SALG2       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_SALHS       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_SALNS       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_SALPA       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_SALPB       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_SALPK       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_CITK8       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRQSGSGNPGAT
PLSY_SALAR       -------------MSAIAP---GMILFAYLCGSISSAILVCRIAGLPDPRESGSGNPGAT
PLSY_ENT38       -------------MSAIAP---GMIFLAYLCGSISSAILVCRIAGLPDPRVSGSGNPGAT
PLSY_CROS8       -------------MSAIAP---GMILLAYLCGSISSAILVCRIAGLPDPRDSGSGNPGAT
PLSY_KLEP3       -------------MSAIAP---GLVLLAYLCGSISSAILVCRLAGLPDPRDSGSGNPGAT
PLSY_KLEP7       -------------MSAIAP---GLVLLAYLCGSISSAILVCRLAGLPDPRDSGSGNPGAT
PLSY_PECAS       -------------MSVTAL---GMMLIAYLCGSVSSAILFCKITGLPDPRLHGSGNPGAT
PLSY_PECCP       -------------MSVTAL---GMMLIAYLCGSISSAILFCRIAGLPDPRQHGSGNPGAT
PLSY_YERP3       -------------MSAIAL---GMIIFAYLCGSISSAILVCRVARLPDPRTHGSGNPGAT
PLSY_YERPA       -------------MSAIAL---GMIIFAYLCGSISSAILVCRVARLPDPRTHGSGNPGAT
PLSY_YERPB       -------------MSAIAL---GMIIFAYLCGSISSAILVCRVARLPDPRTHGSGNPGAT
PLSY_YERPE       -------------MSAIAL---GMIIFAYLCGSISSAILVCRVARLPDPRTHGSGNPGAT
PLSY_YERPN       -------------MSAIAL---GMIIFAYLCGSISSAILVCRVARLPDPRTHGSGNPGAT
PLSY_YERPP       -------------MSAIAL---GMIIFAYLCGSISSAILVCRVARLPDPRTHGSGNPGAT
PLSY_YERPS       -------------MSAIAL---GMIIFAYLCGSISSAILVCRVARLPDPRTHGSGNPGAT
PLSY_YERPY       -------------MSAIAL---GMIIFAYLCGSISSAILVCRVARLPDPRTHGSGNPGAT
PLSY_YERE8       -------------MSAIAL---GMIIFAYLCGSISSAVLVCRVAKLPDPREHGSGNPGAT
PLSY_SERP5       -------------MSATAL---GMIIFAYLCGSISSAILVCRIARLPDPRENGSGNPGAT
PLSY_ERWT9       -------------MSVFAL---GMILFAYLCGSLSSAILVCRLFKLPDPRHHGSGNPGAT
PLSY_EDWI9       -------------MSATAL---GMIIFAYLCGSISSAILVCKAAGLPDPRENGSGNPGAT
PLSY_PHOLL       -------------MSAIAL---GMIIFAYLCGSISSAILICRLAGLPDPRQHGSGNPGAT
PLSY_PROMH       -------------MSANAL---GMIIFAYLCGSISSAILICRLARLPDPRKFGSGNPGAT
PLSY_SODGM       -------------MNAIAI---GMIIFAYLCGSVSNAILICRLARLPDPRTSGSGNPGAT
PLSY_HAEI8       -------------MSLFAL---FYMLFAYLLGSISSAILICRIAGLPDPRQNGSHNPGAT
PLSY_HAEIG       -------------MSLFAL---FYMLFAYLLGSISSAILICRIAGLPDPRQNGSHNPGAT
PLSY_HAEIN       -------------MSLFAL---FYMLFAYLLGSISSAILICRIAGLPDPRQNGSHNPGAT
PLSY_HAEIE       -------------MSLFAL---FYMLFAYLLGSVSSAILICRIAGLPDPRQNGSHNPGAT
PLSY_PASMU       -------------MSLFAI---FYLFLAYLLGSVSSAILLCRLAGLPDPRESGSHNPGAT
PLSY_ACTSZ       -------------MSLFAL---CYMFAAYLLGSISSAVIVCRLAGLPDPRRHGSHNPGAT
PLSY_MANSM       -------------MSFFAI---LYMLATYFLGSISSAILICRLVGLPDPRQSGSGNPGAT
PLSY_HAES1       -------------MSLFAI---IYMLFTYLLGSISSDVVICRFTERNDARVTNS------
PLSY_ACTP2       -------------MSITVY---LLIVFAYLLGSVSSAIIFCRLAGLPDPRENGSHNPGAT
PLSY_ACTP7       -------------MSITVY---LLIVFAYLLGSVSSAIIFCRLAGLPDPRENGSHNPGAT
PLSY_ACTPJ       -------------MSITVY---LLIVFAYLLGSVSSAIIFCRLAGLPDPRENGSHNPGAT
PLSY_HAEDU       -------------MTLTAY---LLILTAYLLGSICSAIIFCRLAGLPDPRQNGSHNPGAT
PLSY_HAEPS       -------------MSVIAY---LLILGAYLLGSISSAVIFCRLAGLPDPREHGSHNPGAT
PLSY_AERS4       -------------MTALTI---LMIILAYLGGSLSSAVLVSRITGLPDPRDHGSHNPGAT
PLSY_TOLAT       -------------MLALTF---AMSGIAYLLGSVSNAVLISRLCDLPDPREYGSHNPGAT
PLSY_ALIF1       -------------MTPLAL---IMIIIAYLLGSISSAVLICRLKGLPDPRTSGSHNPGAT
PLSY_ALIFM       -------------MTPLAL---IMIIIAYLLGSISSAVLICRLKGLPDPRTSGSHNPGAT
PLSY_ALISL       -------------MTPLAL---IMIIIAYLLGSISSAVLICRLRGLPDPRTSGSQNPGAT
PLSY_PHOPR       -------------MTPLVL---LIIIGAYLLGSISSAVLISRLYRLPDPRDSGSGNPGAT
PLSY_VIBC3       -------------MTPLAL---SMIIFAYLLGSISSAVLICRVLRLPDPRNVGSQNPGAT
PLSY_VIBCH       -------------MTPLAL---SMIIFAYLLGSISSAVLICRVLRLPDPRNVGSQNPGAT
PLSY_VIBCM       -------------MTPLAL---SMIIFAYLLGSISSAVLICRVLRLPDPRNVGSQNPGAT
PLSY_VIBCB       -------------MDALAL---IMTMAAYLLGSISSAVLICRLLRLPDPRKVGSNNPGAT
PLSY_VIBPA       -------------MDALAL---IMTMAAYLLGSVSSAVLICRLLKLPDPRNVGSNNPGAT
PLSY_VIBTL       -------------MTPLAL---IMIIAAYLLGSISSAVLICRLLRLPDPRTVGSNNPGAT
PLSY_VIBVU       -------------MDAMAV---TMTIIAYLLGSISSAVLICRVLRLPDPRGVGSNNPGAT
PLSY_VIBVY       -------------MDAMAV---TMTIIAYLLGSISSAVLICRVLRLPDPRGVGSNNPGAT
PLSY_IDILO       -------------MTALTL---LMILSAYLLGSISSAVVICRLWGLPDPRKEGSGNPGAT
PLSY_PSEA6       -------------MTSLSI---LLFCSAYLLGSISSAVLICRVFMLPDPRKTGSNNPGAT
PLSY_COLP3       -------------MLLLTL---TMIIAAYLIGSISSAILVCRFSGLPDPRTTGSKNPGAT
PLSY_PSEHT       ---------------MLAT---LMFILAYLLGSISSAILVSRLFKLPDPRSNGSNNPGAT
PLSY_SHEB2       -----------MSPLTQTL---LMILAAYLAGSISSAVLVCRMRGLPDPRLQGSGNPGAT
PLSY_SHEB5       -----------MSPLTQTL---LMILAAYLAGSISSAVLVCRMRGLPDPRLQGSGNPGAT
PLSY_SHEB8       -----------MSPLTQTL---LMILAAYLAGSISSAVLVCRMRGLPDPRLQGSGNPGAT
PLSY_SHEB9       -----------MSPLTQTL---LMILAAYLAGSISSAVLVCRMRGLPDPRLQGSGNPGAT
PLSY_SHESA       -----------MSQLTLTL---LMIVAAYLAGSVSSAVLVCRMRGLPDPRLQGSGNPGAT
PLSY_SHESR       -----------MSQLTLTL---LMIVAAYLAGSVSSAVLVCRMRGLPDPRSQGSGNPGAT
PLSY_SHESM       -----------MSQLTLTL---LMIVAAYLAGSVSSAVLVCRMRGLPDPRSQGSGNPGAT
PLSY_SHEON       -----------MSQLSLTL---LMIVAAYLAGSVSSAVLVCRMRGLPDPRSQGSGNPGAT
PLSY_SHEPC       -----------MSQLTLTL---LMIVSAYLAGSISSAVLVCRMRGLPDPRSEGSGNPGAT
PLSY_SHESW       -----------MSQLTLTL---LMIVSAYLAGSISSAVLVCRMRGLPDPRSEGSGNPGAT
PLSY_SHEHH       -----------MTLTVLTI---VIIVGAYLAGSVSSAVLVCKIRGLPDPRTQGSGNPGAT
PLSY_SHESH       -----------MTITTLTL---GMILAAYLAGSISSAVLVCRLRGLPDPRTAGSGNPGAT
PLSY_SHEWM       -----------MTITALTL---GMILSAYLAGSISSAVLVCRLRGLPDPRTQGSGNPGAT
PLSY_SHELP       -----------MSLTLLTL---AMILTAYLAGSISSAVLVCRLRGLPDPRSQGSGNPGAT
PLSY_SHEDO       -----------MSAVTITI---LMILGAYLAGSISSAVLVCRLRGLPDPRTNGSGNPGAT
PLSY_BLOFL       ------------MIIFTAT---LIIILAYFLGSISGSILICKTLHFKDPRQHGSKNPGTT
PLSY_BLOPB       -------------MIFFSI---LITIFAYFLGSISSAILICKILRFPDPRNFGSKNPGAT
PLSY_COXB1       ---------------MAFI---ISIIIAYLLGSLSFAVIVAKLMKLPDPRTTGSGNAGAT
PLSY_COXBU       ---------------MAFI---ISIIIAYLLGSLSFAVIVAKLMKLPDPRTTGSGNAGAT
PLSY_COXBN       ---------------MAFI---ISIIIAYLLGSLSFAVIVAKLMKLPDPRTTGSGNAGAT
PLSY_COXBR       ---------------MAFI---ISIIIAYLLGSLSFAVIVAKLMKLPDPRTTGSGNAGAT
PLSY_COXB2       ---------------MAFI---ISIIIAYLLGSLSFAVIVAKLMKLPDPRTTGSGNAGAT
PLSY_FRAT1       -------------MNFLNF---SILIFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGMT
PLSY_FRATT       -------------MNFLNF---SILIFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGMT
PLSY_FRATF       -------------MNFLNF---SILIFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGTT
PLSY_FRATH       -------------MNFLNF---SILIFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGTT
PLSY_FRATN       -------------MNFLNF---SILIFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGTT
PLSY_FRATO       -------------MNFLNF---SILIFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGTT
PLSY_FRATM       -------------MNFLNF---SILIFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGTT
PLSY_FRAP2       -------------MNFLNF---SMLVFAYLLGSINSAIIVCYIFRLPSPRSVGSGNPGTT
PLSY_LEGPC       -------------MALFIF---LILV-GYLMGSINSAIIVCRTFGLPDPREEGSKNPGAT
PLSY_LEGPH       -------------MALFIF---LILV-GYLMGSINSAIIVCRTFGLPDPREEGSKNPGAT
PLSY_LEGPA       -------------MALFIF---LILV-GYLMGSINSAIIVCRTFGLPDPREEGSKNPGAT
PLSY_LEGPL       -------------MAFFIF---LILV-GYLMGSINSAIIVCRTFGLPDPREEGSKNPGAT
PLSY_RUTMC       -----------MLPELLFI---VLLLLSYLIGSISTAIIVCKMFNLPDSRTQGSNNPGAT
PLSY_AROAE       -------------MNFL-----LLLLAAYALGSTPFAIVSSRLFGLADPRRYGSGNPGAT
PLSY_LARHH       -------------MTTI-----ASLVLAYLLGSVPFAVLVSLGMGLADPRSYGSGNPGAT
PLSY_DECAR       -------------MQIA-----IALVAAYLLGSVPFAMISSKLFGLADPRTYGSGNPGAT
PLSY_NITEC       -------------MITV-----ILIFSAYLLGSISFAVVASWLFKLPDPRSYGSGNPGAT
PLSY_NITEU       -------------MITV-----VLIFSAYLLGSISFAVVASWLFKLPDPRSYGSRNPGAT
PLSY_NITMU       -------------MTLI-----ALILPAYLLGSISFGVLASRFFQLPDPRTYGSGNPGAT
PLSY_METFK       -------------MNNA-----VFVIAAYLLGSISFGILVSKAFGLPDPRTVGSGNPGAT
PLSY_BORBR       -MPATMVLTAPSLLSSS-----ALIVLAYLIGSIPFAVVVSKLMGLQDPRSYGSGNPGAT
PLSY_BORPE       -MPATMVLTAPSLLSSS-----ALIVLAYLIGSIPFAVVVSKLMGLQDPRSYGSGNPGAT
PLSY_BORPA       -MPATMVLTAPSLLSSS-----ALIVLAYLIGSIPFAVVVSKLMGLQDPRSYGSGNPGAT
PLSY_BORPD       -----MVQTAPSIFLSA-----ALIALAYLIGSIPFAVVVSKLMGLQDPRSYGSKNPGAT
PLSY_BORA1       -----MILTEPSPLFAA-----LLIVLAYLIGCVPFAVVVSKLMGLKDPRSYGSKNPGAT
PLSY_BURA4       -------------MQIL-----LAALVAYLIGSVSFAVVVSAAMGLADPRSYGSKNPGAT
PLSY_BURCM       -------------MQIL-----LAALVAYLIGSVSFAVVVSAAMGLADPRSYGSKNPGAT
PLSY_BURL3       -------------MQIL-----LAALVAYLIGSVSFAVVVSGAMGLADPRSYGSKNPGAT
PLSY_BURVG       -------------MQIL-----LAALVAYLIGSVSFAVIVSAAMGLADPRSYGSKNPGAT
PLSY_BURCA       -------------MQIL-----LAALVAYLIGSVSFAVVVSSVMGLADPRSYGSKNPGAT
PLSY_BURCH       -------------MQIL-----LAALVAYLIGSVSFAVVVSSVMGLADPRSYGSKNPGAT
PLSY_BURCJ       -------------MQIL-----LAALVAYLIGSVSFAVVVSSVMGLADPRSYGSKNPGAT
PLSY_BURCC       -------------MQIL-----LAALVAYLIGSVSFAVVVSSVMGLADPRSYGSKNPGAT
PLSY_BURM1       -------------MQIL-----LAALIAYLIGSVSFAVIVSAAMGLADPRSYGSKNPGAT
PLSY_BURP1       -------------MQIL-----LATVAAYLIGSVSFAVVVSAAMGLADPRSYGSKNPGAT
PLSY_BURPS       -------------MQIL-----LATVAAYLIGSVSFAVVVSAAMGLADPRSYGSKNPGAT
PLSY_BURMA       -------------MQIL-----LATVAAYLIGSVSFAVVVSAAMGLADPRSYGSKNPGAT
PLSY_BURTA       -------------MQIL-----LATVAAYLIGSVSFAVVVSAAMGLADPRSYGSKNPGAT
PLSY_PARPJ       -------------MQNL-----IVAVVAYLIGSVSFAVIVSAAMGLDDPRSYGSGNPGAT
PLSY_PARXL       -------------MQNL-----IVAVVAYLIGSVSFAVIVSAAMGLDDPRSYGSGNPGAT
PLSY_PARP8       -------------MENL-----IVAVVAYLIGSVSFAVIVSAAMGLADPRSYGSKNPGAT
PLSY_CUPTR       -------------MANL-----LFALAAYLIGSVSFAVVVSKLMGLPDPHSYGSGNPGAT
PLSY_CUPNH       -------------MANL-----LFALAAYLIGSVSFAVVVSKLMGLPDPHSYGSGNPGAT
PLSY_CUPMC       -------------MINL-----LFAVIAYLIGSVSFAVVVSKVMGLPDPHSYGSGNPGAT
PLSY_CUPPJ       -------------MANL-----LFALAAYLIGSVSFAVVVSKVMGLPDPHTYGSGNPGAT
PLSY_RALPJ       ---------MSPVVATV-----IFALAAYLIGSISFAVVVSRAMGLADPRTYGSGNPGAT
PLSY_RALSO       ---------MSTVVATV-----VFAVAAYLIGSVSFAVVVSRAMGLADPRTYGSGNPGAT
PLSY_HERAR       ---------MNTVLSTV-----LFAIGAYLIGSISFAVVVSKCFRLADPRSYGSKNPGAT
PLSY_JANMA       -------------MNTV-----LFALGAYLIGSISFAVVVSKCFRLADPRSYGSKNPGAT
PLSY_RHOFT       MRQQENFLESMQSFFPL-----AATLLGYLIGSLSFAVIVSRVMGLNDPRTFGSKNPGAT
PLSY_CHRVO       -----------MTTTAF-----AFVLAAYLIGSLSFAVIVSKAMGMADPRSYGSGNPGAT
PLSY_THIDA       -------------MIHL-----LLVVAAYLLGSLSFAVIVSRAMGLPDPRSFGSGNPGAT
PLSY_NEIG1       -------------MFNI-----PAVAVSYLIGSLSFAVIVSKYYGMDDPRTYGSGNPGAT
PLSY_NEIG2       -------------MFNI-----PAVAVSYLIGSLSFAVIVSKYYGMDDPRTYGSGNPGAT
PLSY_NEIMA       -------------MFNI-----PAVAVSYLIGSLSFAVIVSKYYGMDDPRTYGSGNPGAT
PLSY_NEIMF       -------------MFNI-----PAVAVSYLIGSLSFAVIVSKYYGMDDPRTYGSGNPGAT
PLSY_NEIM0       -------------MFNI-----SAVAVSYLIGSLSFAVIVSKYYGMDDPRTYGSGNPGAT
PLSY_NEIMB       -------------MFNI-----PAVAVSYLIGSLSFAVIVSKYYGMDDPRTYGSGNPGAT
PLSY_METCA       -------------MPVE----WLLIPFAYLLGSVSSAVIVSRTLGLPDPRQEGSKNPGAT
PLSY_THISH       -------------MLLA----SALVLGAYLLGSVSTAILVCRLAGLPDPRSQGSGNPGAT
PLSY_NITOC       -------------MLTI----LVLVIGGYFVGSLSSAIIVARLAGLGDPRTQGSGNPGAT
PLSY_HYDCU       -------------MIGLSEIELAGIAGAYFLGSLSSAIIVCRLMGLGDPRQEGSGNPGAT
PLSY_HALHL       -------------MLDV-----ILVIIGYLIGSISSAIVVCRAMNLGDPRQGGSGNPGAT
PLSY_PSEA8       -------------MVWL------LAILAYLLGSLSFAVLLSRWFGTQDPRASGSGNPGAT
PLSY_PSEAB       -------------MVWL------LAILAYLLGSLSFAVLLSRWFGTQDPRASGSGNPGAT
PLSY_PSEAE       -------------MVWL------LAILAYLLGSLSFAVLLSRWFGTQDPRASGSGNPGAT
PLSY_PSEA7       -------------MVWL------LAILAYLLGSLSFAVLLSRWFGTQDPRASGSGNPGAT
PLSY_AZOVD       -------------MVWL------LAILAYLLGSLSFAILLSQLSGGPDPRACGSGNPGTT
PLSY_PSE14       ----------MVSMFWL------LATFAYLLGSLSFAILLSRLSGRPDPRASGSGNAGAT
PLSY_PSEU2       ----------MVRMFWL------LTTFAYLLGSLSFAILLSRLSGRPDPRASGSGNAGAT
PLSY_PSESM       ----------MVSMFWL------LATFAYLLGSLSFAILLSRLSGSPDPRASGSGNAGAT
PLSY_PSEFS       -------------MFWL------LAILAYLLGSLSFAILLSRLTGNPDPRMSGSGNAGAT
PLSY_PSEPF       -------------MFWL------LAILAYLLGSLSFAILLSRLTGNPDPRMSGSGNAGAT
PLSY_PSEF5       -------------MFWL------LAIFAYLLGSLSFAILLSRLTGNPDPRMSGSGNAGAT
PLSY_PSEP1       -------------MFWL------LALLAYLLGSLSFAIVLSRLSGSPDPRSSGSGNAGAT
PLSY_PSEPK       -------------MFWL------LALLAYLLGSLSFAIVLSRLSGSPDPRSSGSGNAGAT
PLSY_PSEPG       -------------MFWL------LALLAYLLGSLSFAIVLSRLSGSPDPRSSGSGNAGAT
PLSY_PSEPW       -------------MFWL------LALLAYLLGSLSFAIVLSRLSGSPDPRSCGSGNAGAT
PLSY_PSEE4       -------------MFWS------LALLAYLLGSLSFAIVLSRLTGSPDPRSSGSGNAGAT
PLSY_CHRSD       ---------MSSPLPMT-----ALVLAGYLSGSLLGAVWVCRALGRRDPRHAGSRNPGFS
PLSY_HAHCH       ---------MEHPFQLL-----MATSIAYLLGSIMGAYWVCRYFQLPDPTESGSGNPGAT
PLSY_RHIE6       ------MLSNLMSWHITLPIALAAAVIGYLFGSIPFGLILTRAAGLGDVRSIGSGNIGAT
PLSY_RHIEC       ------MLSNLMSWQITLQIALAAAVIGYLLGSIPFGLILTRAAGLGDVRSIGSGNIGAT
PLSY1_RHIL3      ------MLSNLMSWQITLPIALAAAIIGYLFGSIPFGLILTRAAGLGDVRSIGSGNIGAT
PLSY_AGRFC       -------MSALTDWQTAPALLALAALIGYLLGSIPFGLILTRMAGLGDVRKIGSGNIGAT
PLSY_RHIME       --------MDMFSWQLGLPSTLACLVFGYLLGSIPFGLILTRMAGLGDVRKIGSGNIGAT
PLSY_SINMW       --------MDIFSWQLGLPSTLACLVFGYLLGSIPFGLILTRMAGLGDVRKIGSGNIGAT
PLSY_SINFN       --------MDLFSWQLGLPATLLCLAFGYLLGSIPFGLILTRMAGLGDVRKIGSGNIGAT
PLSY_AGRVS       -------MPSLDYSQVTITALIASLAIGYLLGSIPFGLLLTRMAGLGDVRNIGSGNIGAT
PLSY_BRUA1       ----------MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGSGNIGAT
PLSY_BRUA2       ----------MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGSGNIGAT
PLSY_BRUAB       ----------MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGSGNIGAT
PLSY_BRUC2       ----------MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGSGNIGAT
PLSY_BRUSU       ----------MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGSGNIGAT
PLSY_BRUMB       ----------MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGSGNIGAT
PLSY_BRUME       ----------MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGSGNIGAT
PLSY_BRUO2       ----------MAEPGFFNAMLIGALIFGYVLGSIPFGLILTRLAGLGDVRAIGSGNIGAT
PLSY_BRUSI       ----------MAEPGFFNAMLIGALIFGYVLGSIPFGLILARLAGLGDVRAIGSGNIGAT
PLSY_OCHA4       ----------MAEPGFLSLTLIGALVFGYFLGSIPFGLILTRLAGLGDVRSIGSGNIGAT
PLSY_RHILO       ----------------MTYGLILALVFGYLLGSIPFGLLLTRAAGLGDVRKIGSGNIGAT
PLSY_BRASB       --------------MGPEAFLPVALIIGYLFGSIPFGLILTKLAGTQDLRSIGSGNIGAT
PLSY_BRASO       --------------MGSEAMLPVALLIGYLLGSIPFGLILTKLAGTQDLRSIGSGNIGAT
PLSY_BRADU       --------------MGLEAFLPVALVIGYLLGSIPFGLVLTRLAGTQDIRSIGSGSIGAT
PLSY_RHOP2       ---------------MLIGIYIAALLLGYLFGSIPFGLILTKIAGTEDLRSIGSGNIGAT
PLSY_RHOPS       ----------------MIGIYIAALVLGYLFGSIPFGLILTRIAGTEDLRSIGSGNIGAT
PLSY_RHOPA       ---------------MMIGIYIAALVIGYLFGSIPFGLILTKIAGTQDLRSIGSGNIGAT
PLSY_RHOPT       ---------------MMIGIYIAALVIGYLFGSIPFGLILTKIAGTQDLRSIGSGNIGAT
PLSY_RHOPB       ----------------MILIDTASLIVGYLLGSIPFGLILTRLAGTQDLRSIGSGNIGAT
PLSY_NITHX       --------------MLSSAIAVIAFAIGYLFGSIPFGMILTRIAGTQDLRSIGSGNIGAT
PLSY_NITWN       --------------MFPNGL--IAFAFGYLLGSIPFGMILTRIAGTQDLRSIGSGNIGAT
PLSY_METC4       ---------MTTLLAAGWPVLITALVLGYACGAIPFGLILTKFAGLGDVRTIGSGNIGAT
PLSY_METEP       ---------MTTLLAAGWPVLIAALVLGYACGAIPFGLILTKFAGLGDVRAIGSGNIGAT
PLSY_METPB       ---------MTPLLAAGWPALIAALVLGYACGAIPFGLILTKVAGLGDVRTIGSGNIGAT
PLSY_CAUVN       ---------MQDLAAIAYLTLGIAIVGGYLLGSIPFGLIATRLGGAGDIRQIGSGNIGAT
PLSY_CAUVC       ---------MQDLAAIAYLTLGIAIVGGYLLGSIPFGLIATRLGGAGDIRQIGSGNIGAT
PLSY_RHOS1       ----------MPAIESGLWALILTGVLGYLLGSIPFGIVITRALGLGDLRKIGSGNIGAT
PLSY_RHOS4       ----------MPAIESGLWALILTGVLGYLLGSIPFGIVITRALGLGDLRKIGSGNIGAT
PLSY_RHOSK       ----------MPAIESGLWALILTGVLGYLLGSIPFGIVITRALGLGDLRKIGSGNIGAT
PLSY_RHOS5       ----------MPAIESGLLALILTGVLGYLLGSIPFGIVITRAFGLGDLRRIGSGNIGAT
PLSY_ROSDO       ------------MIESTLPALALWGVIGYLLGSIPFGMVLAKVMGLGNLRDIGSGNIGAT
PLSY_RUEST       ---------MLPALETTLPLLLFWGGIGYLLGSVPFGMVITRAFGLGNLREIGSGNIGTT
PLSY_RUEPO       ----------MPAFDTPAMMLILWAVIGYGLGSIPFGLILTRAMGMGDLRQIGSGNIGTT
PLSY_JANSC       ---------MIPLIETSALLLGLTALLAYLLGSVPFGIMMARLFGLGDLRSVGSGNIGAT
PLSY_DINSH       ----------MPELTTAPGLLALVGLAAYLLGAIPFGLLIAKLFGLGNLREIGSGNIGAT
PLSY_MAGSA       -----------------MLELVAATLGGYLLGSVPFGLVLTRLAGLGDIRQIGSGNIGAT
PLSY_RHORT       --------MADLSTLMPALVLGVCALAGYLLGSVPFGLVLVRLAGLGDVRGIGSGNIGAT
PLSY_MARMM       --------------MTSLLIALAAAAGGYLFGSIPFGLVLTRMAGLGDIRAIGSGNIGAT
PLSY_HYPNA       --------------MPEWALYALAAVAGYLSGSIPFGLVIVKAAGLGDIREIGSKSIGAT
PLSY_ERYLH       --------------MDYNLDPSIAALIGYAFGSIPFGLLLTRMAGMGDVRSIGSGNIGAT
PLSY_NOVAD       --------------MECGVETLLPLVVGYVLGSVPFGLILTRLTGAGDLRAIGSGNIGAT
PLSY_GLUOX       -------------MSGFQAQLILLSLVSYVIGSIPFGLLLTAVAGGGDIRKIGSGNIGAT
PLSY_GRABC       -------------MNGTMTSYCLALLGGYLLGSIPFGLILTRLSGAGDIRKIGSGNIGAT
PLSY_ZYMMO       --------------MSLEMIAVLIFTMGYLLGSVPFGLILARLFGSVDVRQVGSGNIGAT
PLSY_ANAD2       --------------MSPDLLGALLVAAGYLAGSIPFGVVLGRLVLGVDVRTVGSGNIGAT
PLSY_ANASK       --------------MSPDLLGALLVAAGYLAGSIPFGVVLGRLVLGVDVRTVGSGNIGAT
PLSY_ANADE       --------------MSPDLLGAVLVAAGYLAGSIPFGVVLGRLVLGVDVRTVGSGNIGAT
PLSY_ANADF       --------------MSDTVLGLVLVAAGYLAGSIPFGVVLGRFVLGVDVRQVGSGNIGAT
PLSY_MYXXD       -------------------MTSALVLLGYLAGSIPFGVLLTRWLRGVDVRTGGSGNIGAT
PLSY_DEIGD       ----------------MILITSLAVLVSYLIGSIPAAAWVARRRG-VDIRKVGSGNSGAT
PLSY1_DEIRA      ----------------MTLTALLALLLSYLIGAIPAAAWLARARG-VDIRKVGSGNSGAT
PLSY_THET2       -----------------MTAAVWTLLLAYLFGSIPAGVLVARTYG-VDIRKVGSGNIGAT
PLSY_THET8       -----------------MTAAVWTLLLAYLFGSVPAGVLVARTYG-VDLRKVGSGNIGAT
PLSY_RUBXD       ------------------MLEVLLVLLGYVLGSVPTGILVGRAYG-VDVRKVGSGNIGTA
PLSY_ROSS1       --------------MMPTIASIALVLLAYLSGSIPFSLLVARAWG-VDLRVSGSGNVGAA
PLSY1_DEHM1      ----------------------MSLLIGYFLGSIPSAYLVTRRLTGRDIRQMGGGNMGGL
PLSY1_DEHMC      ----------------------MSLLTGYLLGSIPSAYLVTRRLIGRDIRQMGGGNVGGL
PLSY2_DEHM1      --------------MNSLIMVIIALIAAYFIGSTPAPYLAGRIFKGIDIRTVGSKNMGSM
PLSY2_DEHMC      --------------MNSLIMVIIALIAAYFIGSTPAPYLAGRIFKKIDIRTVGSKNMGSM
PLSY5_DEHM1      ----------------MSLVFIIMAIAGYLVGAIPMAYLLSRWRRGIDIRRYGSGNVGAS
PLSY4_DEHMC      ----------------MSPVFLIMIPAGYLVGAIPMAYLLSRWRRGIDIRRYGSGNVGAS
PLSY4_DEHM1      -------------------MPLLFVLLSYLLGTFPSAYLAGYLSTDRDIRLMGDHNMGAQ
PLSY1_MOOTA      --------------MLSWTVILTGIFMAYAVGSLAGGHFLSKILYNADVRQVGSGNAGTM
PLSY1_DESHY      ---------MKLASKEAGMIDLFMILGAYLLGGMSTGYYLVKLWRQEDVRNQGSGATGAT
PLSY_NOSS1       -------------MGFWLSLCGAVVLVAYLLGSFPTGYIAVKQLKGIDIREVGSGSTGAT
PLSY_TRIV2       -------------MGLWLSLCGAVVVVAYLLGSFPTGYIAVKQLKGIDIREVGSGSTGAT
PLSY_TRIEI       -------------MINWLVLNAVILIVAYLLGATPSGYWIGSWFYGVDIREQGSGSTGAT
PLSY_ACAM1       -------------MAIWLLCNGVLLIVAYFLGSFPTGYLLGKALQGIDIREHGSKSTGAT
PLSY2_RHIL3      -------------MVFWIA-GAVGLAIAYLLGSTPSGYLAGKLIRGIDIREHGSKSTGAT
PLSY_SYNJA       -------------MPAWLS-ALLAALGGYLLGSIPTGYWVGRCWGGIDLRQAGSGSTGAT
PLSY_SYNJB       ----------------MLT-ALLAVLGGYLLGSIPTGYWVGRWWGGIDIRQQGSGSTGAT
PLSY_SYNE7       ----------------MLLSVVAIALLAYLLGSFPAGYLAGRWLKGIDIRKEGSGSTGAT
PLSY_SYNP6       ----------------MLLSVVAIALLAYLLGSFPAGYLAGRWLKGIDIRKEGSGSTGAT
PLSY_CROS5       ---------------MAFLISALLILIGYLLGSIPTGYLTGLHLKGIDVRQHGSGSTGAT
PLSY_RIPO1       ---------------MAWAISGLLVILGYLLGSIPTGYLMVRALKGIDIREQGSGSTGAT
PLSY_SYNY3       -------------MTTALLLCLCLLLITYLMGSIPTGYLAGKLLLGIDIREHGSKSTGAT
PLSY_THEEB       --------------MTTAVILGLLALISYLLGSIPTGYLLAKALRGIDIREHGSGSTGAT
PLSY_GLOVI       ---------------MNWPLALGIWAASYLAGSLPAGYLAGRRLKNIDIREFGSGSTGAT
PLSY_PROM2       -------------------MNILIIFASYLLGSLPTGFLIGKYLKNIDLRTIGSGSTGAT
PLSY_PROMS       -------------------MNILIIFTSYLLGSLPTGFLIGKYLKNIDLRTIGSGSTGAT
PLSY_PROM0       -------------------MNILIIFASYLLGSLPTGFLIGKYLKNIDLRTIGSGSTGAT
PLSY_PROM9       -------------------MNILIIFVSYLLGSLPTGFLIGKYLKNIDLRNIGSGSTGAT
PLSY_PROM5       -------------------MTIIIIVLSYFLGSIPTGFLFGKFLKNIDLRLIGSGSTGAT
PLSY_PROMP       -------------------MHILIISISYFLGSLPTGFLFGKFLKNIDLRLTGSGSTGAT
PLSY_PROM1       -------------------MNLLILFFGYLFGSFPSGYLAGRIAKGIDIRSLGSGSTGAT
PLSY_PROMT       -------------------MNLLILFFGYLFGSFPSGYLAGRIAKGIDIRSLGSGSTGAT
PLSY_PROM4       ------------MELTKIFLAFLCIGVSYSLGSFPSGFIAGKWLKGIDLRKVGSGSTGAT
PLSY_PROMA       ------------MDFSISTIALFTLLVSYLLGSLPSGYLAGKWILGIDLREIGSGSTGAT
PLSY_SYNPX       --MLPFLRDPAACLVPVILTALLLLAIGYLLGSTPSGYLAGRWLKGIDLRDCGSGSTGAT
PLSY_SYNSC       -------------MIQTAFTALLLLAIGYLLGAIPSGYLAGRWLKGIDLRDCGSGSTGAT
PLSY_SYNS9       ----------------MLLSSLLLLALGYLLGSMPNGYLAGRWLKGIDLRQCGSGSTGAT
PLSY_PROMM       -------------MFNSLFGNLLSLVMGYLLGSLPSGYLAAHWLAGIDLREKGSGSTGAT
PLSY_DESRM       ---------------MVHITTVMIIIGAYLIGSIPFGFLLAYFWKGIDIRKCGSGNIGAT
PLSY_DESAP       ---------------MSALAVILVIGLSYLVGSVPTGYLIARHVKGIDIRGHGSGNIGAT
PLSY2_MOOTA      -------------------MWLLALVVAYLIGSIPTAYVVGRYLYGFDIRRRGSGNVGAT
PLSY_CARHZ       -------------------MIILAALLAYILGSVPFGYLTSKYLWGVDITKKGSGNIGAT
PLSY_BACSU       ------------------MLIALLIILAYLIGSIPSGLIVGKLAKGIDIREHGSGNLGAT
PLSY_BACVZ       ------------------MLIALLIILAYVIGSIPSGLIVGKLAKGIDIREHGSGNLGAT
PLSY_BACLD       ------------------MLIALLFILAYLLGSIPSGLIVGKAAKGIDIREHGSGNLGAT
PLSY_GEOKA       -------------------MTALILLLAYLLGSIPFGLLVGKIGYGIDIREHGSGNLGGT
PLSY_GEOSW       ------------------MEKALILITAYLLGSIPFALLVGKIGYGIDIREHGSGNLGGT
PLSY3_BACAN      -----------------MVTTYLLFIVAYLLGSIPFALVVGKIGYGIDIREHGSGNLGGT
PLSY2_BACHK      -----------------MVTTYLLFIVAYLLGSIPFALVVGKIGYGIDIREHGSGNLGGT
PLSY_BACC2       -----------------MVTTYLLFIVAYLLGSIPFALVVGKIGYGIDIREHGSGNLGGT
PLSY2_BACCR      -----------------MVTTYLLFIVAYLLGSIPFALVVGKIGYGIDIREHGSGNLGGT
PLSY2_BACCZ      -----------------MVTTYLLFIVAYLLGSIPFALVVGKIGYGIDIREHGSGNLGGT
PLSY2_BACC1      -----------------MVTTYLLFIVAYLLGSIPFALVVGKIGYGIDIREHGSGNLGGT
PLSY_BACCN       -----------------MFITYLLLIVAYLLGSIPFALVVGKIGYGIDIREHGSGNLGGT
PLSY2_OCEIH      ------------------MDYVIFGLVAYLLGSIPSALIVGKVGYNIDIREHGSGNLGAT
PLSY_LISMC       ----------------MTINLILLSLLAYVIGSIPSGLWIGKIFYKKDIRDFGSGNLGAT
PLSY_LISMF       ----------------MTINLILLSLLAYVIGSIPSGLWIGKIFYKKDIRDFGSGNLGAT
PLSY_LISMH       ----------------MTINLILLSLLAYVIGSIPSGLWIGKIFYKKDIRDFGSGNLGAT
PLSY_LISMO       ----------------MTINLILLSLLAYVIGSIPSGLWIGKIFYKKDIREFGSGNLGAT
PLSY_LISIN       ----------------MTINLILLSLLAYVIGSIPSGLWIGKIFYKKDIRDFGSGNLGAT
PLSY_LISW6       ----------------MTINLILLSLLAYVIGSIPSGLWIGKFFYKKDIREFGSGNLGAT
PLSY2_BACAN      -------------------MNILTLILSYLIGSISFALIVGKMFYKKDIRDYGSGNLGAT
PLSY_EXIS2       -----------------MIEIIGILILGYLLGSIPFALLVGKWGHGIDIRQHGSGNLGTT
PLSY_STRR6       ------------------MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTT
PLSY_STRZJ       ------------------MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTT
PLSY_STRZP       ------------------MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTT
PLSY_STRP2       ------------------MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTT
PLSY_STRPJ       ------------------MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTT
PLSY_STRP4       ------------------MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTT
PLSY_STRPN       ------------------MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTT
PLSY_STRP7       ------------------MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTT
PLSY_STRPI       ------------------MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTT
PLSY_STRPS       ------------------MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTT
PLSY_STRZT       ------------------MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTT
PLSY_STRGC       -----------------MINTILGLILAYLLGSIPTGLWIGQIFFKKNLREYGSGNTGTT
PLSY_STRSV       -----------------MMNTIIGLILAYLLGSIPTGLWIGQIFFKKNLREYGSGNTGTT
PLSY_LACLM       -----------------MLIIILLLIASYLLGAIPFGLWIGKIFFKKNLHDYGSGNTGTT
PLSY_LACLS       -----------------MLIIILLLIASYLLGAIPFGLWIGKIFFKKNLHDYGSGNTGTT
PLSY_LACLA       -----------------MLTIILLLIASYLLGAIPFGLWIGKIFFKKNLHDYGSGNTGTT
PLSY_STRA3       ------------------MNIIIMIIIAYLLGSIQTGLWIGKYFYQVNLRQHGSGNTGTT
PLSY_STRA5       ------------------MNIIIMIIIAYLLGSIQTGLWIGKYFYQVNLRQHGSGNTGTT
PLSY_STRA1       -----------------------MIIIAYLLGSIQTGLWIGKYFYQVNLRQHGSGNTGTT
PLSY_STRT1       ------------------MKILLLILIAYLLGSIQTGLWIGKVFFHTNLREHGSGNTGTT
PLSY_STRT2       ------------------MKILLLILIAYLLGSIQTGLWIGKVFFHTNLREHGSGNTGTT
PLSY_STRTD       ------------------MKILLLILIAYLLGSIQTGLWIGKVFFHTNLREHGSGNTGTT
PLSY_STREM       ------------------MKLILLILTAYLLGSIPTGLWIGQYFYNINLREHGSGNTGTT
PLSY_STRS7       ------------------MKLILLILTAYLLGSIPTGLWIGQYFYNINLREHGSGNTGTT
PLSY_STRE4       ------------------MKLILLILTAYLLGSIPTGLWIGQYFYNINLREHGSGNTGTT
PLSY_STRPM       ------------------MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTT
PLSY_STRPZ       ------------------MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTT
PLSY_STRP6       ------------------MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTT
PLSY_STRP8       ------------------MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTT
PLSY_STRPB       ------------------MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTT
PLSY_STRPC       ------------------MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTT
PLSY_STRPD       ------------------MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTT
PLSY_STRPF       ------------------MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTT
PLSY_STRPG       ------------------MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTT
PLSY_STRP1       ------------------MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTT
PLSY_STRP3       ------------------MKLLLFITIAYLLGSIPTGLWIGQYFYHINLREHGSGNTGTT
PLSY_STRMU       ------------------MKLILLIIAAYLLGSIPTGLWIGKYFYGKNLRDYGSGNMGTT
PLSY_LACBA       ------------------MKLIGLLIVAYLLGAIPNGVWVGKAFFQTDIRQAGSGNIGTT
PLSY_LACPL       ------------------MKIIIMLIIAYLIGAIPSGVIIGKFFFHTDIRQAGSGNIGTT
PLSY_LACP3       ------------------MILVLCFILAYFIGAIPFGVVIGKLFYHTDIRKGGSHNIGTT
PLSY_LACCB       ------------------MILVLCFILAYFIGAIPFGVVIGKLFYHTDIRKGGSHNIGTT
PLSY_LACSS       ------------------MKLSLIFILAYLIGSFPSGVIIGRVFCHKDPRDAGSHNIGTT
PLSY_LACRD       ----------------MFFEIIGMIIIAYLLGSIPTGLWIGKYIYHKDIRKLGSGNIGTT
PLSY_LACRJ       ----------------MFFEIIGMIIIAYLLGSIPTGLWIGKYIYHKDIRKLGSGNIGTT
PLSY_LACS1       ----------------MDIKIILMLIIGYLLGSIPSGVWIGKIFYNKDIRNYGSGNMGTT
PLSY_ENTFA       ------------------MKIVILLLVAYLLGSIPSGVWIGKLFFKKDIRQFGSGNTGTT
PLSY2_LACAC      ---------------MFALKFASLFILAYLLGSFPAGVVVGKIFFYKDIRKYGSGNIGTT
PLSY2_LACJO      ---------------MSTLNYLLIFILAYLIGSFPTGVLVGKIFFHEDIRNFGSGNIGTT
PLSY_STAA1       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAA2       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAA9       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAAW       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAAM       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAAN       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAAR       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAAS       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAAB       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAA3       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAA8       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAAT       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAAC       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAAE       ------------------MMIIVMLLLSYLIGAFPSGFVIGKLFFKKDIRQFGSGNTGAT
PLSY_STAEQ       ------------------MMIIVMLILSYLIGAFPSGLIIGKLFFKKDIRQYGSGNTGAT
PLSY_STAES       ------------------MMIIVMLILSYLIGAFPSGLIIGKLFFKKDIRQYGSGNTGAT
PLSY_STAHJ       ------------------MMIVVMLILSYLIGAIPNGYVIGKLFFKKDIRQYGSGNTGAT
PLSY_STAS1       ------------------MMIVIMLILSYLIGAFPSGYVIGKLFFKKDIRQFGSGNTGAT
PLSY_STACT       ------------------MMIVLMLLLAYIVGSFPSGVIIGKIFFKKDIRQFGSGNTGAT
PLSY_MACCJ       ------------------MQIALLLLIAYLLGAIPTGLIVGKLFFNKDIRKFGSGNLGAT
PLSY_PELLD       -----------------MMTLLAILAVSYIIGSIPTSIMAGKMLKRIDIRQFGSGNAGGT
PLSY_CHLPM       -----------------MLTLLAILTVSYIIGSIPTSIMAGKMMKGIDIRNFGSGNAGGT
PLSY_CHLL2       -----------------MLTLLAILAVSYLIGSIPTGIMAGKMLKGIDIRKFGSGNAGGT
PLSY_PELPB       -----------------MLTLLAILAVSYIIGSIPTSLVAGKLLKGIDIRNFGSGNAGGT
PLSY_CHLCH       -----------------MLTLLAILVVSYIVGSIPTSLIAGKMLKSIDIRDFGSGNAGGT
PLSY_CHLPD       -----------------MLTLIAILAISYLVGAIPTGIMAGKMLKGIDIRQFGSGNAGGT
PLSY_CHLP8       -----------------MLTFLAIITVAYLIGSIPTSIIAGRMLKGIDIREFGSGNAGGT
PLSY_CHLTE       -----------------MLTFLAIIVVAYLIGSIPTSIIAGKLLKGIDIREFGSGNAGGT
PLSY_CHLPB       -----------------MFTLIVILAVSYLIGSIPTSIIAGRLLKGIDIRDFGSGNAGGT
PLSY_PROA2       -----------------MLTLIVILAVSYLIGSIPTSIIAGKLLRGIDVRDYGSGNAGGT
PLSY_SALRD       -----------------MWSLTVILLISYFLGSIPGALWSSKALHGVDIRNHGSHNCGAT
PLSY_THEP3       ------------------MYAVLTAIIAYLIGCINNAYILTKYTRKIDIRNYGSGNAGAT
PLSY_THEPX       ------------------MYAVLTAIIAYLIGCINNAYIFTKYTRNIDIRNYGSGNAGAT
PLSY_CALS4       ------------------MKFVLVAVLAYLIGCINNAYIFTKYTRNIDIRNYGSGNAGAT
PLSY_ALKMQ       ------------------MINLLVIISAYFIGNFSTSFIVGKLTSNIDIRQHGSGNAGST
PLSY_CLOD6       ---------------MEIFSYIIIAVVAYLLGNISTSYIVAKRIAGVDIRTQGSGNAGST
PLSY_FINM2       ---------------MNYLYLIILGIVCYFIGNISGSIAISKLVYKQDIRNYGSKNAGAT
PLSY_SYNWW       ---------------MQEAALLVL---CYLLGSIPFSYFFTRMLTRQDIRKRGSGNVGAT
PLSY2_DESHY      -----------------MWEY-AIFIIAYLLGAIPFAYWAGR-YKGMDVRKHGSGNIGTT
PLSY_SYMTH       -----------------MAELVSVAILGYLLGSIPVGFLMGK-LRGIDVRRYGSGATGGT
PLSY_BACHD       ----------------MELGWLL-VIGSYLLGSVSFSYIIAKKIKKVDIRQHGSGNAGAT
PLSY_BACSK       ----------------MIVSLIATVLFGYLLGSVSFSYIIAKKIKKIDIRSEGSGNAGAT
PLSY3_DEHM1      ---------------MLIAKLLLVVIVSYLLGSIPFGYLVSHRGSKIDIRSYGSGRTGAT
PLSY3_DEHMC      ---------------MLIAKLLLVVIVSYILGSIPFGYLVSHRGSKIDIRSFGSGRTGAT
PLSY_AQUAE       ------------------MKALFLVIFAYLLGSITFGEVIAK-LKGVDLRNVGSGNVGAT
PLSY_HYDS0       ---------------MGFIIGFLLSVFGYLLGSILFAKIVAS-YKGIDITSVGSKSAGAT
PLSY1_BACAN      --------MQKVNDYMINSMQFLYLVASYLFGNILTAYIVTKWRHNVDIRDEGSGNPGAR
PLSY1_BACCZ      -----------MSDYMINSMQFLYLVASYLFGNILTAYIVTKWRHNVDIRDEGSGNPGAR
PLSY1_BACHK      ---------------MINSMQFLYLVASYLFGNILTAYIVTKWRHNVDIRDEGSGNPGAR
PLSY1_BACC1      ---------------MINSMQFLYLVASYLFGNILTAYIVTKWRHDVDIRNEGSGNPGAR
PLSY1_BACCR      ---------------MINSMQFLYLVASYLIGNILTAYIVTKLRHNVDIRDEGSGNPGAR
PLSY1_LACAC      ------------------MARIYATLIGYVFGNFLTAMIVGKLFLKINPTEYGSHNPGTA
PLSY1_LACJO      ------------------MDEFVSLVIGYFLGNILFAMIVTKIFLHKDPTKYGSGNPGTA
PLSY_MYCCT       ----------MKGFYMYYLGIILASVVGYFLGSISWSIIIVKKVGNIDIRTIGSGNPGAT
PLSY_MYCMS       ----------MKGFYMYYLGIILASVIGYFLGSISWSIIIVKKVGNIDIRTVGSGNPGAT
PLSY_MESFL       --------------MFPYLGIIIASIFGYLLGSVLWSVPITKWVKGVSIYEVGSNNPGAT
PLSY_MYCAP       ----------MNILYSILINLALFLLGYLLLGSFNTSIILSRRVKNDDIREHNSKNAGAT
PLSY_MYCS5       ----------MEIFLSIAINILIFWIGYLI-GSLNASIIVGKLFYKKDVREFHSKNAGAT
PLSY_MYCMO       ----------MSLEVIFGSNILLILVAYFI-GSINFSIIVSKIFKKSDIREKGSKNAGAT
PLSY_MYCPU       ----------MPDFVIVLINLAFCLGAYLF-GSINFSIIYSK-FKKNDVRKLGSGNAGST
PLSY_UREP2       ------MDQVYNIVMAYILTLIISPLYSYLIGSLNASIILSLVFKKQDVRLFASKNAGMT
PLSY_UREPA       ------MDQVYNIVMAYILTLIISPLYSYLIGSLNASIILSLVFKKQDVRLFASKNAGMT
PLSY_UREU1       ------MDQVYSVAMAYILTLIISPLYSYLIGSLNASIILSLLLKKQDIRHFASKNAGMT
PLSY_MYCGE       ----------MNQASAIAILVIFSLASGYLLGSIIFADIFSKILKKN-VREFGSKNPGAT
PLSY_MYCPN       ----------MNAASAIALLIVFSLVIGYLMGSVMFADVFGKILNKD-VRKLGSKNPGAT
PLSY_MYCGA       ----------MNVAGYISLLVILSLLIGYLFGSIMFADVASMILKRN-VRELGSKNPGTT
PLSY_PSELT       ------------------MNYILIGLISYFCGAIPFSYLLPK-LRKIDIRRTGSGNVGGT
PLSY_THEM4       ------------------MEYIYSIFIGYFFGAIPFSFFIAK-LKGIDIRKTGSGNVGGT
PLSY_KOSOT       ------------------MRFIWLAIIGYLFGSIPWGYIIPK-LRGIDIRKVGSGNVGGT
PLSY2_THEMA      ------------------MGWWLFPILGYFIGSIPFSYLIPKWLKGIDVRKVGSGNVGAT
PLSY_THEP1       ------------------MGWWLFPILGYFIGSIPFSYLIPKWLKGIDVRKVGSGNVGAT
PLSY_ANAMF       -----------MNLLMGYTYLIPILFASYLIGSIPFSWILVKVFYKRDLRSVGSGNIGAT
PLSY_ANAMM       -----------MNLIMGYTYLIPILFASYLIGSIPFSWILVKVFYKRDLRSVGSGNIGAT
PLSY_ANAPZ       -------------------MFIAILMGAYLLGSIPFAYILTKLMAKRDIREVGSKNVGAT
PLSY_EHRCJ       -----------------MNIYTSILVLSYLIGSIPFGLILSYIGGLGDIRKIGSGNIGAT
PLSY_EHRCR       -----------------MNIHAVVIVLSYLIGSIPFGLILSYIGGLGDIRKVGSGNIGAT
PLSY_EHRRG       -----------------MDFQVVIFILCYFIGSIPFGFILSYVTGIGDIRKTGSGNIGAT
PLSY_EHRRW       -----------------MDFQVVIFILCYLIGSIPFGFILSYVIGIGDIRKTGSGNIGAT
PLSY_BARHE       ---------MNEGEILFQFTTWLIFLISYLIGSIPFGLLLTKLAKLGDVRTIGSGNIGAT
PLSY_BARQU       ---------MNESETLLQFYTWSIFLMSYLIGSIPFGLLFTRLAKLGDVRAIGSGNIGAT
PLSY_BART1       ---------MNETEIFFQSTPWFIFLISYLIGSIPFGLLFTKLAKLGDIRTIGSGNIGAT
PLSY_BARBK       ---------MNQIEIFFQFYAYFLLLISYFIGSIPFGLLFTRFAKLGDVRTIGSGNIGTT
PLSY_PELUB       ------------------MEYLIVALSSYLLGSIPFGFILTKIFLKKDIRDIGSGNIGAT
PLSY_WOLPM       ------------------MEKYVVLILSYILGSIPFSLIITRIKGI-NLREVGSGNIGAT
PLSY_WOLPP       ------------------MEKYIILILSYVIGSIPFSLIIAKINGI-NLREVGSGNIGAT
PLSY_WOLTR       ------------------MEKYIVFVLSYILGSIPFSLVITKIKGI-NLREVGSGNIGAT
PLSY_ARCB4       -------------MDFLTNQNIVFYLLAYLIGSIPFGLILAKTFAGVDIKSQGSKSIGAT
PLSY_SULDN       -------------MDFLFNTNAQFFIAAYLIGAIPFGLLLAKKYAGVDVKSSGSGSIGAT
PLSY_WOLSU       -------------MSFISNPNIHFYLLAYFIGGIPFGYLLSRFFYNINLQEVGSGSIGAT
PLSY_NITSB       -------------MDFFTNPNVLFYITAYLVGGIPFGYILAKIFAGVDIKQSGSKSIGAT
PLSY_CAMJ8       ------------------MENLIIYAFIYLLGSIPFGLILAKFFAKTDIKKEGSKSIGAT
PLSY_CAMJJ       ------------------MENLIIYAFIYLLGSIPFGLILAKFFAKTDIKKEGSKSIGAT
PLSY_CAMJE       ------------------MENLIIYAFIYLLGSIPFGLILAKFFAKTDIKKEGSKSIGAT
PLSY_CAMJR       ------------------MENLIIYAFIYLLSSIPFGLILAKFFAKTDIKKEGSKSIGAT
PLSY_CAMJD       ------------------MENLIIYAFIYLLGSISFGLILTKFFAKTDIKKEGSRSIGAT
PLSY_CAMLR       ------------------MENLIIYLLAYLIGAIPFGLLLAQIFAKTNIKNAGSKSIGAT
PLSY_CAMC1       ------------------MQNLILYAVSYLLGSIPSGLILAKIFGHVDIKKEGSKSIGAT
PLSY_HELPH       ---------MEGVLNFLTNINVIFTLLGYLIGGIPFGYALMKIFYGMDITKIGSGGIGAT
PLSY_HELPJ       ---------MEGVLNFLTNINVIFTLLGYLIGGIPFGYALMKIFYGMDITKIGSGGIGAT
PLSY_HELPY       ---------MESVLNFLTNINVIFTLLGYLIGGIPFGYALMKIFYGMDITKIGSGGIGAT
PLSY_HELAH       ---------MDGVLNFLTNINVIFTLLGYLIGGIPFGYALMKIFYGMDITKIGSGGIGAT
PLSY_HELHP       ------MSFLSSVLYTLSNINMIFYIVAFLFGGIPFGWLLVKVLYKVDIRDIGSKSIGAT
PLSY_MYCPE       -----------MNIGNLIGIIILFLFIGYFIGNILFGILISKSQG-VDIRTLGSGNVGAT
PLSY_NEOSM       ------------MASAFEMNRLAFIIFVYVIAAIPFGRCISACFG-VDICTRGSGNIGAT
PLSY1_OCEIH      ------------------MYYVIASLLGYIFGCIHGSQIVGKLKG-INIKDGGVKNAGAS
PLSY1_THEMA      ------------------MLNFFLITIQFLSGAVMYSHIIAKIKG-IDLRKIRDGNPGSS
PLSY2_DEIRA      --------------MRAVVSLAVVFVLSYLLGSLVAGVLYSR---GRGEDIRGRDLPGGS
                                                .                            

PLSY_AYWBP       NAFRVL-------GKKWGILVFLLDFCKGFVPLTIFLHFSEFWPTEPSTQTFLQPHL---
PLSY_ONYPE       NALRVL-------GKKWGILVFLLDFCKGFVPLTICLHFSKFWLTEPSTKTFLQPNP---
PLSY_PHYAS       NASRIL-------GFKWGIVVFLFDFAKGLVPAIICLRFKNF-KDLIFINGCDNRYK---
PLSY_ACHLA       NVLRVL-------GAKYGIPTFLLDCFKGALPIIIIRYMLGMPELFLISDTYDIS-----
PLSY_CLOAB       NVKRVA-------GTKISMITQVMDILKGIIPVLLCMLIASKIKLPISTSMYLSI-----
PLSY_GEOMG       NVYRTL-------GRSVGIATLVGDCLKGLIPVLAAKYL---------GMTDLWI-----
PLSY_GEOSL       NVYRTL-------GRTVGIATLLGDCLKGLVPVLVARKL---------GFADPWV-----
PLSY_GEODF       NVYRTL-------GRRVGIMTLIGDCLKGLIPVLIARHL---------QLPEIWV-----
PLSY_GEOLS       NLYRTV-------GRKVGILTLTGDCLKGLLPVLLAWKL---------GHAEPMQ-----
PLSY_PELCD       NVYRVA-------GKKLGVLTLIGDALKGAVPVLIAIKLT--------DLGDAQV-----
PLSY_KORVE       NVARTG-------AKGLAVLTLLLDAVKGWVAVFAATIFIARVSNPANVDVRLIP-----
PLSY_FUSNN       NSYRVL-------GAKLGVAVLIMDVLKGFIPLYIASKF---------NLVYNDL-----
PLSY_UNCTG       NVFREI-------GKCAGVITLIADILKGFIPVYFATFI---------DNSFSYS-----
PLSY_DESAD       NVARLC-------GFKYGVAALVLDVAKGFVPVLMAYQYSH---------NWIFI-----
PLSY_DESMR       NVSRLC-------GTKLGVLTLVLDLAKGLVPVLCARAMTD---------SPVFL-----
PLSY_DESAG       NVARLC-------GTGFGVLTLVCDVLKGVVPVAVAMTFSD---------SAVFF-----
PLSY_DESVH       NVARLC-------GTKVGVLTLVCDALKGAIPVAVALSISD---------STVFH-----
PLSY_DESDA       NVARLC-------GFGWGVATLLCDVLKGAVPVWLAFRINA---------SPVFV-----
PLSY_LAWIP       NITRIC-------GRKLGFITLFFDVLKGFFPVVIATYLSE---------SPFMY-----
PLSY_LEPBJ       NVGRSI-------GWKFGFPVLVLDVAKGIFPVYLSGIYIP-------EGGVPFQ-----
PLSY_LEPBL       NVGRSI-------GWKFGFPVLVLDVAKGIFPVYLSGIYIP-------EGGVPFQ-----
PLSY_LEPIC       NVGRLI-------GWKFGFVVLALDITKGMLPVYLSSVYVP-------EGGIPFQ-----
PLSY_LEPIN       NVGRLI-------GWKFGFIVLALDITKGMLPVYLSSVYVP-------EGGIPFQ-----
PLSY_DESPS       NVSRIL-------GKKLGFATLLCDSLKGFLPMVLAATLLPSS-----ENRELIV-----
PLSY_ECOLI       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_SHIB3       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_SHISS       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_SHIBS       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_SHIDS       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECO24       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECO27       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECO45       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECO55       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECO57       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECO5E       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECO7I       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECO81       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECO8A       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECOBW       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECODH       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECOHS       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECOK1       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECOL5       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECOL6       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECOLC       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECOLU       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECOSE       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECOSM       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ECOUT       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_SHIF8       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_SHIFL       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_ESCF3       NVLRMG-------GKGAALAVLIFDVLKGMLPVWGAYELGVSP-----------------
PLSY_SALSV       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGVTP-----------------
PLSY_SALTI       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGVTP-----------------
PLSY_SALTY       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGVTP-----------------
PLSY_SALA4       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGVTP-----------------
PLSY_SALCH       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGVTP-----------------
PLSY_SALDC       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGVTP-----------------
PLSY_SALEP       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGVTP-----------------
PLSY_SALG2       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGVTP-----------------
PLSY_SALHS       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGVTP-----------------
PLSY_SALNS       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGVTP-----------------
PLSY_SALPA       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGVTP-----------------
PLSY_SALPB       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGVTP-----------------
PLSY_SALPK       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGVTP-----------------
PLSY_CITK8       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAYALGVTP-----------------
PLSY_SALAR       NVLRIG-------GKGAAVAVLIFDILKGMLPVWGAYALGITP-----------------
PLSY_ENT38       NVLRIG-------GKRAAVAVLVFDVLKGMLPVWGAYMLGVTP-----------------
PLSY_CROS8       NVLRIG-------GKGAALAVLIFDVLKGMLPVWGAYALGVTP-----------------
PLSY_KLEP3       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAWALGLTP-----------------
PLSY_KLEP7       NVLRIG-------GKGAAVAVLIFDVLKGMLPVWGAWALGLTP-----------------
PLSY_PECAS       NVLRIG-------GKAAAATVLVFDILKGMLPVWGAYALGVTP-----------------
PLSY_PECCP       NVLRIG-------GKAAAATVLVFDVLKGMLPVWAAYALGVSP-----------------
PLSY_YERP3       NVLRIG-------GRTAAVAVLLFDILKGMLPVWIAYLLHIPP-----------------
PLSY_YERPA       NVLRIG-------GRTAAVAVLLFDILKGMLPVWIAYLLHIPP-----------------
PLSY_YERPB       NVLRIG-------GRTAAVAVLLFDILKGMLPVWIAYLLHIPP-----------------
PLSY_YERPE       NVLRIG-------GRTAAVAVLLFDILKGMLPVWIAYLLHIPP-----------------
PLSY_YERPN       NVLRIG-------GRTAAVAVLLFDILKGMLPVWIAYLLHIPP-----------------
PLSY_YERPP       NVLRIG-------GRTAAVAVLLFDILKGMLPVWIAYLLHIPP-----------------
PLSY_YERPS       NVLRIG-------GRTAAVAVLLFDILKGMLPVWIAYLLHIPP-----------------
PLSY_YERPY       NVLRIG-------GRTAAVAVLLFDILKGMLPVWIAYLLHIPP-----------------
PLSY_YERE8       NVLRIG-------GRTAAATVLIFDVLKGMLPVWIAYLLHVSP-----------------
PLSY_SERP5       NVLRIG-------GRVAAAAVLVFDILKGMLPVWLAYKLDVPP-----------------
PLSY_ERWT9       NVLRIG-------GRGVAATVLVFDVLKGMLPVWLAYHLGATP-----------------
PLSY_EDWI9       NVLRNG-------GRLAAAAVLIFDVLKGMIPVWLAYTLEMSP-----------------
PLSY_PHOLL       NVLRIG-------GRSTAAIVLICDVLKGMIPVWLAYQLYVPP-----------------
PLSY_PROMH       NVLRIG-------GKLAAASVLICDVLKGMIPVWLAYYLNVPP-----------------
PLSY_SODGM       NVLRLG-------GKLAAAGVMVFDVLKGMIPVWIGYGLGLPP-----------------
PLSY_HAEI8       NVLRIG-------NRKSALAVLIFDMLKGMIPVWAGYYLGLTQ-----------------
PLSY_HAEIG       NVLRIG-------NRKSALAVLIFDMLKGMIPVWAGYYLGLTQ-----------------
PLSY_HAEIN       NVLRIG-------NRKSALAVLIFDMLKGMIPVWAGYYLGLTQ-----------------
PLSY_HAEIE       NVLRIG-------NRKSALAVLIFDMLKGMIPVWAGYYLGLTQ-----------------
PLSY_PASMU       NVLRIG-------GRWVALSVLLFDMLKGMLPVWLGYYLGLTH-----------------
PLSY_ACTSZ       NVLRIG-------GRWAALAVFVFDVLKGMIPVWCGYYLGLTQ-----------------
PLSY_MANSM       NVLRIG-------GRWAALAVLIFDILKGMIPVWCGYYLGLTP-----------------
PLSY_HAES1       NVLQKG-------EYRLVLVVFLCDVLKGMLPVWVGYYLGLTY-----------------
PLSY_ACTP2       NVLRIG-------GKFSALGVLLFDILKGGLPVLLAFNFKLEP-----------------
PLSY_ACTP7       NVLRIG-------GKFSALGVLLFDILKGGLPVLLAFNFKLEP-----------------
PLSY_ACTPJ       NVLRIG-------GKFSALGVLLFDILKGGLPVLLAFNFKLEP-----------------
PLSY_HAEDU       NVLRNG-------GKLAAIGVLLFDTLKGSLPVLIAFRCDLSP-----------------
PLSY_HAEPS       NVLRIG-------GKLSALGVLMADILKGMLPVSLGFYLELPI-----------------
PLSY_AERS4       NVLRLG-------GRVAALVVLLLDVLKGTAPVYLAWYLQIKP-----------------
PLSY_TOLAT       NVLRSG-------NRLAALIVFLLDMLKGTIPVYLAWYLGIPP-----------------
PLSY_ALIF1       NVFRIG-------GRSAAGLVLLCDILKGMLPVWGGYFLEINP-----------------
PLSY_ALIFM       NVFRIG-------GRSAAGLVLLCDILKGMLPVWGGYFLEINP-----------------
PLSY_ALISL       NVFRLG-------GKGAAGLVLLCDILKGMLPVWGGYFLESNP-----------------
PLSY_PHOPR       NVLRLG-------GKSAASMVLVCDVLKGMLPVWLSYFLNINP-----------------
PLSY_VIBC3       NVLRIG-------GKKAAVAVLLCDMLKGTIPVWGGYFLNIEP-----------------
PLSY_VIBCH       NVLRIG-------GKKAAVAVLLCDMLKGTIPVWGGYFLNIEP-----------------
PLSY_VIBCM       NVLRIG-------GKKAAVAVLLCDMLKGTIPVWGGYFLNIEP-----------------
PLSY_VIBCB       NVLRIG-------GKGAAVAVLLCDMLKGTIPVWGGYFLGIDP-----------------
PLSY_VIBPA       NVLRIG-------GKGAAVSVLLCDMLKGTIPVWGGYFLGIDP-----------------
PLSY_VIBTL       NVLRVG-------GKGAAAAVLLCDMLKGTIPVWLGYYLKIDP-----------------
PLSY_VIBVU       NVLRIG-------GKGAAAAVLLCDMLKGTIPVWSGYYLGIEP-----------------
PLSY_VIBVY       NVLRIG-------GKGAAAAVLLCDMLKGTIPVWSAYYLGIEP-----------------
PLSY_IDILO       NVYRVG-------GKIPALLTLWFDVLKGMVPVWGSYFLGIEP-----------------
PLSY_PSEA6       NVLRIG-------GRLPAALVFIFDVLKGTLPVYVGYLLGMPP-----------------
PLSY_COLP3       NVLRIS-------NKFTAATVLFLDILKGTIPVWGAYFLKIDS-----------------
PLSY_PSEHT       NVYRLG-------GALPACLVLIFDVLKGTIPVWGAYFLDLEP-----------------
PLSY_SHEB2       NVLRIG-------GASSAAMVLFFDMLKGAVPSYLAYLMGIDA-----------------
PLSY_SHEB5       NVLRIG-------GASSAAMVLFFDMLKGAVPSYLAYLMGIDA-----------------
PLSY_SHEB8       NVLRIG-------GASSAAMVLFFDMLKGAVPSYLAYLMGIDA-----------------
PLSY_SHEB9       NVLRIG-------GASSAAMVLFFDMLKGAVPSYLAYLMGIDA-----------------
PLSY_SHESA       NVLRIG-------GASSAAMVLFFDMLKGALPTYLAYLMGIDA-----------------
PLSY_SHESR       NVLRIG-------GASSAAMVLFFDMLKGALPTYLAYLMGIDA-----------------
PLSY_SHESM       NVLRIG-------GASSAAMVLFFDMLKGALPTYLAYLMGIDA-----------------
PLSY_SHEON       NVLRIG-------GASSAAMVLFFDMLKGALPTYLAYLMGIDA-----------------
PLSY_SHEPC       NVLRIG-------GASSAAMVLFFDMLKGALPTYLAYLMGIDA-----------------
PLSY_SHESW       NVLRIG-------GASSAAMVLFFDMLKGALPTYLAYLMGIDA-----------------
PLSY_SHEHH       NVLRIG-------GASSAALVLFCDMLKGAAPAYLAFRLGVDP-----------------
PLSY_SHESH       NVLRIG-------GASSAAMVLFFDMLKGALPAYIAFRLGIDQ-----------------
PLSY_SHEWM       NVLRIG-------GVSSAALVLFFDMLKGALPAYIAFRLGLDS-----------------
PLSY_SHELP       NVLRIG-------GASAAAMVLLFDMLKGAVPAYVAFRLGVDA-----------------
PLSY_SHEDO       NVLRIG-------GLSSAVMVLLFDMLKGAIPSYISYKLGLDS-----------------
PLSY_BLOFL       NILRII-------NYKIAIFVLLFDSLKGAVPIWLGTYFHIDP-----------------
PLSY_BLOPB       NILRIA-------GLKIAISVILFDILKGAIPMWLGYHLKISP-----------------
PLSY_COXB1       NMLRVG-------GRQAAFYVLLGDAAKGLIAVLIARFLNVQG-----------------
PLSY_COXBU       NMLRVG-------GRQAAFYVLLGDAAKGLIAVLIARFLNVQG-----------------
PLSY_COXBN       NMLRVG-------GRQAAFYVLLGDAAKGLIAVLIARFLNVQG-----------------
PLSY_COXBR       NMLRVG-------GRQAAFYVLLGDAAKGLIAVLIARFLNVQG-----------------
PLSY_COXB2       NMLRVG-------GRQAAFYVLLGDAAKGLIAVLIARFLNVQG-----------------
PLSY_FRAT1       NVLRIG-------GKVPAAITLIFDILKGLVPVVIAKVLTGNE-----------------
PLSY_FRATT       NVLRIG-------GKVPAAITLIFDILKGLVPVVIAKVLTGNE-----------------
PLSY_FRATF       NVLRIG-------GKVPAAITLIFDILKGLVPVVIAKVLTGND-----------------
PLSY_FRATH       NVLRIG-------GKVPAAITLIFDILKGLVPVVIAKVLTGND-----------------
PLSY_FRATN       NVLRIG-------GKVPAAITLIFDILKGLVPVVIAKVLTGNE-----------------
PLSY_FRATO       NVLRIG-------GKVLAAITLIFDILKGLVPVVIAKVLTGND-----------------
PLSY_FRATM       NVLRIG-------GKVPAAITLIFDILKGLVPVVIAKVLTGNE-----------------
PLSY_FRAP2       NVLRIG-------GNVPAIITLAFDILKGLVPVVLAKVLTGNE-----------------
PLSY_LEGPC       NVLRLG-------GKQYGIMVMVFDALKGILPVILAKLLSAEP-----------------
PLSY_LEGPH       NVLRLG-------GKQYGIMVMVFDALKGILPVILAKFLSAEP-----------------
PLSY_LEGPA       NVLRLG-------GKQYGIMVMVFDALKGILPVILAKLLSAEP-----------------
PLSY_LEGPL       NVLRLG-------GKQYGIMVMVFDALKGILPVILAKLLSAEP-----------------
PLSY_RUTMC       NVLRIG-------GKKAAAITLIGDGLKGAIPVLIAHYLAFNM-----------------
PLSY_AROAE       NVLRSG-------NKAAALLTLVGDCAKGWLAVWGA----AKLGF---------------
PLSY_LARHH       NVLRSG-------NKLAALLTLLGDAAKGWLAVWLAQTYGASFGL---------------
PLSY_DECAR       NVLRSG-------NKKAALVTLIGDALKGWAAVFIA----QRMGF---------------
PLSY_NITEC       NVLRTG-------KKVAAAVTLLGDAGKGWVAVVVAKYLGNVLGL---------------
PLSY_NITEU       NVLRTG-------KKAAAAVTLLGDAGKGWVAVAAAKYGGEVWEL---------------
PLSY_NITMU       NVLRSG-------KKSAAIFTLLGDGGKGWLAVALAEYSAPLLEL---------------
PLSY_METFK       NVLRSG-------KKLAALLTLLGDAAKGWLPVWLAQYYA----L---------------
PLSY_BORBR       NVLRTG-------NKTAAALTLLGDAAKGWFALWLARALVPEL-----------------
PLSY_BORPE       NVLRTG-------NKTAAALTLLGDAAKGWFALWLARALVPEL-----------------
PLSY_BORPA       NVLRTG-------NKTAAALTLLGDAAKGWFALWLARALVPEL-----------------
PLSY_BORPD       NVLRSG-------NKAAAALTLLGDAFKGWFALWLAQMLAPGL-----------------
PLSY_BORA1       NVLRTG-------NKTAAALTLLGDAAKGWFALWLALKLAPGL-----------------
PLSY_BURA4       NVLRSG-------NKKAAILTLVGDAFKGWLAVWLARHFGLP------------------
PLSY_BURCM       NVLRSG-------NKKAAILTLVGDAFKGWLAVWLARHFGLP------------------
PLSY_BURL3       NVLRSG-------NKKAAILTLVGDAFKGWIAVWLARHLGLP------------------
PLSY_BURVG       NVLRSG-------NKKAAILTLVGDAFKGWLAVWLARHFGMP------------------
PLSY_BURCA       NVLRSG-------NKKAAILTLVGDAFKGWIAVWLARHFGLP------------------
PLSY_BURCH       NVLRSG-------NKKAAILTLVGDAFKGWIAVWLARHFGLP------------------
PLSY_BURCJ       NVLRSG-------NKKAAILTLVGDAFKGWIAVWLARHFGLP------------------
PLSY_BURCC       NVLRSG-------NKKAAILTLVGDAFKGWIAVWLARHFGLP------------------
PLSY_BURM1       NVLRSG-------NKKAAILTLIGDAFKGWIAVWLARRYGLP------------------
PLSY_BURP1       NVLRSG-------NKKAAILTLVGDAFKGWLAVWLVKRFGIGG-----------------
PLSY_BURPS       NVLRSG-------NKKAAILTLVGDAFKGWLAVWLVKRFGIGG-----------------
PLSY_BURMA       NVLRSG-------NKKAAILTLVGDAFKGWLAVWLVKRFGIGG-----------------
PLSY_BURTA       NVLRGG-------NKKAAILTLVGDAFKGWLAVWLVKHFGIGG-----------------
PLSY_PARPJ       NVLRSG-------NKKAAILTLIGDAFKGWLPVWFVVHYGARYGL---------------
PLSY_PARXL       NVLRSG-------SKKAAILTLIGDAFKGWLPVWFVVHFGARYGL---------------
PLSY_PARP8       NVLRSG-------NKKAAILTLIGDAFKGWLAVWLTGHFSAHFGL---------------
PLSY_CUPTR       NVLRTG-------NKKAAILTLIGDALKGWLAVWLAARFGPAHGL---------------
PLSY_CUPNH       NVLRTG-------NKKAAILTLIGDALKGWLAVWLAARFGPAYGL---------------
PLSY_CUPMC       NVLRTG-------NKKAAIFTLIGDALKGLAAVLLAKHFGPAYGV---------------
PLSY_CUPPJ       NVLRTG-------NKKAAIFTLIGDGLKGWLAVWLASRFGPAYGL---------------
PLSY_RALPJ       NVLRSG-------NKKAAILTLLGDAAKGGLAVWLAQWLAPRFGV---------------
PLSY_RALSO       NVLRSG-------NKKAAILTLLGDAAKGWLAVWLAQLLAPRYGV---------------
PLSY_HERAR       NVLRSG-------NKKAAILTLLGDGAKGFVAVWLVKHFGPDYGV---------------
PLSY_JANMA       NVLRSG-------NKKAAILTLLGDGAKGFLAVWLVKHFGPGYGV---------------
PLSY_RHOFT       NVLRSG-------SKTAAIVTLLLDAAKGWLPVMLVRWYGKPYGM---------------
PLSY_CHRVO       NVLRTG-------KKLAAALTLLGDGAKGWVAVALASWLGPRYGL---------------
PLSY_THIDA       NVLRTG-------RKTAAILTLLGDALKGWVAVVAARGLAAQFGL---------------
PLSY_NEIG1       NVLRSG-------KKKAAALTLLGDAAKGLVAVLLARVLQEPLGL---------------
PLSY_NEIG2       NVLRSG-------KKKAAALTLLGDAAKGLVAVLLARVLQEPLGL---------------
PLSY_NEIMA       NVLRSG-------KKKAAALTLLGDAAKGLVAVLLARVLQEPLGL---------------
PLSY_NEIMF       NVLRSG-------KKKAAVLTLLGDAAKGLVAVLLARVLQEPLGL---------------
PLSY_NEIM0       NVLRSG-------KKKAAALTLLGDAAKGLVAVLLARVLQEPLGL---------------
PLSY_NEIMB       NVLRSG-------KKKAAALTLLGDAAKGLVAVLLARVLQEPLGL---------------
PLSY_METCA       NVLRLG-------GKRAAILTLLGDASKGLIPLLIAKSMAVS------------------
PLSY_THISH       NVLRTG-------RKGAAIITLLGDLLKGLVPVLVAHALGLE------------------
PLSY_NITOC       NILRLG-------SKRLAGIVLLGDALKGFLPVWLAQEVGAN------------------
PLSY_HYDCU       NVKRLY-------GSKPAAITLLGDMLKGVVPVALANMAGWS------------------
PLSY_HALHL       NVLRLA-------GKVPAGITLLGDWLKGTLPVLLAWLATED------------------
PLSY_PSEA8       NMLRVA-------GKKLAILTLLGDVGKGLLPVLVARWLGLGV-----------------
PLSY_PSEAB       NMLRVA-------GKKLAILTLLGDVGKGLLPVLVARWLGLGV-----------------
PLSY_PSEAE       NMLRVA-------GKKLAILTLLGDVGKGLLPVLVARWLGLGV-----------------
PLSY_PSEA7       NMLRVA-------GKKLAILTLLGDVGKGLLPVLVARWLGLGV-----------------
PLSY_AZOVD       NMLRIA-------GKRLAALTLLGDLGKGLLPVLIAQHAGLGV-----------------
PLSY_PSE14       NMLRLA-------GKKLAILTLLGDLCKGLLPILIASAWNLNI-----------------
PLSY_PSEU2       NMLRLA-------GKKLAILTLLGDLCKGLVPILIASTLSMDI-----------------
PLSY_PSESM       NMLRLA-------GKKLAVLTLLGDLCKGLIPVVLAGAWGLDP-----------------
PLSY_PSEFS       NMLRLA-------GKKLAVLTLLGDMCKGLLPVLIASLAGLTL-----------------
PLSY_PSEPF       NMLRLA-------GRKLAILTLLGDLCKGLLPVLIASAMGLSL-----------------
PLSY_PSEF5       NMLRLA-------GKKLAVLTLLGDLCKGLAPVLIAHLAGLSL-----------------
PLSY_PSEP1       NMLRLA-------GRKLAILTLLGDLCKGLLPVLLARVAGLDL-----------------
PLSY_PSEPK       NMLRLA-------GRKLAILTLLGDLCKGLLPVLLARAAGLDL-----------------
PLSY_PSEPG       NMLRLA-------GRKLAILTLLGDLCKGLLPVLLARAAGLDL-----------------
PLSY_PSEPW       NMLRLA-------GRKMAILTLLGDLCKGLLPVMLARLAGLDL-----------------
PLSY_PSEE4       NMLRLA-------GRKLAILTLLGDLCKGMLPVLLARQVGLDP-----------------
PLSY_CHRSD       NVLRLH-------GVVPAALTLGVDAAKAMPVLWVAQREALPI-----------------
PLSY_HAHCH       NIYRLG-------GPVPATLTLFWDAAKGAAAVCIAAMLGLSP-----------------
PLSY_RHIE6       NVLRTG-------NRKLAAATLLLDALKASAAAWIVGYFLGEEA----------------
PLSY_RHIEC       NVLRTG-------NRKLAAATLLLDALKASAAAWIVGYFLGEEA----------------
PLSY1_RHIL3      NVLRTG-------NRTLAAATLLLDALKASAAAWVVSYFLGEEA----------------
PLSY_AGRFC       NVLRTG-------NKKLAAATLLLDALKGTAAVLVANALWGYEA----------------
PLSY_RHIME       NVLRTG-------NRKLAAATLLFDALKGTAAAAIAS-YWGVEA----------------
PLSY_SINMW       NVLRTG-------NKKLAATTLLLDALKGTAAAAIAS-LWGVEA----------------
PLSY_SINFN       NVLRTG-------NKKLAAATLLLDALKGTAAAAIAS-LWGVEA----------------
PLSY_AGRVS       NVLRTG-------NKKLAAATLLLDALKATAAALIAQKLFGSDTV---------------
PLSY_BRUA1       NVLRTG-------NKKLAAATLILDALKGTAAALIAAHFGQNAA----------------
PLSY_BRUA2       NVLRTG-------NKKLAAATLILDALKGTAAALIAAHFGQNAA----------------
PLSY_BRUAB       NVLRTG-------NKKLAAATLILDALKGTAAALIAAHFGQNAA----------------
PLSY_BRUC2       NVLRTG-------NKKLAAATLILDALKGTAAALIAAHFGQNAA----------------
PLSY_BRUSU       NVLRTG-------NKKLAAATLILDALKGTAAALIAAHFGQNAA----------------
PLSY_BRUMB       NVLRTG-------NKKLAAATLILDALKGTAAALIAAHFGQNAA----------------
PLSY_BRUME       NVLRTG-------NKKLAAATLILDALKGTAAALIAAHFGQNAA----------------
PLSY_BRUO2       NVLRTG-------NKKLAAATLILDALKGTAAALIAAHFGQNAA----------------
PLSY_BRUSI       NVLRTG-------NKKLAAATLILDALKGTAAALIAAHFGQNAA----------------
PLSY_OCHA4       NVLRTG-------NKKLAAATLIFDMLKGTVAVLVASRYGPDAA----------------
PLSY_RHILO       NVLRTG-------NKGLAAATLLLDALKGTAAVLIAGHFAPETA----------------
PLSY_BRASB       NVLRTG-------RKGLAAGTLLGDALKGTAAVIISGYLG--------------------
PLSY_BRASO       NVLRTG-------RKGLAAATLLGDALKGTAAVIIAGYLG--------------------
PLSY_BRADU       NVLRTG-------RKSLAAGTLLLDALKGTVAVVIAGYIA--------------------
PLSY_RHOP2       NVLRTG-------RKGLAAATLLLDALKGTAAVIIASSFG--------------------
PLSY_RHOPS       NVLRTG-------RKGLAAATLLLDALKGTAAVLIAAGFG--------------------
PLSY_RHOPA       NVLRTG-------RKGLAAATLLLDALKGTAAVIVAAYLASGTDA--------------I
PLSY_RHOPT       NVLRTG-------RKGLAAATLLLDALKGTAAVIVAAYLASGTDA--------------I
PLSY_RHOPB       NVLRTG-------RKGLAAATLLGDALKGTAAVLIAASLG--------------------
PLSY_NITHX       NVLRTG-------RKGLAAATLVGDMLKGTAAVLVAGLLW--------------------
PLSY_NITWN       NVLRTG-------RRGLAAATLLGDMLKGTAAVVIALLLS--------------------
PLSY_METC4       NVLRTG-------RKGLAAATLLCDALKGTLPVLAASHWG--------------------
PLSY_METEP       NVLRTG-------RKGLAAATLLCDALKGTLPVLAASHWG--------------------
PLSY_METPB       NVLRTG-------RKGLAAATLLCDALKGTLPVLAAGQWG--------------------
PLSY_CAUVN       NVLRSG-------RKDLAAITLLGDAGKGVVAVLLARYLTNGNPA---------------
PLSY_CAUVC       NVLRSG-------RKDLAAITLLGDAGKGVVAVLLARYLTNGNPA---------------
PLSY_RHOS1       NVLRTG-------NKPAALATLLLDSGKGAIAVLIARAAVGED-----------------
PLSY_RHOS4       NVLRTG-------NKPAALATLLLDSGKGAIAVLIARAAVGED-----------------
PLSY_RHOSK       NVLRTG-------NKPAALATLLLDSGKGAIAVLIARAAVGED-----------------
PLSY_RHOS5       NVLRTG-------NRPAALATLLLDSGKGAIAVLIARAAVGED-----------------
PLSY_ROSDO       NVLRTG-------NKLAAALTLVLDGGKGVVAVLAARAAGGED-----------------
PLSY_RUEST       NVLRTG-------SKAAAAATLLLDGGKGAAAVLLARALAGED-----------------
PLSY_RUEPO       NVLRTG-------NKGAAALTLLLDGGKGAVAVLLARAFAGED-----------------
PLSY_JANSC       NVLRTG-------NKLAAFLTLVLDAGKGAIAVFLARALLGED-----------------
PLSY_DINSH       NVLRTG-------SKPAAAATLILDAGKGAFAVILARVLVGED-----------------
PLSY_MAGSA       NVLRTG-------RKGLALATLLLDGGKGAIAVGLVWVLLGR----------------EM
PLSY_RHORT       NVLRTG-------RKDLALATLVLDSGKGAIAALVASALASRIAGF------------ED
PLSY_MARMM       NVLRTG-------RKDLAALTLILDAGKAGIAAAVFGYFLGT------------------
PLSY_HYPNA       NVLRTG-------RKDLALATFLLDSLKAGLVALAFTLLAGR------------------
PLSY_ERYLH       NVLRTG-------NKGLAALTLVLDLVKGFVPVWIAWRYFQ-------------------
PLSY_NOVAD       NVLRTG-------KKGLAAATLLLDLGKGLAAVLIVRHVWP-------------------
PLSY_GLUOX       NVLRTG-------RRGLAAATLLLDALKGALAVLIARFFFPGASE---------------
PLSY_GRABC       NVLRTG-------RKGLAATTLLLDGGKGAAAALLAVHL---GGW---------------
PLSY_ZYMMO       NVLRTG-------RKDLAALTLFFDIGKGALAVLLAHGFSYHLYQQT-----------GC
PLSY_ANAD2       NVARAG-------GKKMGVLVLVLDAAKAIVPILVARRVLGGTPHAE-----------F-
PLSY_ANASK       NVARAG-------GKKMGVLVLVLDAAKAIVPILVARRVLAGTPHAE-----------V-
PLSY_ANADE       NVARAG-------GKKMGVLVLVLDAAKAIVPILLARRLLAGAPHAE-----------A-
PLSY_ANADF       NVARAG-------GKKLGIAVLLLDAAKAIVPILVARWLLAGTPRAE-----------L-
PLSY_MYXXD       NVTRVA-------GKKLGAVVLLLDAIKGALPVVLAVRLLPDAPTVH-------------
PLSY_DEIGD       NVLRSL-------GKGPALLVAAFDILKGAIAVGLARALGLDPA----------------
PLSY1_DEIRA      NVLRSL-------GKGPALLVASFDILKGVLAVLLARALGLSAE----------------
PLSY_THET2       NVLRAL-------GWGPALVVAFFDVFKGGIAVLVARAFGLSDW----------------
PLSY_THET8       NVLRAL-------GWGPALVVAFFDVFKGGIAVLVARAFGLSDW----------------
PLSY_RUBXD       NVMRAA-------GKGAAALTMLGDMLKGVAPVLLARALGAGPW----------------
PLSY_ROSS1       NVWRTC-------GFSAFALAMGGDMLKGALPTIAAQALGLSPL----------------
PLSY1_DEHM1      NTFREV-------GVGAGAAVVLMDLAKGALAVSVAYYLLIQNAQW--------------
PLSY1_DEHMC      NTFREV-------GTGAGISVAFIDLVKGTLAVSVSYYLLTQNAQW--------------
PLSY2_DEHM1      NVFYNV-------GFWPGILVLAVDIGKGALAMAVANWL-GEGLGI--------------
PLSY2_DEHMC      NVFYNV-------GFWPGILVLTTDIGKGALAMAVANWL-GEGLGI--------------
PLSY5_DEHM1      NVVKTA-------GKRLGLAVFIFDVSKGAVMILLSGAL-GLALWQ--------------
PLSY4_DEHMC      NVIKTA-------GKKLGLAVFVFDVSKGAIIILLAGWL-GLELWQ--------------
PLSY4_DEHM1      NAYRCL-------GRGWGLAVFVFDLAKGSLAITLALAA-GLSPGW--------------
PLSY1_MOOTA      NVLRNL-------GIAAGIMTFIWDTAKGFLVVTLGLKG--GGAEL--------------
PLSY1_DESHY      NAGRVL-------GKKGFLLTLMGDALKGALAPALSMHF-NLSLTT--------------
PLSY_NOSS1       NVLRTL-------GKGPGAFVLGLDCLKGVLAIALVYYLFTFASNQN--LIPTTVNIELW
PLSY_TRIV2       NVLRTL-------GKGPGAFVLGLDCLKGVLAIALVDYLFNFATSQN--LIPTTVNVQLW
PLSY_TRIEI       NVLRTL-------GNVPALVVLVIDIFKGALAIALVRYIYSLVFAQNLTIIAGVTDIDTA
PLSY_ACAM1       NVLRTL-------GKGPGLATLGVDICKGAGAVALVRWAYGNPMFLT--QAPATTNIGLW
PLSY2_RHIL3      NVLRTL-------GKWPALVVLLVDVLKGVGAVVFARWFYSWFSTLSSGMPPTALDLQSL
PLSY_SYNJA       NVLRTV-------GKGPALLVLLVDAAKGAAAVAL--------------------GSALG
PLSY_SYNJB       NVLRTL-------GKGPALLVLLVDAAKGAAAVAL--------------------GSALG
PLSY_SYNE7       NVLRVL-------GKGPALVVFITDILKGVLAVVAARA-----------IASTNGLDPSA
PLSY_SYNP6       NVLRVL-------GKGPALVVFITDILKGVLAVVAARA-----------IASTNGLDPSA
PLSY_CROS5       NILRTI-------GKRAAIFVLTVDLAKAMLAVILVKLWFFVE--------SPEMIPLEW
PLSY_RIPO1       NVLRTV-------GKTAAIAVLIIDMLKAMVAVGGVKLLYFGV--------PSAIVPLDW
PLSY_SYNY3       NVFRTL-------GKPAAIAVLAIDISKGVMAVALVRAIYSGD--------WLPALPAAW
PLSY_THEEB       NVLRVV-------GKGPGLVTFLVDVGKGLGAILVARWVLGQA---------WSPVPAGW
PLSY_GLOVI       NVLRTL-------GRGPAAAVLLFDVFKGLFAVWLARTLAG---------------GEDA
PLSY_PROM2       NVLRNV-------GKWPALFVFIIDVGKGFIAVKIAQYY-------------------TD
PLSY_PROMS       NVLRNV-------GKWPALFVFIIDVGKGLIAVKIAQYY-------------------TD
PLSY_PROM0       NVLRNV-------GKWPALFVFIIDLGKGLIAVKIAQYY-------------------TD
PLSY_PROM9       NVLRNV-------GKWPALIVFIIDVGKGLIAVKIAQHY-------------------TD
PLSY_PROM5       NVLRNV-------GKWPAFFVFIIDVGKGLLAVKLSQSY-------------------TN
PLSY_PROMP       NVLRNV-------GKWPAFFVFIIDVGKGLIAVKIAQHY-------------------TN
PLSY_PROM1       NVLRHI-------GKRAAIIVFLLDVFKGVLSILLAKYL-------------------LL
PLSY_PROMT       NVLRHI-------GKRAAITVFLLDVFKGVLSILLAKYL-------------------LL
PLSY_PROM4       NVLRHV-------GKKAALIVFLIDVSKGIGSILIAKSL-------------------FL
PLSY_PROMA       NVLRHV-------GKTPALFVFFIDVTKGIGAILIAKSF-------------------LL
PLSY_SYNPX       NVLRNV-------GKGPALVVFLIDVGKGALAVLLAKTF-------------------GL
PLSY_SYNSC       NVLRNV-------GKGPALVVFLIDVGKGALAVLLAKSV-------------------GL
PLSY_SYNS9       NVLRNV-------GKGPALVVFLLDVGKGALAVLLAKSF-------------------GL
PLSY_PROMM       NVLRQV-------GKGPALAVFLIDVGKGTTAVLVARAL-------------------EL
PLSY_DESRM       NVWRTL-------GKVPGMIVLILDMIKGISAVLLAKQL-------------------EN
PLSY_DESAP       NVWRTL-------GPGWGLASLVGDTAKGIVAVLLGRAV--------------------G
PLSY2_MOOTA      NTLRTM-------GTIPGLVVLGVDALKGVLAVLLGQAL--------------------G
PLSY_CARHZ       NVYRNL-------GPYPGAITAIGDVGKGMLAVYIGSLL--------------------A
PLSY_BACSU       NAFRTL-------GVKAGSVVIAGDILKGTLATALPFLMHVDIHP---------------
PLSY_BACVZ       NAFRTL-------GVKAGSVVIAADILKGTLAAALPYLLHVPIHP---------------
PLSY_BACLD       NAFRTL-------GVKAGSIVVAADILKGTLAAFLPAILHIGVHP---------------
PLSY_GEOKA       NTFRVL-------GAKAGTIVIVGDMLKGTLAASLPMLFSVPVHP---------------
PLSY_GEOSW       NTFRVL-------GVKAGMIVTCGDMLKGTLAASLPVLFSVHIHP---------------
PLSY3_BACAN      NTFRTL-------GKKAGFTVTIADILKGTLATSLPMVFGLDIHP---------------
PLSY2_BACHK      NTFRTL-------GKKAGFTVTIADILKGTLATSLPMVFGLDIHP---------------
PLSY_BACC2       NTFRTL-------GKKAGFTVTIADILKGTLATSLPMIFGLDIHP---------------
PLSY2_BACCR      NTFRTL-------GKKAGFTVTIADILKGTLATSLPMIFGLDIHP---------------
PLSY2_BACCZ      NTFRTL-------GKKAGFIVTIADILKGTLATSLPMVFGLDIHP---------------
PLSY2_BACC1      NTFRTL-------GKKAGFIVTIADILKGTLATSLPIIFALDIHP---------------
PLSY_BACCN       NTFRTL-------GKKAGFIVTIADILKGTLATGLPLIFSLDIHP---------------
PLSY2_OCEIH      NTFRIL-------GTKAGSIVTLADILKGTLATVLPQLFDANVYV---------------
PLSY_LISMC       NSFRVL-------GIKAGSIVTVMDILKGTVATLLPFFFQLNVDHH------F-------
PLSY_LISMF       NSFRVL-------GIKAGSIVTVMDILKGTVATLLPFFFQLNVDHH------F-------
PLSY_LISMH       NSFRVL-------GIKAGSIVTVMDILKGTVATLLPFFFQLNVDHH------F-------
PLSY_LISMO       NSFRVL-------GIKAGSIVTVMDILKGTVATLLPFFFQLNVDHH------F-------
PLSY_LISIN       NSFRVL-------GVKAGSIVTVMDILKGTVATLLPFFFQLNVNHH------F-------
PLSY_LISW6       NSFRVL-------GIKAGSIVTVMDILKGTVATLLPFFFQLHVDHH------F-------
PLSY2_BACAN      NAYRVL-------GIKAGVIVAIADILKGTFACLLPLILSSTINP---------------
PLSY_EXIS2       NTFRVL-------GKKAGIIVLIGDLGKGAVASLVPILLASELHP---------------
PLSY_STRR6       NTFRIL-------GKKAGMATFVIDFFKGTLATLLPIIFHLQ--------GVS-------
PLSY_STRZJ       NTFRIL-------GKKAGMATFVIDFFKGTLATLLPIIFHLQ--------GVS-------
PLSY_STRZP       NTFRIL-------GKKAGMATFVIDFFKGTLATLLPIIFHLQ--------GVS-------
PLSY_STRP2       NTFRIL-------GKKAGMATFVIDFFKGTLATLLPIIFHLQ--------GVS-------
PLSY_STRPJ       NTFRIL-------GKKAGMATFVIDFFKGTLATLLPIIFHLQ--------GVS-------
PLSY_STRP4       NTFRIL-------GKKAGMATFVIDFFKGTLATLLPIIFHLQ--------GVS-------
PLSY_STRPN       NTFRIL-------GKKAGMATFVIDFFKGTLATLLPIIFHLQ--------GVS-------
PLSY_STRP7       NTFRIL-------GKKAGMATFVIDFFKGTLATLLPIIFHLQ--------GVS-------
PLSY_STRPI       NTFRIL-------GKKAGMATFVIDFFKGTLATLLPIIFHLQ--------GVS-------
PLSY_STRPS       NTFRIL-------GKKAGMATFVIDFFKGTLATLLPIIFHLQ--------GVS-------
PLSY_STRZT       NTFRIL-------GKKAGMATFVIDFFKGTLATLLPIMFHLQ--------GVS-------
PLSY_STRGC       NTFRIL-------GKTAGTVTFAIDFLKGTLATLLPLFLHIN--------GIS-------
PLSY_STRSV       NTFRIL-------GKTAGTATFAIDFLKGTAATLLPFFLHIE--------GVS-------
PLSY_LACLM       NTFRIL-------GVKAGIAVFIFDLLKGTLATLLPLIFHIN--------GVS-------
PLSY_LACLS       NTFRIL-------GVKAGIAVFIFDLLKGTLATLLPLIFHIN--------GVS-------
PLSY_LACLA       NTFRIL-------GVKAGISVFAFDLLKGTLATLLPLFFHIN--------GVS-------
PLSY_STRA3       NTFRIL-------GVKAGIVTLTIDILKGTLATLIPIILGIT--------TVS-------
PLSY_STRA5       NTFRIL-------GVKAGIVTLTIDILKGTLATLIPIILGIT--------TVS-------
PLSY_STRA1       NTFRIL-------GVKAGIVTLTIDILKGTLATLIPIILGIT--------TIS-------
PLSY_STRT1       NTFRVL-------GKTAGTITFLVDMLKGTLAVLLPIWLGVT--------EVS-------
PLSY_STRT2       NTFRVL-------GKTAGTITFLVDMLKGTLAVLLPIWLGVT--------EVS-------
PLSY_STRTD       NTFRVL-------GKTAGTITFLVDMLKGTLAVLLPIWLGIT--------EVS-------
PLSY_STREM       NTFRIL-------GLKAGAATLLIDIFKGTLATLLPVLVGAS--------NVS-------
PLSY_STRS7       NTFRIL-------GLKAGAATLLIDIFKGTLATLLPVLVGAS--------NVS-------
PLSY_STRE4       NTFRIL-------GLKAGAATLLIDIFKGTLATLLPVLVGAS--------NIS-------
PLSY_STRPM       NTFRIL-------GVKAGTATLAIDMFKGTLSILLPIIFGMT--------SIS-------
PLSY_STRPZ       NTFRIL-------GVKAGTATLAIDMFKGTLSILLPIIFGMT--------SIS-------
PLSY_STRP6       NTFRIL-------GVKAGTATLAIDMFKGTLSILLPIIFGMT--------SIS-------
PLSY_STRP8       NTFRIL-------GVKAGTATLAIDMFKGTLSILLPIIFGMT--------SIS-------
PLSY_STRPB       NTFRIL-------GVKAGTATLAIDMFKGTLSILLPIIFGMT--------SIS-------
PLSY_STRPC       NTFRIL-------GVKAGTATLAIDMFKGTLSILLPIIFGMT--------SIS-------
PLSY_STRPD       NTFRIL-------GVKAGTATLAIDMFKGTLSILLPIIFGMT--------SIS-------
PLSY_STRPF       NTFRIL-------GVKAGTATLAIDMFKGTLSILLPIIFGMT--------SIS-------
PLSY_STRPG       NTFRIL-------GVKAGTATLAIDMFKGTLSILLPIIFGMT--------SIS-------
PLSY_STRP1       NTFRIL-------GVKAGTATLAIDMFKGTLSILLPIIFGMT--------SIS-------
PLSY_STRP3       NTFRIL-------GVKAGTATLAIDMFKGTLSILLPIIFGMT--------SIS-------
PLSY_STRMU       NTFRVL-------GPKAGLLTFTVDFLKGTLATLLPMWLGVT--------HIS-------
PLSY_LACBA       NTYRVL-------GPYAGTIVMVLDIAKGSVATLLPIVFHVQTV----LGTAT-------
PLSY_LACPL       NTYRVL-------GPTAGTIVMVMDILKGTIAALQPTLLFH-------MNNRY-------
PLSY_LACP3       NAYRML-------GPVGGSIVLVLDILKGTLAASLPILFGI-------EHHWL-------
PLSY_LACCB       NAYRML-------GPVGGSIVLVLDILKGTLAASLPILFGI-------EHHWL-------
PLSY_LACSS       NSYRVL-------GPIAGTAVLFLDILKGTLAASLPMIFHT-------SNHSL-------
PLSY_LACRD       NTFRTL-------GFKAGVVVLFIDILKGTLAASQPYFLGISG-------TVN-------
PLSY_LACRJ       NTFRTL-------GFKAGVVVLFIDILKGTLAASQPYFLGISG-------TVN-------
PLSY_LACS1       NTFRVL-------GKKAGIVVLLMDMLKGTITACLPFIFHVN---------VS-------
PLSY_ENTFA       NTFRVL-------GKPAGITVLLMDILKGTLATSLPYLFGLQ--------GVN-------
PLSY2_LACAC      NTFRVL-------GPVAGIIVFLIDFFKGTLATLIPVIFNL-------GPHYL-------
PLSY2_LACJO      NSFRVM-------GPVAGSAVLVIDVLKGTLATDLPLIFHLK------GPKYL-------
PLSY_STAA1       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLPVHADGPISTFFTN-------
PLSY_STAA2       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLPVHADGPISTFFTN-------
PLSY_STAA9       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLPVHADGPISTFFTN-------
PLSY_STAAW       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLPVHADGPISTFFTN-------
PLSY_STAAM       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLPVHADGPISTFFTN-------
PLSY_STAAN       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLPVHADGPISTFFTN-------
PLSY_STAAR       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLPVHADGPISTFFTN-------
PLSY_STAAS       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLPVHADGPISTFFTN-------
PLSY_STAAB       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLPVHADGPISTFFTN-------
PLSY_STAA3       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLQVHADGPISTFFTN-------
PLSY_STAA8       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLQVHADGPISTFFTN-------
PLSY_STAAT       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLQVHADGPISTFFTN-------
PLSY_STAAC       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLQVHADGPISTFFTN-------
PLSY_STAAE       NSFRVL-------GRPAGFLVTFLDIFKGFITVFFPLWLQVHADGPISTFFTN-------
PLSY_STAEQ       NSFRVL-------GRPAGFIVTFLDIFKGFITVFFPLWFPVHADGVISTFFTN-------
PLSY_STAES       NSFRVL-------GRPAGFIVTFLDIFKGFITVFFPLWFSVHADGVISTFFTN-------
PLSY_STAHJ       NSFRVL-------GKPAGFIVTFLDIFKGFITVFFPIWFPVHADGPLSTFFTH-------
PLSY_STAS1       NSFRVL-------GKPAGFLVTFLDIFKGFIVVFFPLWLPVQAEGPITTFFTN-------
PLSY_STACT       NSFRVL-------GRPAGFVVTFLDIFKGFIVVFFPLLFPVHPTGPISEFFTN-------
PLSY_MACCJ       NTFRVL-------GKKAGIFVTIFDVAKGVLPAIFPI---------IYDLDIH-------
PLSY_PELLD       NAFRVL-------GWKTGLSVTLIDIAKGVIAAVSVVAFFRMHPIGAYPDINE-------
PLSY_CHLPM       NAFRVL-------GWKTGLTVTLIDIVKGVVAAVSVVAFFRHHPIGAFPDINE-------
PLSY_CHLL2       NAFRVL-------GWKTGLTVTLIDIIKGVVAAVSVVAFFRHHPIDVFPDINE-------
PLSY_PELPB       NAFRVL-------GWKPGLVVTLIDIVKGVVAAVSVVAFFRHHPIGAFPDMNE-------
PLSY_CHLCH       NAFRVL-------GWKTGLTVTLIDIIKGVVAAVSVVAFFRHHPIDVFPDINE-------
PLSY_CHLPD       NAFRVL-------GWKAGLAVTLLDILKGIVAAVSIVAFFRHHPVGAFPDINE-------
PLSY_CHLP8       NAFRVL-------GWKAGLAVTLIDIAKGTIAAVPVVAFFKAHPLGAFPDMNE-------
PLSY_CHLTE       NAFRVL-------GWKAGLVVTLIDIAKGTIAAVPVVGFFKAHPLGAFPDMNE-------
PLSY_CHLPB       NAFRVL-------GWKAGLTVTILDIVKGAIAAISVVVFFESHPIGPLPDINP-------
PLSY_PROA2       NAFRVL-------GWKAGLAVTLLDIVKGAVAAISVVVFFEAHPLGAMPDINP-------
PLSY_SALRD       NAFRVV-------GWQAGALATVVDFGKGFLAAGVVASVIRIDPIPSGLSLFGG----DP
PLSY_THEP3       NVLRVL-------GYKAAAPVFALDVLKGVIAVLIGK---YLMGNTGAM-----------
PLSY_THEPX       NVLRVL-------GYKAAAPVFALDVLKGVIAVLIGK---YLMGNTGAM-----------
PLSY_CALS4       NVLRVL-------GPKAAAPVFVLDVLKGVVAVLLGK---YFIGMPGAL-----------
PLSY_ALKMQ       NVLRTL-------GVKAAALTFLGDTLKGMLSFYLAQ---RFVGEQAAL-----------
PLSY_CLOD6       NVLRTL-------GKRAGAMTFLGDVLKGVMAVLISEFAARLVGIDTLLA----------
PLSY_FINM2       NALRVY-------GVKVGLATFLIDFFKGLLCAYLGF---KFYGSLGIL-----------
PLSY_SYNWW       NVFRTS-------GPGVALLAFLGDLLKGLLAAWIGQ---STGSQLLLV-----------
PLSY2_DESHY      NAFRLL-------GAKLGVLVLLGDALKGALAAYLGYRFFGPWG----------------
PLSY_SYMTH       NVLRTL-------GPWAALFTVLCDIGKGLLAAYLGERLAGEWG----------------
PLSY_BACHD       NTLRVL-------GVGPAVTVLLLDILKGVIAVVV------TVQLTPDGDG---------
PLSY_BACSK       NTLRVL-------GIGPAICVLLLDVAKGVAPALL------AIALTNGDYP---------
PLSY3_DEHM1      NVLRTM-------GRKAALLVAALDVVKGVSAVAFAGLVIGTEALTFGTNGMA-------
PLSY3_DEHMC      NVLRTM-------GRKAALLVASLDVIKGASAVAFAGLVIGTEALAFGTNGMA-------
PLSY_AQUAE       NVTRAL-------GKKYGVLVFFLDFLKGFIPALIAVKSFGIDSWVLTFT----------
PLSY_HYDS0       NVTRTL-------GKKYGALVFLLDAFKGFLIAILDRFYIDPSSLWFGIV----------
PLSY1_BACAN      NMGRVY-------GKGYFVATFLGDAIKGAIVVSIAKYLFEDF-----------------
PLSY1_BACCZ      NMGRVY-------GKGYFVATFLGDAIKGAIVVSIAKYLFEDS-----------------
PLSY1_BACHK      NMGRVY-------GKGYFVATFLGDAIKGAIVVSIAKYLFEDS-----------------
PLSY1_BACC1      NMGRVY-------GKGYFIVTFLGDAIKGAIVVSIAEYLFGDS-----------------
PLSY1_BACCR      NMGRVY-------GKGYFIATFLGDAIKGAIVVAVAKYLFEDP-----------------
PLSY1_LACAC      NMGAVF-------GKKWGILTCLGDLLKSLIALFIVYFVFPGH-----------------
PLSY1_LACJO      NVGAVF-------GKKWGILTCIGDLAKTLAALLIVYFIYHGNR----------------
PLSY_MYCCT       NTVRAL-------GKKWGLVVAFLDALKVIFTSIIAILLSLIPSSL-------------F
PLSY_MYCMS       NTVRTL-------GKKWGLVVAFLDALKVVFTAIVAILLSMIPNDL-------------F
PLSY_MESFL       NTVRIL-------GKRWGLAVALLDGFKVLITAAFAIGLSMIPNEL-------------F
PLSY_MYCAP       NSLRTY-------GAKFALIVFATDVLKTLLPILIISAIVNHVPAVNAFS-----YASYI
PLSY_MYCS5       NSLRVF-------GYKVAIVILFIDIFKVVFATYFVRIVFPFVFSPKLYF-----YIPLI
PLSY_MYCMO       NMARNF-------GFKIGFLVFFLDVSKSFWFAIISAILRDFVPFFGAVI-----TQLVV
PLSY_MYCPU       NVLRNF-------GVKIALVIFALDILKTYLASLLVYFVNLYAFKDSVVV-----FHAVA
PLSY_UREP2       NMIRVH-------GKKLGILTLFLDIIKPITTVSLTYIIYKYALDAPFDL-----SNGFN
PLSY_UREPA       NMIRVH-------GKKLGILTLFLDIIKPITTVSLTYIIYKYALDAPFDL-----SNGFN
PLSY_UREU1       NMTRVY-------GKKLGILTLFLDIVKPIITISLTYIIYKYALNAPFVL-----SNGFN
PLSY_MYCGE       NSMRVF-------GLKIGFLVAIFDAFKGFFAFLLTWILFRFGLQGYLTE-----KVYQS
PLSY_MYCPN       NSIRVF-------GLKIGFLVGLCDALKGFLAFVFSFLIFSFWLQQYLNV-----NQYQK
PLSY_MYCGA       NSFRVF-------PKKVAIAIGFFEIIKSVIPFSIILLIYKYGLQPELTKLDP--SVINK
PLSY_PSELT       NALRAA-------GPVIGFICMVLDGVKAFVPVLVFSLIFK-DIHYTGIS----------
PLSY_THEM4       NVLRNA-------GAFYGALAFFFDIFKAYIAVFLVKGF---GIKFMLIA----------
PLSY_KOSOT       NVLRNL-------GGFWGAITMVLDGFKPFIPIMIAKHTFGVSVSDAMMI----------
PLSY2_THEMA      NAIRTT-------GPAVGGICLLLDALKGFFPVFITITFSG-DSKIVSLT----------
PLSY_THEP1       NAIRTT-------GPVVGGICLLLDALKGFFPVFIATTFSG-DPKLVSLT----------
PLSY_ANAMF       NAFRV--------NRGISFLVLLLDIFKSVLVILILEK--M-C----------------A
PLSY_ANAMM       NAFRV--------NRGISFLVLLLDIFKSVLVILILEK--M-C----------------A
PLSY_ANAPZ       NVFRV--------NKGLAGLVLLLDIAKSAVLIYSLKEYDI-V----------------S
PLSY_EHRCJ       NVFRK--------SKKLAVVTLILDSLKGFVSVMLAKNF---S----------------S
PLSY_EHRCR       NVFRK--------SKKLAVMTLLLDAVKGLISVLLAKIY---S----------------T
PLSY_EHRRG       NVFRK--------NKKLALLTLLLDALKSFICVAIAQKY---N----------------I
PLSY_EHRRW       NVFRK--------NKKLALLTLLLDALKSFICVAIAQKY---N----------------I
PLSY_BARHE       NVLRTG-------NKKVAALTLLCDILKGTLVILVIKFLTDPI----------------E
PLSY_BARQU       NVLRTG-------NKKVATLTLLCDILKGTVVVLVIKFLNDPI----------------E
PLSY_BART1       NVLRTG-------NKKVAALTLLCDMLKGAIVVFVIKFFSDPL----------------N
PLSY_BARBK       NVLRTG-------NKKIAALTLLCDTLKGTIVIWIAKFLIYPI----------------D
PLSY_PELUB       NALRTG-------NKTLGYATLLLDITKAVLPVLYVKF---------------------N
PLSY_WOLPM       NVARTG-------NKFLAALALFLDSFKGFIAVYIAQQFCD------------------N
PLSY_WOLPP       NVARTG-------NKRLAVLALFLDSLKGFVAVYTAQQFCD------------------N
PLSY_WOLTR       NVARTG-------SKCIAALALLLDSLKGFIAVYIAKQFFD------------------D
PLSY_ARCB4       NVLRVVKQTNPSLAKKLGIATVLLDALKGTLVLLVGIYYGV-------------------
PLSY_SULDN       NVLRVVKQSNPALAKKLGAATLLLDALKGVLVLLFAYFYGV-------------------
PLSY_WOLSU       NVLRALKERDPKKAKMMAALTMLLDALKGALVILVAKMAGM-------------------
PLSY_NITSB       NVLRVVKEKDPKLAKKLAIATVVFDALKGAVLVLIAKLLGF-------------------
PLSY_CAMJ8       NVLRVVKEKNPKLAKKLAIATIILDFAKAAIPLLILKFLHY-------------------
PLSY_CAMJJ       NVLRVVKEKNPKLAKKLAIATIILDFAKAAIPLLILKFLHY-------------------
PLSY_CAMJE       NVLRVVKEKNPKLAKKLAIATIILDFAKAAIPLLTLKFLHY-------------------
PLSY_CAMJR       NVLRVVKEKNPKLAKKLAIATIILDFAKAAIPLLTLKFLHY-------------------
PLSY_CAMJD       NVLRVVKEKNPKLAKKLAIATIILDFAKAAIPLLILKFLHY-------------------
PLSY_CAMLR       NVLRVVKESNPKLAKTLAVATVILDALKGVLPILMAKFYGF-------------------
PLSY_CAMC1       NVLRVLKQTNPKLAKKLAILTVVCDVLKGVLPLIVASFLGA-------------------
PLSY_HELPH       NVLRALQSKGVSNAKQMALLVLILDLFKGMFAVFLSKLFGL-------------------
PLSY_HELPJ       NVLRALQSKGVSNAKQMALLVLILDLFKGMFAVFLSKLFGL-------------------
PLSY_HELPY       NVLRALQSKGVSNAKQMALLVLILDLFKGMFAVFLSKLFGL-------------------
PLSY_HELAH       NVLRTLQSRGVSNAKQMALLILILDLFKGMFAVFLSKLFGL-------------------
PLSY_HELHP       NVYRAVKEIDESKAKYLSILTIILDATKGLIVVLGAKLLGM-------------------
PLSY_MYCPE       NVTRNL-------GRISGAIVMVLDFFKSWFSTFVCLLIYKALRYSIGD-----ESAYAN
PLSY_NEOSM       NMTRVM-------GLGFGSVVFMLDFLKAAAPVFLAVQCCSDV-----------------
PLSY1_OCEIH      NTTILL-------GWKYGIVVALIDIFKATAAIFLLLILLQGNAIPT-----------QE
PLSY1_THEMA      NLWRAA-------GWKYGFPALMLDYFKGTFPIAFFVWNESFHVNR--------------
PLSY2_DEIRA      GTYRQY-------GKGAAAAVTLADILKGAAAVGLALWLAPQALP---------------
                 .                       :  *                                

PLSY_AYWBP       -TMKISLLAISPILGHMFSLFNKFK---------------GGKA-----IATSVGIITSF
PLSY_ONYPE       -TIKISLLAISPILGHMFSLFNKFK---------------GGKA-----IATSVGIITAF
PLSY_PHYAS       -DIAICLLVILPIFGHMFSIFNKFK---------------GGKA-----IATSVGVITAI
PLSY_ACHLA       -----IVFGAAAAIGHIKSIYIGFK---------------GGKA-----VATGVGAVIAI
PLSY_CLOAB       -------IVIAVILGHDYTPFLGFN---------------GGKG-----VNTTVGAFFLL
PLSY_GEOMG       -----ALAGLAAFLGHVYTVFLGFK---------------GGKG-----VATALGVFLGL
PLSY_GEOSL       -----AAVGLAAFLGHVYTIFLGFK---------------GGKG-----VATALGVFLGV
PLSY_GEODF       -----AATGLAAFLGHVYTVFLRFK---------------GGKG-----VATALGVFIGI
PLSY_GEOLS       -----AWVGLAAFCGHVFSVFLLFK---------------GGKG-----VATALGVFLAL
PLSY_PELCD       -----GAVAAAAFIGHCYPVYLKFK---------------GGKG-----VATALGIFLVL
PLSY_KORVE       -----AFAGLCAILGHLYPVWLKFK---------------GGKG-----VATALGVFLAL
PLSY_FUSNN       -----VILGLVAILAHTFSCFISFK---------------GGKG-----VATSLGVFLFL
PLSY_UNCTG       -----VAVAAAAMVGHVFTIFLKFK---------------GGKG-----VATGLGVFFAL
PLSY_DESAD       -----SLVAAAAVIGHVFSIFMDMK---------------GGKA-----VATTIGVFLAL
PLSY_DESMR       -----SMVAVAAVVGHMYSVFLYGK---------------GGKG-----VATTIGVFLGG
PLSY_DESAG       -----SLTALAALLGHLYSVFLGFR---------------GGKA-----VATTLGVFIPL
PLSY_DESVH       -----SLTALAALLGHLYSCFLSFK---------------GGKA-----VATTVGVFLPL
PLSY_DESDA       -----SMVALACVLGHVFSCFMKFR---------------GGKA-----VATSIGIFLPL
PLSY_LAWIP       -----TMTGLAAIIGHLYSCFLHFK---------------GGKA-----VATSIGVLIPI
PLSY_LEPBJ       -----LACGVLAVLGHMFSPFLGFK---------------GGKG-----VATTLGVFLVL
PLSY_LEPBL       -----LACGVLAVLGHMFSPFLGFK---------------GGKG-----VATTLGVFLVL
PLSY_LEPIC       -----LLCGVCAVLGHMFSPFLGFR---------------GGKG-----VATTFGVFLVL
PLSY_LEPIN       -----LLCGVCAVLGHMFSPFLGFR---------------GGKG-----VATTFGVFLVL
PLSY_DESPS       -----CLSGVMGVLGHMFPVYLGFK---------------GGKG-----VATGLGVFLFL
PLSY_ECOLI       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SHIB3       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SHISS       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SHIBS       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SHIDS       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECO24       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECO27       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECO45       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECO55       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECO57       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECO5E       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECO7I       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECO81       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECO8A       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECOBW       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECODH       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECOHS       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECOK1       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECOL5       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECOL6       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECOLC       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECOLU       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECOSE       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECOSM       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ECOUT       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SHIF8       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SHIFL       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ESCF3       --FWLGLIAIAACLGHIWPIFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALSV       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALTI       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALTY       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALA4       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALCH       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALDC       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALEP       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALG2       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALHS       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALNS       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALPA       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALPB       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALPK       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_CITK8       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_SALAR       --FWLGLIAIAACLGHIWPVFFGFK---------------GGKG-----VATAFGAIAPI
PLSY_ENT38       --FWLGLIAIAACVGHIWPVFFHFK---------------GGKG-----VATAFGAIAPI
PLSY_CROS8       --FWLGLIAIAACLGHIWPIFFHFR---------------GGKG-----VATAFGAIAPI
PLSY_KLEP3       --FWLGLVAIAACVGHIWPVFFHFR---------------GGKG-----VATAFGAIAPI
PLSY_KLEP7       --FWLGLVAIAACVGHIWPVFFHFR---------------GGKG-----VATAFGAIAPI
PLSY_PECAS       --LYLGLTAIAACLGHIYPVFFHFR---------------GGKG-----VATALGAIAPI
PLSY_PECCP       --LYLGLTAIAACLGHIYPVFFHFR---------------GGKG-----VATAFGAIAPI
PLSY_YERP3       --LYLGLTAIAACLGHIYPVFFHFK---------------GGKG-----VATAFGAIAPI
PLSY_YERPA       --LYLGLTAIAACLGHIYPVFFHFK---------------GGKG-----VATAFGAIAPI
PLSY_YERPB       --LYLGLTAIAACLGHIYPVFFHFK---------------GGKG-----VATAFGAIAPI
PLSY_YERPE       --LYLGLTAIAACLGHIYPVFFHFK---------------GGKG-----VATAFGAIAPI
PLSY_YERPN       --LYLGLTAIAACLGHIYPVFFHFK---------------GGKG-----VATAFGAIAPI
PLSY_YERPP       --LYLGLTAIAACLGHIYPVFFHFK---------------GGKG-----VATAFGAIAPI
PLSY_YERPS       --LYLGLTAIAACLGHIYPVFFHFK---------------GGKG-----VATAFGAIAPI
PLSY_YERPY       --LYLGLTAIAACLGHIYPVFFHFK---------------GGKG-----VATAFGAIAPI
PLSY_YERE8       --LYLGLTAIAACLGHIYPVFFHFK---------------GGKG-----VATAFGAIAPI
PLSY_SERP5       --LYLGLTAIAACLGHIYPVFFHFR---------------GGKG-----VATAFGAIAPI
PLSY_ERWT9       --FYLGLTAIAACLGHIYPVFFHFK---------------GGKG-----VATALGAIAPI
PLSY_EDWI9       --FYLGLTAIAACLGHIYPVFFRFR---------------GGKG-----VATAFGAIAPI
PLSY_PHOLL       --FYLGITAIAACLGHIYPIFFQFK---------------GGKG-----VATAFGAIAAI
PLSY_PROMH       --FYLGIVAIAACLGHIYPVFFHFK---------------GGKG-----VATAFGSIAAI
PLSY_SODGM       --FWLGLVAIAACLGHIYPIFFHFR---------------GGKG-----VATALGAIAPI
PLSY_HAEI8       --FELGMVALGACLGHIFPIFFQFK---------------GGKG-----VATAFGAIAPI
PLSY_HAEIG       --FELGMVALGACLGHIFPIFFQFK---------------GGKG-----VATAFGAIAPI
PLSY_HAEIN       --FELGMVALGACLGHIFPIFFQFK---------------GGKG-----VATAFGAIAPI
PLSY_HAEIE       --FELGMVALGACLGHIFPIFFQFK---------------GGKG-----VATAFGAIAPI
PLSY_PASMU       --FELGMVALGACLGHIFPIFFKFK---------------GGKG-----VATAFGAIAPI
PLSY_ACTSZ       --FELGMVALGACLGHIFPIFFKFR---------------GGKG-----VATAFGAIAPI
PLSY_MANSM       --FELGMVALSACLGHIFPIYFKFR---------------GGKG-----VATAFGAIAPI
PLSY_HAES1       --FELGMVALAACLGHIFPIFFKFS---------------GGKG-----VATAFGAIAPI
PLSY_ACTP2       --SEIGLIALAACLGHIFPLFFRFR---------------GGKG-----VATAFGALLSI
PLSY_ACTP7       --SEIGLIALAACLGHIFPLFFRFR---------------GGKG-----VATAFGALLSI
PLSY_ACTPJ       --SEIGLIALAACLGHIFPLFFRFR---------------GGKG-----VATAFGALLSI
PLSY_HAEDU       --SAIGLIGLAACLGHIFPIFFQFR---------------GGKG-----VATAFGVFFSI
PLSY_HAEPS       --SVIGFIALAACLGHIFPVFFKFQ---------------GGKG-----VATAFGAIIPM
PLSY_AERS4       --VYLGFIGVAACLGHMYPIFFHFR---------------GGKG-----VATALGTMMPI
PLSY_TOLAT       --LYLGFIGIAACLGHMYPLYFHFR---------------GGKG-----VATALGALLPL
PLSY_ALIF1       --FMLGIIAISACLGHMYPLFFHFK---------------GGKG-----VATALGALAPI
PLSY_ALIFM       --FMLGIIAISACLGHMYPLFFHFK---------------GGKG-----VATALGALAPI
PLSY_ALISL       --LLLGIIAIAACLGHMYPLFFHFK---------------GGKG-----VATALGALAPI
PLSY_PHOPR       --FLLGIIGIAACLGHIYPIFFHFR---------------GGKG-----VATALGALAPI
PLSY_VIBC3       --FMLGLVAIAACLGHMYPIFFHFK---------------GGKG-----VATALGAIAPI
PLSY_VIBCH       --FMLGLVAIAACLGHMYPIFFHFK---------------GGKG-----VATALGAIAPI
PLSY_VIBCM       --FMLGLVAIAACLGHMYPIFFHFK---------------GGKG-----VATALGAIAPI
PLSY_VIBCB       --IILGVIAIAACLGHMYPIFFHFK---------------GGKG-----VATALGAIAPI
PLSY_VIBPA       --IILGVIAIAACLGHMYPIFFHFK---------------GGKG-----VATALGAIAPI
PLSY_VIBTL       --IILGVVAIAACLGHMYPIFFHFK---------------GGKG-----VATALGAIAPI
PLSY_VIBVU       --VLLGVIAIAACLGHMYPLFFHFQ---------------GGKG-----VATALGAIAPI
PLSY_VIBVY       --VLLGVIAIAACLGHMYPLFFHFQ---------------GGKG-----VATALGAIAPI
PLSY_IDILO       --FFLGLIAVAACLGHIFPLYFHFR---------------GGKA-----VATALGAMFPV
PLSY_PSEA6       --ITLGLVGIAACLGHIYPLYFNFN---------------GGKG-----VATAIGAMLPL
PLSY_COLP3       --LYLGFIGVSACLGHMYPIFFNFK---------------GGKA-----VATALGTLLPI
PLSY_PSEHT       --LALGLVAVAACLGHMFPLFFGFK---------------GGKA-----VATAFGSLLPI
PLSY_SHEB2       --VSLGLIAIAACLGHIYPVFFGFK---------------GGKG-----VATAFGAMAPI
PLSY_SHEB5       --VSLGLIAIAACLGHIYPVFFGFK---------------GGKG-----VATAFGAMAPI
PLSY_SHEB8       --VSLGLIAIAACLGHIYPVFFGFK---------------GGKG-----VATAFGAMAPI
PLSY_SHEB9       --VSLGLIAIAACLGHIYPVFFGFK---------------GGKG-----VATAFGAMAPI
PLSY_SHESA       --ISLGLIAIAACLGHIYPIFFGFK---------------GGKG-----VATAFGAMAPI
PLSY_SHESR       --ISLGLIAIAACLGHIYPIFFGFK---------------GGKG-----VATAFGAMAPI
PLSY_SHESM       --ISLGLIAIAACLGHIYPIFFGFK---------------GGKG-----VATAFGAMAPI
PLSY_SHEON       --ISLGLIAIAACLGHIYPVFFGFK---------------GGKG-----VATAFGAMAPI
PLSY_SHEPC       --ISLGLIAIAACLGHIYPIFFGFK---------------GGKG-----VATAFGAMAPI
PLSY_SHESW       --ISLGLIAIAACLGHIYPIFFGFK---------------GGKG-----VATAFGAMAPI
PLSY_SHEHH       --IALGVIAIAACLGHIFPIFFGFK---------------GGKG-----VATAFGAMAPI
PLSY_SHESH       --VALGAIAIAACLGHIFPIFFKFK---------------GGKG-----VATAFGAMAPI
PLSY_SHEWM       --VSLGIIAIAACLGHIFPIFFHFK---------------GGKG-----VATAFGAMAPI
PLSY_SHELP       --VSLGVIAIAACLGHIFPIFFKFK---------------GGKG-----VATAFGAMAPI
PLSY_SHEDO       --VYLGLVAVAACLGHIFPIFFAFK---------------GGKG-----VATAFGAMAPI
PLSY_BLOFL       --IYLYIIAISACIGHIYPIYFQFY---------------GGKG-----VATAFGALTAI
PLSY_BLOPB       --IFLGATAVFSCLGHMYPIFFKFY---------------GGKG-----VATAFGVLTTI
PLSY_COXB1       --VSLAFVGLVAVLGHLFPVYFKFR---------------GGKG-----VATMMGVLLGL
PLSY_COXBU       --VSLAFVGLVAVLGHLFPVYFKFR---------------GGKG-----VATMMGVLLGL
PLSY_COXBN       --VSLAFVGLVAVLGHLFPVYFKFR---------------GGKG-----VATMMGVLLGL
PLSY_COXBR       --VSLAFVGLVAVLGHLFPVYFKFR---------------GGKG-----VATMMGVLLGL
PLSY_COXB2       --VSLAFVGLVAVLGHLFPVYFKFR---------------GGKG-----VATMMGVLLGL
PLSY_FRAT1       --FITACTALYAILGHIFPIFFGFK---------------GGKG-----VATLIGTLFGF
PLSY_FRATT       --FITACTALYAILGHIFPIFFGFK---------------GGKG-----VATLIGTLFGF
PLSY_FRATF       --FITACTALYAILGHIFPIFFGFK---------------GGKG-----VATLIGTLFGF
PLSY_FRATH       --FITACTALYAILGHIFPIFFGFK---------------GGKG-----VATLIGTLFGF
PLSY_FRATN       --FITACTALYAILGHIFPIFFGFK---------------GGKG-----VATLIGTLFGF
PLSY_FRATO       --FITACTALYAILGHIFPIFFGFK---------------GGKG-----VATLIGTLFGF
PLSY_FRATM       --FITACTALYAILGHIFPIFFGFK---------------GGKG-----IATLVGTLFGF
PLSY_FRAP2       --FITACTALYAILGHIFPIFFGFK---------------GGKG-----VATLIGTLFGF
PLSY_LEGPC       --VTVAFTALAAVVGHMYPVFFHFR---------------GGKG-----VATTIGALLAF
PLSY_LEGPH       --VTVAFTALAAVVGHMYPVFFHFR---------------GGKG-----VATTIGALLAF
PLSY_LEGPA       --VTVAFTALAAVVGHMYPVFFHFR---------------GGKG-----VATTIGALLAF
PLSY_LEGPL       --VTVAFTALAAVVGHMYPVFFHFR---------------GGKG-----VATTIGALLAF
PLSY_RUTMC       --LNVTWVILVTFLGHVYPIFFSFK---------------GGKG-----VATFLGALLAL
PLSY_AROAE       SPVEAALAGLAAFLGHVFSVFLRFR---------------GGKG-----VATALGVLAGI
PLSY_LARHH       AAPEIAMVGLAVFIGHLWPVFLAFR---------------GGKG-----VATALGVLLAV
PLSY_DECAR       SDNVIGLVALAVFLGHLYPIFLKFK---------------GGKG-----VATAAGVLIAL
PLSY_NITEC       GDEVIASAALAVFLGHLFPIFLAFK---------------GGKG-----VATSAGILLGL
PLSY_NITEU       GDEVIAGAALAVFLGHLFPIFLAFK---------------GGKG-----VATSAGILLGL
PLSY_NITMU       GNEAVAAAALGVFLGHLFPVFLHFK---------------GGKG-----VATALGILLGF
PLSY_METFK       PVGVVCWVAVAVFLGHLYPVFYRFK---------------GGKG-----VATALGVLLAF
PLSY_BORBR       SWGAYALVALAVFLGHLYPLFLRFK---------------GGKG-----VATALGVLMAI
PLSY_BORPE       SWGAYALVALAVFLGHLYPLFLRFK---------------GGKG-----VATALGVLMAI
PLSY_BORPA       SWGAYALVALAVFLGHLYPLFLRFK---------------GGKG-----VATALGVLMAI
PLSY_BORPD       SWTVFALVALAAFLGHLYPVFLGFK---------------GGKG-----VATALGILLAI
PLSY_BORA1       SSLGYGLVLIAVFLGHLYPVSLGFK---------------GGKG-----VATALGVLFAV
PLSY_BURA4       -DVAVAWVAIAVFLGHLYPVFFRFQ---------------GGKG-----VATAAGVLLAV
PLSY_BURCM       -DVAVACVAIAVFLGHLYPVFFRFQ---------------GGKG-----VATAAGVLLAV
PLSY_BURL3       -DVAVAWVAIAVFLGHLYPVFFRFQ---------------GGKG-----VATAAGVLLAV
PLSY_BURVG       -DVAVAWVAIAVFVGHLYPVFFRFQ---------------GGKG-----VATAAGVLLAV
PLSY_BURCA       -DVAIAWVAIAVFLGHLYPVFFRFQ---------------GGKG-----VATAAGVLLAV
PLSY_BURCH       -DVAIAWVAIAVFLGHLYPVFFRFQ---------------GGKG-----VATAAGVLLAV
PLSY_BURCJ       -DVAVAWVAIAVFLGHLYPVFFRFQ---------------GGKG-----VATAAGVLLAV
PLSY_BURCC       -DVAIAWVAIAVFLGHLYPVFFRFQ---------------GGKG-----VATAAGVLLAV
PLSY_BURM1       -DVAIAWVAIAVFIGHLYPVFFRFQ---------------GGKG-----VATAAGVLLAV
PLSY_BURP1       -EIGVALAAIAVFLGHLYPVFFRFQ---------------GGKG-----VATAAGVLLAV
PLSY_BURPS       -EIGVALAAIAVFLGHLYPVFFRFQ---------------GGKG-----VATAAGVLLAV
PLSY_BURMA       -EIGVALAAIAVFLGHLHPVFFRFQ---------------GGKG-----VATAAGVLLAV
PLSY_BURTA       -EIGVALAAIAVFLGHLYPVFFRFQ---------------GGKG-----VATAAGVLLAV
PLSY_PARPJ       DETSVAIASVAVFLGHLYPVFFRFK---------------GGKG-----VATAAGVLLAI
PLSY_PARXL       DDTSVAIAAVAVFLGHLYPAFFRFK---------------GGKG-----VATAAGVLLAI
PLSY_PARP8       DDTSVAIAAIAVFLGHLYPVFFRFK---------------GGKG-----VATAAGVLLAI
PLSY_CUPTR       NDTGLAMVALAVFLGHLFPVFHRFA---------------GGKG-----VATAAGILLAI
PLSY_CUPNH       NETGLAMVALAVFLGHLFPVYHRFA---------------GGKG-----VATAAGILLAI
PLSY_CUPMC       DETGIALVALAVFLGHLFPLYHRFA---------------GGKG-----VATAAGILFAI
PLSY_CUPPJ       DDNGLAMVALAVFLGHLFPVFHRFA---------------GGKG-----VATAAGVLLAI
PLSY_RALPJ       DETGIALVVIAVFLGHLFPVFHRFE---------------GGKG-----VATAAGILLAL
PLSY_RALSO       EDMGIALVVIAAFLGHLYPVFHRFT---------------GGKG-----VATAAGILLAL
PLSY_HERAR       QESGVALVAIAVFLGHLWPIFFRFV---------------GGKG-----VATALGILLAL
PLSY_JANMA       HENGVALVAIAVFLGHLWPVFFRFV---------------GGKG-----VATALGVLLAL
PLSY_RHOFT       EEGTMALVGLAAFIGHLYPVFFNFA---------------GGKG-----VATALGVLLGL
PLSY_CHRVO       GEQGIALCALAVLFGHMWPVFFGFK---------------GGKG-----VATAVGILFGI
PLSY_THIDA       DDDIVLLCALAAFIGHLFPVFFGFQ---------------GGKG-----VATALGILVAL
PLSY_NEIG1       SDSAIAAVALAALVGHMWPVFFGFK---------------GGKG-----VATALGVLLAL
PLSY_NEIG2       SDSAIAAVALAALVGHMWPVFFGFK---------------GGKG-----VATALGVLLAL
PLSY_NEIMA       SDSAIAAVALAALVGHMWPVFFGFK---------------GGKG-----VATALGVLLAL
PLSY_NEIMF       SDSAIAAVALAALVGHMWPVFFGFK---------------GGKG-----VATALGVLLAL
PLSY_NEIM0       SDSAIAAVALAALVGHMWPVFFGFK---------------GGKG-----VATALGVLLAL
PLSY_NEIMB       SDSAIAAVALAALVGHMWPVFFGFK---------------GGKG-----VATALGVLLAL
PLSY_METCA       -PPLFAAIGFAAFVGHLYPVFFQFK---------------GGKG-----VATALGVLLGF
PLSY_THISH       -PVWIAAVALAAFLGHLFPVYHGFR---------------GGKG-----VATALGVILGI
PLSY_NITOC       -AWAVAGVGLAAFWGHLYPVFFGFR---------------GGKG-----VATGLGVLLGF
PLSY_HYDCU       -PLAIILVGFASFIGHLYPIFFGFR---------------GGKG-----VATMLGVMFGL
PLSY_HALHL       -PVVASAAGLAAFFGHLFPVYFRFQ---------------GGKG-----VATGLGVILAW
PLSY_PSEA8       --MEEAWVGIAAVIGHLYPLYFNFR---------------GGKG-----VATAAGMLLGL
PLSY_PSEAB       --MEEAWVGIAAVIGHLYPLYFNFR---------------GGKG-----VATAAGMLLGL
PLSY_PSEAE       --MEEAWVGIAAVIGHLYPLYFNFR---------------GGKG-----VATAAGMLLGL
PLSY_PSEA7       --MEEAWVGIAAVIGHLYPLYFNFR---------------GGKG-----VATAAGMLLGL
PLSY_AZOVD       --QQQAWIGLAAVSGHLYPLYFNFR---------------GGKG-----VATAAGMLLGL
PLSY_PSE14       --AQQGWIGVCAVLGHLFPVYFRFR---------------GGKG-----VATAAGVLLGL
PLSY_PSEU2       --AQQGWIGVCAVLGHLFPVYFRFR---------------GGKG-----VATAAGVLLGL
PLSY_PSESM       --SQQGWIGVCAVLGHLFPLYFRFR---------------GGKG-----VATAAGVLLGL
PLSY_PSEFS       --QQQAWIGVCAVLGHLFPLYFRFR---------------GGKG-----VATAAGMLLGI
PLSY_PSEPF       --QDQAWIGVCAVIGHLFPLYFRFR---------------GGKG-----VATAAGMLLGL
PLSY_PSEF5       --QQQAWVGLYAVLGHLFPLYFRFR---------------GGKG-----VATAAGMLLGL
PLSY_PSEP1       --HAQAWVGICAVLGHLFPLYFRFK---------------GGKG-----VATAAGMLMGL
PLSY_PSEPK       --HAQAWVGICAVLGHLFPLYFRFK---------------GGKG-----VATAAGMLMAL
PLSY_PSEPG       --HAQAWVGVCAVLGHLFPLYFRFQ---------------GGKG-----VATAAGMLMGL
PLSY_PSEPW       --QEQAWVGVCAVLGHLFPVYFRFQ---------------GGKG-----VATAAGMLMGL
PLSY_PSEE4       --QEQAWVGICAVLGHLFPVYFRFQ---------------GGKG-----VATAAGMLMAL
PLSY_CHRSD       --WAQGAVGLSVLVGHSYPLWHRGR---------------GGKA-----VASAFGVLLMI
PLSY_HAHCH       --YEQGVTAVAAIVGHMLPAFHHFK---------------GGKG-----VATVLGAGLAL
PLSY_RHIE6       ----AIIAGFFAFIGHLFPVWIGFK---------------GGKG-----VATYIGTLLGV
PLSY_RHIEC       ----AIIAGFFAFIGHLFPVWIGFK---------------GGKG-----VATYIGTLLGV
PLSY1_RHIL3      ----AIIAGFFAFIGHLFPVWIGFK---------------GGKG-----VATYIGTLLGV
PLSY_AGRFC       ----SLVAGFFAFLGHLFPVWLGFK---------------GGKG-----VAVYIGVLLGA
PLSY_RHIME       ----GIAAGFAAFLGHLFPVWLSFR---------------GGKG-----VATYIGVLLGL
PLSY_SINMW       ----GMAAGLAAFLGHLFPVWLSFK---------------GGKG-----VATYIGVLLGL
PLSY_SINFN       ----GIAAGLAAFLGHLFPVWLSFK---------------GGKG-----VATYIGVLLGL
PLSY_AGRVS       -HLPGLLGGFAAFIGHLFPVWLGFK---------------GGKG-----VATYIGTLLGI
PLSY_BRUA1       -----IAAGFGAFIGHLFPVWIGFK---------------GGKG-----VATYLGVLIGL
PLSY_BRUA2       -----IAAGFGAFIGHLFPVWIGFK---------------GGKG-----VATYLGVLIGL
PLSY_BRUAB       -----IAAGFGAFIGHLFPVWIGFK---------------GGKG-----VATYLGVLIGL
PLSY_BRUC2       -----IAAGFGAFIGHLFPVWIGFK---------------GGKG-----VATYLGVLIGL
PLSY_BRUSU       -----IAAGFGAFIGHLFPVWIGFK---------------GGKG-----VATYLGVLIGL
PLSY_BRUMB       -----IAAGFGAFIGHLFPVWIGFK---------------GGKG-----VATYLGVLIGL
PLSY_BRUME       -----IAAGFGAFIGHLFPVWIGFK---------------GGKG-----VATYLGVLIGL
PLSY_BRUO2       -----IAAGFGAFIGHLFPVWIGFK---------------GGKG-----VATYLGVLIGL
PLSY_BRUSI       -----IAAGFGAFIGHLFPVWIGFK---------------GGKG-----VATYLGVLIGL
PLSY_OCHA4       -----IGAGFGAFIGHLFPVWIGFK---------------GGKG-----VATYLGVLIGL
PLSY_RHILO       -----VWAGLGAFLGHLFPVWLGFK---------------GGKG-----VATYLGVLIGL
PLSY_BRASB       GPNAAMIAGLGAFLGHLFPVWLKFR---------------GGKG-----VAVYIGILIGL
PLSY_BRASO       GSNAAMLAGLGAFLGHLFPVWLKFR---------------GGKG-----VAVYIGILIGL
PLSY_BRADU       GPNAAMAAGLGAFLGHLFPVWLKFK---------------GGKG-----VAVYIGILLGL
PLSY_RHOP2       GAEAAMLAALGAFLGHLFPVWLKFK---------------GGKG-----VAVYIGVLIGL
PLSY_RHOPS       GAEAAMLAALGAFLGHLFPVWLKFK---------------GGKG-----VAVYIGVLLGL
PLSY_RHOPA       AANAAMLAALGAFLGHLFPVWLKFK---------------GGKG-----VAVYIGVLIGL
PLSY_RHOPT       AANAAMLAALGAFLGHLFPVWLKFK---------------GGKG-----VAVYIGVLIGL
PLSY_RHOPB       GPEAAMLAALGAFLGHLFPVWLKFK---------------GGKG-----VAVYIGVLLGL
PLSY_NITHX       GSAAAIAAALGAFLGHLFPVWLKFR---------------GGKG-----VATYIGVLLGL
PLSY_NITWN       GPGAAMAATLGAFLGHLFPVWLKFR---------------GGKG-----VATYIGVLLGL
PLSY_METC4       -EGPALAAGLGAFLGHLFPVWLGFK---------------GGKG-----VATFIGVLLAL
PLSY_METEP       -EGPALAAGLGAFLGHLFPVWLGFK---------------GGKG-----VATFIGVLLAL
PLSY_METPB       -EGPALAAGLGAFLGHLFPVWLGFK---------------GGKG-----VATFIGVLLAL
PLSY_CAUVN       ---IIALAGGSAFLGHLFPVWLKFK---------------GGKG-----VATFYGVLLSA
PLSY_CAUVC       ---IIALAGGSAFLGHLFPVWLKFK---------------GGKG-----VATFYGVLLSA
PLSY_RHOS1       ---AAQLAAFTSFLGHLFPVWLGFR---------------GGKG-----VATFLGTLLAL
PLSY_RHOS4       ---AAQLAAFTSFLGHLFPVWLGFR---------------GGKG-----VATFLGTLLAL
PLSY_RHOSK       ---AAQLAAFTSFLGHLFPVWLGFR---------------GGKG-----VATFLGTLLAL
PLSY_RHOS5       ---AAQLAAFTSFLGHLYPVWLGFR---------------GGKG-----VATFLGTLIAL
PLSY_ROSDO       ---LAQIAGLMAMIGHCYPVWLRFA---------------GGKG-----VATFLGIVLAL
PLSY_RUEST       ---AAQLAGLLAFLGHCFPVWLGFK---------------GGKG-----VATFLGLMLAL
PLSY_RUEPO       ---AAQVAALAAFVGHCYPIWLGFK---------------GGKG-----VATFLGLWLAL
PLSY_JANSC       ---AAQLAGFAAFLGHCFPVFLGFK---------------GGKG-----VATFLGTLLAL
PLSY_DINSH       ---AAQIAGAAAFLGHCFPVYLKFN---------------GGKG-----VATFFGTVIAL
PLSY_MAGSA       VPVAGF----AAVLGHNFPVWLGFK---------------GGKG-----VATTIGTLLAA
PLSY_RHORT       AVLAGLLAGGMAVVGHNFPIWLGFK---------------GGKG-----VATTLGTLLAT
PLSY_MARMM       --TAGLVAGAFAFAGHCFPVWLGFK---------------GGKG-----VATFVGTMLVV
PLSY_HYPNA       --EVGFVAGFAAFIGHCYPVWLGFK---------------GGKG-----IATYAGLLAFV
PLSY_ERYLH       --NDIGWAALGAVVGHCFPIWLGFK---------------GGKG-----VATNAGVCFGL
PLSY_NOVAD       --GAEALAALAAVLGHCFPVWLRFK---------------GGKG-----VATLMGVSLAL
PLSY_GLUOX       --TTMAVAAVAVVIGHCFPVWLGFR---------------GGKG-----VATGLGTIWVL
PLSY_GRABC       --ALALPAGIAAVIGHLFPVWLGFR---------------GGKG-----VATGLGVLLAT
PLSY_ZYMMO       APDLTLIAGAAAFLGHCYPVWLGFR---------------GGKG-----VATMLGVSFAA
PLSY_ANAD2       ---WVTAVAVAAFVGHLFPVWLGFK---------------GGKG-----VATGLGIFAVL
PLSY_ANASK       ---WVTAVAVAAFVGHLFPVWLGFK---------------GGKG-----VATGLGIFAVL
PLSY_ANADE       ---WSTAVAVAAFVGHLFPVWLGFK---------------GGKG-----VATGLGIFAVL
PLSY_ANADF       ---FTVLVALAAFVGHLYPVWLGFR---------------GGKG-----VATGLGIFLVL
PLSY_MYXXD       -----VAVGLAAVLGHIYPVWLKLQ---------------GGKG-----VATALGVLLVL
PLSY_DEIGD       ---WTALCGVAAVLGHNFSPFLGFR---------------GGKG-----VATSFGTMLAL
PLSY1_DEIRA      ---WAALCGVLAVIGHNFSPFLAFR---------------GGKG-----VATSFGVIAIL
PLSY_THET2       ---MLGGVALMAVLGHNYSVFLRFR---------------GGKG-----VATSFGTLLFL
PLSY_THET8       ---MLGGVALMAVLGHNYSVFLRFR---------------GGKG-----VATSFGTLLFL
PLSY_RUBXD       ---VLAAVALAAVVGHCWPVFLRFR---------------GGKG-----VATGAGTSIAL
PLSY_ROSS1       ---AVVIVGTAAMLGHTRSIFLGFR---------------GGKA-----VATGGGVVLTL
PLSY1_DEHM1      ----VILTGFAAVIGHNWPIWLDFK---------------GGKGLGPAFGAMLFLLPVYG
PLSY1_DEHMC      ----VILTGFMAVIGHNWSVWLDFK---------------GGKGLGPAFGAMLFLLPVYG
PLSY2_DEHM1      ----QMLCALMAIAGHNYPVWLKFK---------------GGKG-----GATAIGILAYL
PLSY2_DEHMC      ----QMLCALMAIAGHNYPVWLKFK---------------GGKG-----GATAIGILAYM
PLSY5_DEHM1      ----QIVVGLFTIAGHNWPVFLRFN---------------GGRG-----IATSLGVALVM
PLSY4_DEHMC      ----QIVVGLLTIAGHNWPVFLRFN---------------GGRG-----IATSLGVALVM
PLSY4_DEHM1      ----VMFCGLAAVLGHNWPVWLGFR---------------GGRG-----EATAIGVMLLI
PLSY1_MOOTA      ----GVLMALAAVAGHNWPLYWRFQ---------------GGKG-----LATSLGVALAV
PLSY1_DESHY      ----LILCLIAGVAGHIWPLQLGLR---------------GGKG-----VAPALGGILVV
PLSY_NOSS1       QPWLVTLAGIAAILGHSKSIFLGFT---------------GGKS-----VATSLGILLAM
PLSY_TRIV2       QPWLVTLAGIAAILGHSKSIFLGFT---------------GGKS-----VATSLGILLAM
PLSY_TRIEI       KEWMVIIAGLIAIVGHTKSIWIGFK---------------GGKS-----VASSLGILLAI
PLSY_ACAM1       LSLVVIMAGLMAILGHSKSVWLNFT---------------GGKS-----VATGLGVLLVM
PLSY2_RHIL3      EPWAVCLTGLAVLLGHGRSVWLNFT---------------GGKS-----VAAGLGVLLAM
PLSY_SYNJA       SPWWVVVAALGAVIGHSRSCWLGFK---------------GGKS-----VATSLGILLAM
PLSY_SYNJB       SAWWVVLAALFAVIGHSRSCWLGFR---------------GGKS-----VATSLGILLAM
PLSY_SYNE7       IAWLAAFAAIIAVVGHSLPVWLSFR---------------GGKS-----VATSLGVLLAL
PLSY_SYNP6       IAWLAAFAAIIAVVGHSLPVWLSFR---------------GGKS-----VATSLGVLLAL
PLSY_CROS5       KSWLVVFAAIAAVLGHSKSIFLNFT---------------GGKS-----VASSLGVLLVL
PLSY_RIPO1       KPWLIVTVASAAILGHSKSIFLNFT---------------GGKS-----VASSLGVLLVL
PLSY_SYNY3       QNWLTLGVAIAVVLGHSKSIFLKFS---------------GGKS-----VATSLGVLFML
PLSY_THEEB       FEFVLLAIAFIAVLAHSKPIWLGWR---------------GGKS-----VATGLGVLLAL
PLSY_GLOVI       GAWIVLGAGLAAIVGHSWPVWLAFR---------------GGKS-----VAVSVGLLLGM
PLSY_PROM2       QELIEVIAGISAISGHIWPIWLGGK---------------GGKA-----VATGLGMFLAL
PLSY_PROMS       QGLIEVIAGISAISGHIWPIWLRGK---------------GGKA-----VATGLGMFLAL
PLSY_PROM0       QGLIEVIAGISAISGHIWPIWLRGK---------------GGKA-----VATGLGMFLAL
PLSY_PROM9       QGLIEVIAGISAITGHIWPIWLRGK---------------GGKA-----VATGLGMFLAL
PLSY_PROM5       QHLFEVLAGISAVSGHIWPIWLKGK---------------GGKA-----VATGLGMFIAL
PLSY_PROMP       QNLFEVLAGIAAISGHIWPIWLKGK---------------GGKA-----VATGLGMFIAL
PLSY_PROM1       NDSWQVAIGLSTLIGHIWPVWLNWK---------------GGKA-----VATGLGIFLGL
PLSY_PROMT       NDSWQVAVGLSTLIGHIWPVWLNWK---------------GGKA-----VATGLGIFLGL
PLSY_PROM4       SPSFHVICGIAALSGHIWPIWLNWK---------------GGKA-----VATGLGVFLGI
PLSY_PROMA       DESLQIAAGLASLSGHIWPVWLKGK---------------GGKA-----VATGLGVFLGI
PLSY_SYNPX       SDWLQVLAGLAALAGHIWPVWLGWK---------------GGKA-----VATGFGMFLGL
PLSY_SYNSC       NDWLQVLTGLAALAGHIWPVWLGWK---------------GGKA-----VATGLGIFLGL
PLSY_SYNS9       NDWVQVLAGLAALAGHIWPVWLGWK---------------GGKA-----VATGLGMFLGL
PLSY_PROMM       DDGWQVAAGLAALAGHIWPVWLGWK---------------GGKA-----VATGLGMLLGI
PLSY_DESRM       TDIAVLGVALAVMAGHSWPLWLRFK---------------GGKI-----IATGAGAILAL
PLSY_DESAP       VPGLELLTGAAALTGHGWSVFLRFQ---------------GGKI-----IATSLGVLIML
PLSY2_MOOTA      GPVLVILAALMAIVGHNWSIFLEFQ---------------GGRG-----VATTAGALLAM
PLSY_CARHZ       GERGALVASFFVVIGHAYSIFLKFH---------------GGKI-----VATTFGVLIMT
PLSY_BACSU       -----LLAGVFAVLGHVFPIFAKFK---------------GGKA-----VATSGGVLLFY
PLSY_BACVZ       -----LLAGVAAVIGHVFPVFAKFK---------------GGKA-----VATSGGVLLFY
PLSY_BACLD       -----LLAGVAAVIGHMFPVFAKFK---------------GGKA-----VATSGGVLLCY
PLSY_GEOKA       -----LLAGAIAVVGHMYPVFAKFR---------------GGKA-----VATSGGVMLFY
PLSY_GEOSW       -----LLAGVCAVIGHTYPIFAKFR---------------GGKA-----VATSAGVMLFY
PLSY3_BACAN      -----LWFGLAAVLGHVYPIFAKFR---------------GGKA-----VATSAGVLLCY
PLSY2_BACHK      -----LWFGLAAVLGHVYPIFAKFR---------------GGKA-----VATSAGVLLCY
PLSY_BACC2       -----LWFGLAAVLGHVYPIFAKFR---------------GGKA-----VATSAGVLLCY
PLSY2_BACCR      -----LWFGLAAVLGHVYPIFAKFR---------------GGKA-----VATSAGVLLCY
PLSY2_BACCZ      -----LWFGLAAVLGHVYPIFAKFR---------------GGKA-----VATSAGVLLCY
PLSY2_BACC1      -----LWFGLAAVLGHVYPIFAKFR---------------GGKA-----VATSAGVLLCY
PLSY_BACCN       -----LLFGLAAVLGHVYPIFARFR---------------GGKA-----VATSAGVLLCY
PLSY2_OCEIH      -----LAIGLLAVVGHMYPIFAKFR---------------GGKA-----VATSGGMILGM
PLSY_LISMC       ----WLLTGAFAIIGHSFPLFAGFR---------------GGKA-----VATSAGVILAY
PLSY_LISMF       ----WLLTGAFAIIGHSFPLFAGFR---------------GGKA-----VATSAGVILAY
PLSY_LISMH       ----WLLTGAFAIIGHSFPLFAGFR---------------GGKA-----VATSAGVILAY
PLSY_LISMO       ----WLLTGAFAIIGHSFPLFAGFR---------------GGKA-----VATSAGVILAY
PLSY_LISIN       ----WLLTGAFAIIGHSFPLFAGFR---------------GGKA-----VATSAGVILAY
PLSY_LISW6       ----WLLTGAFAIIGHSFPLFAGFR---------------GGKA-----VATSAGVILAY
PLSY2_BACAN      -----IVCGLLAILGHIFSVFASFK---------------GGKA-----VATATGVFLFL
PLSY_EXIS2       -----LFAGLAAVVGHIYPVFARFK---------------GGKA-----VATSGGMLLVT
PLSY_STRR6       ----PLIFGLLAVIGHTFPIFAGFK---------------GGKA-----VATSAGVIFGF
PLSY_STRZJ       ----PLIFGLLAVIGHTFPIFAGFK---------------GGKA-----VATSAGVIFGF
PLSY_STRZP       ----PLIFGLLAVIGHTFPIFAGFK---------------GGKA-----VATSAGVIFGF
PLSY_STRP2       ----PLIFGLLAVIGHTFPIFAGFK---------------GGKA-----VATSAGVIFGF
PLSY_STRPJ       ----PLIFGLLAVIGHTFPIFAGFK---------------GGKA-----VATSAGVIFGF
PLSY_STRP4       ----PLIFGLLAVIGHTFPIFAGFK---------------GGKA-----VATSAGVIFGF
PLSY_STRPN       ----PLIFGLLAVIGHTFPIFAGFK---------------GGKA-----VATSAGVIFGF
PLSY_STRP7       ----PLIFGLLAVIGHTFPIFAGFK---------------GGKA-----VATSAGVIFGF
PLSY_STRPI       ----PLIFGLLAVIGHTFPIFAGFK---------------GGKA-----VATSAGVIFGF
PLSY_STRPS       ----PLIFGLLAVIGHTFPIFAGFK---------------GGKA-----VATSAGVIFGF
PLSY_STRZT       ----PLIFGLLAVIGHTFPIFAGFK---------------GGKA-----VATSAGVVFGF
PLSY_STRGC       ----PMIFGLIAVLGHTFPIFAEFK---------------GGKA-----VATSAGVVLGF
PLSY_STRSV       ----PLVFGLLAVIGHTFPIFAGFK---------------GGKA-----VATSAGVVLGF
PLSY_LACLM       ----PLIFGLLAVIGHTLSIFDHFK---------------GGKA-----VATSAGVVLGF
PLSY_LACLS       ----PLIFGLLAVIGHTLSIFDHFK---------------GGKA-----VATSAGVVLGF
PLSY_LACLA       ----PLIFGLLAVIGHTFSIFDRFK---------------GGKA-----VATSAGVILGF
PLSY_STRA3       ----PFFIGFFAIIGHTFPIFAQFK---------------GGKA-----VATSAGVLLGF
PLSY_STRA5       ----PFFIGFFAIIGHTFPIFAQFK---------------GGKA-----VATSAGVLLGF
PLSY_STRA1       ----PFFIGFFAIIGHTFPIFAQFK---------------GGKA-----VATSAGVLLGF
PLSY_STRT1       ----PLIIGFFAIIGHVFPFFTGFK---------------GGKA-----VATSAGVLLGF
PLSY_STRT2       ----PLIIGFFAIIGHVFPFFTGFK---------------GGKA-----VATSAGVLLGF
PLSY_STRTD       ----PLIIGFFAIIGHVFPFFTGFK---------------GGKA-----VATSAGVLLGF
PLSY_STREM       ----PIAIGFFAVLGHTFPIFAGFK---------------GGKA-----VATSAGVLLGF
PLSY_STRS7       ----PIAIGFFAVLGHTFPIFAGFK---------------GGKA-----VATSAGVLLGF
PLSY_STRE4       ----PITIGFFAVLGHTFPIFAGFK---------------GGKA-----VATSAGVLLGF
PLSY_STRPM       ----SIAIGFFAVLGHTFPIFANFK---------------GGKA-----VATSAGVLLGF
PLSY_STRPZ       ----SIAIGFFAVLGHTFPIFANFK---------------GGKA-----VATSAGVLLGF
PLSY_STRP6       ----SIAIGFFAVLGHTFPIFANFK---------------GGKA-----VATSAGVLLGF
PLSY_STRP8       ----SIAIGFFAVLGHTFPIFANFK---------------GGKA-----VATSAGVLLGF
PLSY_STRPB       ----SIAIGFFAVLGHTFPIFANFK---------------GGKA-----VATSAGVLLGF
PLSY_STRPC       ----SIAIGFFAVLGHTFPIFANFK---------------GGKA-----VATSAGVLLGF
PLSY_STRPD       ----SIAIGFFAVLGHTFPIFANFK---------------GGKA-----VATSAGVLLGF
PLSY_STRPF       ----SIAIGFFAVLGHTFPIFANFK---------------GGKA-----VATSAGVLLGF
PLSY_STRPG       ----SIAIGFFAVLGHTFPIFANFK---------------GGKA-----VATSAGVLLGF
PLSY_STRP1       ----SIAIGFFAVLGHTFPIFANFK---------------GGKA-----VATSAGVLLGF
PLSY_STRP3       ----SIAIGFFAVLGHTFPIFANFK---------------GGKA-----VATSAGVLLGF
PLSY_STRMU       ----PLLFGFFAILGHTFPIFANFK---------------GGKA-----VATSAGILLGF
PLSY_LACBA       ----PLLFGLFAVLGHTVSIFDHFK---------------GGKA-----VATSAGMLLAY
PLSY_LACPL       ----TLLIGLAAILGHTFSIYIGFK---------------GGKA-----VATSAGILLAY
PLSY_LACP3       ----VLIVGLAAVFGHTFSIYIRFK---------------GGKA-----VATSAGILLAY
PLSY_LACCB       ----VLIVGLAAVFGHTFSIYIRFK---------------GGKA-----VATSAGILLAY
PLSY_LACSS       ----VLVVGLAAVIGHAYSIFLRFT---------------GGKA-----VATSAGILLAY
PLSY_LACRD       ----PLLIGLFASLGHTVSIFDNFH---------------GGKA-----VATSAGILLAY
PLSY_LACRJ       ----PLLIGLFASLGHTVSIFDNFH---------------GGKA-----VATSAGILLAY
PLSY_LACS1       ----VLLIGLSAILGHVFPIFAGFR---------------GGKA-----VATSVGVLLVY
PLSY_ENTFA       ----PLFFGVAAVLGHTFPIFANFK---------------GGKA-----VATSAGMLLAY
PLSY2_LACAC      ----CLIFGLVAILGHAFPIFLKFK---------------GGKA-----VATSAGFLLGY
PLSY2_LACJO      ----LLIAGACAILGHTFSIFLKFK---------------GGKA-----VATSAGVFLGY
PLSY_STAA1       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAA2       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAA9       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAAW       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAAM       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAAN       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAAR       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAAS       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAAB       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAA3       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAA8       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAAT       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAAC       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAAE       ----GLIVGLFAILGHVYPVYLKFQ---------------GGKA-----VATSAGVVLGV
PLSY_STAEQ       ----GLIVGLFAILGHVYPIYLKFN---------------GGKA-----VATSAGVVLGV
PLSY_STAES       ----GLIVGLFAILGHVYPIYLKFN---------------GGKA-----VATSAGVVLGV
PLSY_STAHJ       ----GLIVGLFAILGHVYPIYLRFK---------------GGKA-----VATSAGVVLGV
PLSY_STAS1       ----GLIVGAFAILGHVYPVYLGFK---------------GGKA-----VATSAGVILGV
PLSY_STACT       ----GLIVGVFAILGHVYPIFLKFH---------------GGKA-----VATSAGVVLGV
PLSY_MACCJ       ----GIWFGLAAIIGHVYPIYLNFK---------------GGKA-----VATSAGVILGV
PLSY_PELLD       -VALRLLAGMAAVIGHVFTVFAGFK---------------GGKG-----VSTAAGMLIGI
PLSY_CHLPM       -VALRLLAGMSAVIGHVFTVFAGFK---------------GGKG-----VSTAAGMLIGI
PLSY_CHLL2       -VALRLLAGMSAVVGHVFTVFAGFK---------------GGKG-----VSTAAGMLIGI
PLSY_PELPB       -VALRLLAGMSAVIGHVFTLFAGFK---------------GGKG-----VSTAAGMLIGI
PLSY_CHLCH       -VALRLLAGMSAVIGHVFTVFAGFR---------------GGKG-----VSTAAGMLIGI
PLSY_CHLPD       -VALRLLAGMSAVIGHVFTVFAGFK---------------GGKG-----VSTAAGMLIGI
PLSY_CHLP8       -IALNLIAGMSAVIGHVFTVFAGFK---------------GGKG-----VSTAAGMLIGI
PLSY_CHLTE       -IALSLIAGMAAVIGHVFTVFAGFK---------------GGKG-----VSTAAGMLIGI
PLSY_CHLPB       -IALRLIAGLSAVFGHVFTVFAGFK---------------GGKG-----VSTAAGMMFGI
PLSY_PROA2       -VALRLIAGLAAVFGHVFTVFAGFR---------------GGKG-----VSTAAGMMFGI
PLSY_SALRD       FVVLGLLAGVGAVIGHMYPIFARFE---------------GGKG-----VNTAAGMLFAL
PLSY_THEP3       ------IAGIAVVCGHNWPVFLKFR---------------GGKG-----IATSVGVVMTV
PLSY_THEPX       ------IAGIAVVCGHNWPVFLKFR---------------GGKG-----IATSVGVVMTV
PLSY_CALS4       ------IAGIAVVCGHNWPIFLKFR---------------GGKG-----VATSVGVVMTI
PLSY_ALKMQ       ------MAGIAVVIGHNWPVLLGFK---------------GGKG-----IATTIGVALIA
PLSY_CLOD6       ----GYLAVICVVAGHNWPAVLGFR---------------GGKG-----VATSLGAMLAV
PLSY_FINM2       ------VCGLLCVIGHILPVLYNFK---------------GGKG-----IATSFGVLLFA
PLSY_SYNWW       ------ICVILAVIGHIYPVFLGFK---------------GGKG-----VTTSAGIILFL
PLSY2_DESHY      ----GIIAGLLAMAGHSWNPFFGFKP--------------SGKG-----VASGFGIILVL
PLSY_SYMTH       ----FVAAGLLASLGHSYPVWLRFR---------------GGKS-----VATSGGVMLLH
PLSY_BACHD       --WFAAAAGIAAIIGHNWPIYYGFR---------------GGKG-----VATTIGVLASL
PLSY_BACSK       --LVPALAGLAAILGHNWPIYFGFR---------------GGKG-----VATSIGVVATL
PLSY3_DEHM1      ILFAQVLAGLAAVAGHIWPVFLKFR---------------GGRG-----VATFFGGMIAL
PLSY3_DEHMC      LLFAQVLAGLAAVAGHIWPVFLKFR---------------GGRG-----VATFFGGMIAL
PLSY_AQUAE       --------GLASVLGHMYPVFFGFK---------------GGKG-----VATALGVVFAV
PLSY_HYDS0       --------MVSPVIGHIYSYRSDFK---------------GGKG-----VATAFGVVFGI
PLSY1_BACAN      --TFVMLTLLAVIMGHIYPMLFKGK---------------GGKG-----ISTFIGGLIAF
PLSY1_BACCZ      --TFVMLTLLAVIIGHIYPVLFKGK---------------GGKG-----ISTFIGGLIAF
PLSY1_BACHK      --TFLMLTLLAVIMGHIYPILFKGK---------------GGKG-----ISTFIGGLIAF
PLSY1_BACC1      --TFVMLALLAVLLGHIYPIVFKGK---------------GGKG-----ISTFIGGLIAF
PLSY1_BACCR      --TFVMLTLLAVIIGHIYPVLFKGK---------------GGKG-----ISTFIGGLIAF
PLSY1_LACAC      --INIAYAGLGLILGHCFPIWNHFK---------------GGKG-----VAVSAQVAVFY
PLSY1_LACJO      --LDLSFAGLGVVLGHSFPFWNHFK---------------GGKG-----VAVTALWIVFF
PLSY_MYCCT       SQTSYFIPCIFALIGHCFPIYYKFK---------------GGKA-----VSCFLGLLFVV
PLSY_MYCMS       SQTSYFIPCIFALIGHCYPIYYKFK---------------GGKA-----VSCFLGLLFVV
PLSY_MESFL       SKTSYFIPCIFVLIGHCWPIWFKFK---------------GGKA-----VSCFLGLLIVV
PLSY_MYCAP       SPQAL---GLGVVIGHIFPAYYKFK---------------GGKG-----AACTVGLIISI
PLSY_MYCS5       A-------GLAAQIGQAYPIYFKFR---------------GGKG-----VAATVGLLISI
PLSY_MYCMO       L---------FVIIGHVFPIYFKFK---------------GGKG-----AATNLGMIASL
PLSY_MYCPU       Y---------CVVIGHIFPIWHKFK---------------GGKG-----AASTLGYIISV
PLSY_UREP2       QAILVYFGGIFTIIGHCYPIFFKFQ---------------GGKG-----VACYGGFLITV
PLSY_UREPA       QAILVYFGGIFTIIGHCYPIFFKFQ---------------GGKG-----VACYGGFLITV
PLSY_UREU1       QAILVYFGGIFTIIGHCYPIFFKFQ---------------GGKG-----VASYGGFLITI
PLSY_MYCGE       TYFLSYLSCFAATIGHIFPLYFKFK---------------GGKA-----IATTGGSLLAI
PLSY_MYCPN       VYYLTYLSCFAATIGHIFPLYFKFK---------------GGKA-----IATTGGSLLAI
PLSY_MYCGA       TYYLTYLAPLAAIFGHMYPVYFKFN---------------GGKA-----VATTAGFVFVV
PLSY_PSELT       --------SIFAVLGHDFPVFLRFK---------------GGKG-----VASTTGVFFAL
PLSY_THEM4       --------GTMAVLGHCYSIFLKFK---------------GGKG-----VASTFGVFLAV
PLSY_KOSOT       --------GFFAGVGHCYPIWLKFK---------------GGKS-----VAVSVGTISGT
PLSY2_THEMA      --------AIATVLGHDFPIFMKFK---------------GGKG-----VASTLGIIFCL
PLSY_THEP1       --------AIATVLGHDFPIFMKFK---------------GGKG-----VASTLGIIFCL
PLSY_ANAMF       HKSIMYLTGFTVVLGHIFPVWFLFK---------------GGKG-----IAPTIGVVLSI
PLSY_ANAMM       HKSIMYLTGFTVVLGHIFPVWFLFK---------------GGKG-----IAPTIGVVLSI
PLSY_ANAPZ       TKEELCIVGLLSVLGHIYPIWLKFK---------------GGKG-----VATGIGVIIPL
PLSY_EHRCJ       DQTFVFMSALFSIIGHMFPVWLSFK---------------GGKG-----VATLLGSIMFI
PLSY_EHRCR       DQTFAFISAMFSIIGHMFPVWLLFK---------------GGKG-----ISTLLGSMVLI
PLSY_EHRRG       DNTILFLAALFAIIGHMFPVYLFFK---------------GGKG-----VAPLLGSLIFI
PLSY_EHRRW       DNTILFLAALFAIIGHMFPVYLFFK---------------GGKG-----VAPLLGSLIFI
PLSY_BARHE       NNIFISLAGFFAFLGHLFPVWLKFK---------------GGKG-----VATYLGVCLGL
PLSY_BARQU       NSIIISLVGFFAFLGHLFPIWLKFK---------------GGKG-----VATYLGVCLGY
PLSY_BART1       KSILISLAGFFAFLGHLFPVWLKFK---------------GGKG-----VATYLGVCLGV
PLSY_BARBK       NNIISVLAGFFAFWGHLFPIWLKFK---------------GGKG-----VATYLGVCLGL
PLSY_PELUB       YPDYIFIASLSAFLGHVFPIWLKFK---------------GGKG-----VATYVGILFSI
PLSY_WOLPM       NDFYIYVSAILAVLGHMFPIWLKFS---------------GGKG-----VATTLGILIAF
PLSY_WOLPP       NDLYIYVSAILAVLGHMFPIWLRFN---------------GGKG-----VATTLGVLIAL
PLSY_WOLTR       GSFHMYASAILVVLGHMFPVWLKFS---------------GGKG-----VATTLGILIAL
PLSY_ARCB4       TNETLWAIAVLAVLGHCYSIYLGLE---------------GGKG-----VATGLGVYIVL
PLSY_SULDN       SEATLWGISVLAVLGHCYSPYLGFE---------------GGKG-----VATGMGVMMFM
PLSY_WOLSU       SVETQWAIAVLAVVGHCFSPYLKLE---------------GGKG-----VATGLGVMAVM
PLSY_NITSB       PPATWWLIGIMTVLGHCYSPFLKFE---------------GGKG-----VATGMGVLLVL
PLSY_CAMJ8       DQALLWSVAVLAIFGHCFSIYLLFE---------------GGKG-----IATGAGAMIVL
PLSY_CAMJJ       DQALLWSVAVLAIFGHCFSIYLLFE---------------GGKG-----IATGAGAMIVL
PLSY_CAMJE       DQALLWSVAVLAILGHCFSIYLLFE---------------GGKG-----IATGAGAMIVL
PLSY_CAMJR       DQALLWSVAVLAILGHCFSIYLLFE---------------GGKG-----IATGAGAMIVL
PLSY_CAMJD       DQALLWSVAVLAIFGHCFSIYLLFE---------------GGKG-----IATGAGAMIVL
PLSY_CAMLR       DDNILWTMAVLAVFGHCFSPYLKFE---------------GGKG-----VATGAGVLAVF
PLSY_CAMC1       SQSVLWTMAVLSVAGHCFSIFLGFQ---------------GGKG-----VATGAGVLAFF
PLSY_HELPH       DYSLQWMVAIASILGHCYSPFLNFN---------------GGKG-----VSTIMGSVVLL
PLSY_HELPJ       DYSLQWMVAIASILGHCYSPFLNFN---------------GGKG-----VSTIMGSVVLL
PLSY_HELPY       DYSLQWMVAIASILGHCYSPFLNFN---------------GGKG-----VSTIMGSVVLL
PLSY_HELAH       DYSLQWMVAIASILGHCYSPFLNFN---------------GGKG-----VSTIMGSVVLL
PLSY_HELHP       SYETQWSIALLAILGHCYSPYLGFK---------------GGKG-----VATAIGSVLLL
PLSY_MYCPE       AGVIIYLGGFAAIIGHCFPCFYFYTLFKTKFNFEEAKKYSGGKG-----VSSAAGFAASI
PLSY_NEOSM       ---FASTVGFVAVFAHVFSVYMAFK---------------GGKG-----VAPMMGVYFVL
PLSY1_OCEIH      QHIYIYLTALFVIIGHNYPITMQFS---------------GGKG-----TASLVGALIAI
PLSY1_THEMA      --YVIAFAALSGILGHAFSPFLKFK---------------GGKA-----IATTFGAWSVL
PLSY2_DEIRA      --LATALATFGVVFGHCYPVWFGFR---------------GGGG-----IAPFLGAMLVV
                               .:                        .*                  

PLSY_AYWBP       NPLIGISGII-FFAIFLRLFGYASLSSIMASTLVNIFLWLNYLYCD--------------
PLSY_ONYPE       NPLIGISGII-FFAIFLRLFGYASLASIIASTLVNVFYG---------------------
PLSY_PHYAS       NPFIGLLGIL-FFVLLFIFVGYASLASIMATLLVDLLLF---------------------
PLSY_ACHLA       NPIIGLSGIG-LFFIVAFSTKYVSIGSVVASFSVAVMMWIGVLIKE--------------
PLSY_CLOAB       APAAVLAGAV-VYFVLRLFTKIVSIKSIAVGITMPIACI---------------------
PLSY_GEOMG       APLAVLIALG-IFVAVVATSRYISLGSITAAAAMPP------------------------
PLSY_GEOSL       SPLSVLGALA-LFIGIVATTRYISLGSIIAAAAMPL------------------------
PLSY_GEODF       SPLSVLAALA-IFVFTLIKWRYVSLASITAAAAIPF------------------------
PLSY_GEOLS       APLAVLGALA-VFILLVAVWRYISLGSIMAAAVMPL------------------------
PLSY_PELCD       SPLAVLGAFA-VFALLVWKWRYVSLGSICAAAAIPI------------------------
PLSY_KORVE       APTPIGIVLG-LFALVVLLTHYISLGSILAAAAFPF------------------------
PLSY_FUSNN       IPVITLILLA-IFILVAYFTKYVSLASITAAFLLPI------------------------
PLSY_UNCTG       MRWPSLIALA-IFGLAFVFSRYVSLGSICAVISLPL------------------------
PLSY_DESAD       APVATFYSIV-FLLAVIALSGFVSMGSLTFAVALPF------------------------
PLSY_DESMR       APIPALLSVA-VCVAVIRVSGYVSAGSLTLAVALPI------------------------
PLSY_DESAG       AFTPLLVSAL-LCALVIWRSGFVSLGSLTLVTALPL------------------------
PLSY_DESVH       AFWPLVLSGI-ACLAVIWRSGFVSLGSLTLVTAMPA------------------------
PLSY_DESDA       AFWQLLASSL-LCMLVIWRSGFVSLGSLTLVTALPV------------------------
PLSY_LAWIP       AFWQLLFAAI-LCTFFIWRSGFVSLGSLVLVTSLPI------------------------
PLSY_LEPBJ       TPIACFGAIF-VFLVTIKYFKFVSIGSIFASLTLPLVYAFSSI-----------------
PLSY_LEPBL       TPIACFGAIF-VFLVTIKYFKFVSIGSIFASLTLPLVYAFSSI-----------------
PLSY_LEPIC       TPIACLGAVL-VFWVVYKFFKFVSLGSIFASITLPLVYAFSTI-----------------
PLSY_LEPIN       TPIACLGAVL-VFWVVYKFFKFVSLGSIFASITLPLVYAFSTI-----------------
PLSY_DESPS       SPAAIAISLG-VFAASVFFSGFVSVGSLLASGLIPL------------------------
PLSY_ECOLI       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SHIB3       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SHISS       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SHIBS       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SHIDS       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECO24       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECO27       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECO45       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECO55       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECO57       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECO5E       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECO7I       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECO81       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECO8A       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECOBW       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECODH       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECOHS       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECOK1       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECOL5       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECOL6       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECOLC       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECOLU       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECOSE       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECOSM       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ECOUT       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SHIF8       SWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SHIFL       SWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ESCF3       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALSV       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALTI       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALTY       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALA4       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALCH       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALDC       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALEP       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALG2       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALHS       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALNS       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALPA       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALPB       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALPK       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_CITK8       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_SALAR       GWDLTGVIAG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_ENT38       GWDLTGVMAG-TWLLSVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_CROS8       GWDLTGVMAG-TWLLTVLLSGYSSLGAIVSALVAPF--YVWWFKP---------------
PLSY_KLEP3       GLDLTGVMAG-TWLLTILLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_KLEP7       GLDLTGVMAG-TWLLTILLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_PECAS       GLDLTGLMTG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_PECCP       GWDLTGLMTG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_YERP3       GWDLTGLMTG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_YERPA       GWDLTGLMTG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_YERPB       GWDLTGLMTG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_YERPE       GWDLTGLMTG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_YERPN       GWDLTGLMTG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_YERPP       GWDLTGLMTG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_YERPS       GWDLTGLMTG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_YERPY       GWDLTGLMTG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_YERE8       GWDLTGLMTG-TWLLTVLLSGYSSLGAIISALIAPF--YVWWFKP---------------
PLSY_SERP5       GWDLTGLMTG-TWLLTVLLSGYSSLGAIISALIAPF--YVWWFKP---------------
PLSY_ERWT9       GWDLTGLMTG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_EDWI9       GWDLTGLMVG-TWLLTVLLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_PHOLL       GWDLTGLMMG-TWLLTILLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_PROMH       GWDLSGLIAG-TWLLTVLLSGYSSLGAIISALLAPF--YVWWFKP---------------
PLSY_SODGM       GYDLSGLMIG-TWLLTALLSGYSSLGAIVSALIAPF--YVWWFKP---------------
PLSY_HAEI8       SWAVAGSMFG-TWIFVFLVSGYSSLSAVISALLVPF--YVWWFKP---------------
PLSY_HAEIG       SWAVAGSMFG-TWIFVFLVSGYSSLSAVISALLVPF--YVWWFKP---------------
PLSY_HAEIN       SWAVAGSMFG-TWIFVFLVSGYSSLSAVISALLVPF--YVWWFKP---------------
PLSY_HAEIE       SWAVAGSMFG-TWIFVFLVSGYSSLSAVISALLVPF--YVWWFKP---------------
PLSY_PASMU       SWGVAGSMLG-TWLLIFFVSGYSSLSAVMTALLVPF--YVWWFKP---------------
PLSY_ACTSZ       GWGVMATMLG-TWVLVFVISGYSSLSAVISALLVPL--YVWWFRP---------------
PLSY_MANSM       SWGIAGAMLG-TWGIIFLLSGYSSLSAVIAALVTPF--YVWWIRP---------------
PLSY_HAES1       AWGVAGSMLG-TWLLIFLFSGYVALSTVVTALILPF--YVWWFKP---------------
PLSY_ACTP2       SFAASAAGLC-TWLIVFLLFGYSSLSAVITALIMPF--YIWWFLP---------------
PLSY_ACTP7       SFAASAAGLC-TWLIVFLLFGYSSLSAVITALIMPF--YIWWFLP---------------
PLSY_ACTPJ       SFAASAAGLC-TWLIVFLLFGYSSLSAVITALIMPF--YIWWFLP---------------
PLSY_HAEDU       SIIASTTMIC-AWLIVFLLTRFSSLSAVIMALTAPF--YIWCFKP---------------
PLSY_HAEPS       GYSVAGLAVG-TWLFVFLISGYSSLSAVITALIVPL--YIWWFSS---------------
PLSY_AERS4       GFTMGGAVIG-TWLVVLLVSGYSSLASIITVLLSPL--FTYLIKP---------------
PLSY_TOLAT       GLDMGSFMIV-TWLIVLLFTGYSSLAAIGAALLAPL--YTYCLKP---------------
PLSY_ALIF1       GLDLTGMLFG-CWVVTVLVTGYSSLASMITALLAPL--FTWLVKP---------------
PLSY_ALIFM       GLDLTGMLFG-CWVVTVLVTGYSSLASMITALLAPL--FTWLVKP---------------
PLSY_ALISL       GLDLTGLLFG-TWVVIVLITGYSSLASMATALLAPL--FTWLVKP---------------
PLSY_PHOPR       GWDLSGMLIG-TWLLTVFITGYSSLGSLITALAAPL--LTWFVKP---------------
PLSY_VIBC3       GLDLTAMVMA-TWLVVVVLFRYSSLAALVTVLLAPL--YTWLIKP---------------
PLSY_VIBCH       GLDLTAMVMA-TWLVVVVLFRYSSLAALVTVLLAPL--YTWLIKP---------------
PLSY_VIBCM       GLDLTAMVMA-TWLVVVVLFRYSSLAALVTVLLAPL--YTWLIKP---------------
PLSY_VIBCB       GLDLTGLVML-TWLSVAVLFRYSSLAALVTVLVTPF--YTWMFKP---------------
PLSY_VIBPA       GLDLTGLVML-TWLSVAVLFRYSSLAALVTVLVTPF--YTWMFKP---------------
PLSY_VIBTL       GFDLTGMIMA-TWLVVAFLFRYSSLAALVTVLLAPF--YAWLVKP---------------
PLSY_VIBVU       GLDLTGMIMA-TWLLVAILFRYSSLAALVTVLLAPM--YTWMIKP---------------
PLSY_VIBVY       GLDLTGMIMA-TWLLVAILFRYSSLAALVTVLLAPM--YTWMIKP---------------
PLSY_IDILO       AWEMALLLIA-TWLLVFRVSRVSSLAALVTVCLAPF--YAYWIKP---------------
PLSY_PSEA6       GWELVSLLLA-CWLVIVFITGYSSLAAIISVSVAPF--ITWFVKP---------------
PLSY_COLP3       GFTLGGLLIL-TWVLVVKLTKYSSLAAIVTVSIAPL--YVYFLKP---------------
PLSY_PSEHT       GLSLAGLLIC-TWFIMVAITRYSSLAALVAVSLAPL--YTWLIKP---------------
PLSY_SHEB2       GDDLAICLMA-SWVVLLLISRYSSLAAILTALLAPL--YTWWLDD---------------
PLSY_SHEB5       GDDLAICLMA-SWVVLLLISRYSSLAAILTALLAPL--YTWWLDD---------------
PLSY_SHEB8       GDDLAICLMA-SWVVLLLISRYSSLAAILTALLAPL--YTWWLDD---------------
PLSY_SHEB9       GDDLAICLMA-SWVVLLLISRYSSLAAILTALLAPL--YTWWLDD---------------
PLSY_SHESA       GDDLAICLMA-SWVVLVLISRYSSLAAIITALLAPL--YTWWLDD---------------
PLSY_SHESR       GDDLAICLMA-SWVVLVLISRYSSLAAIITALLAPL--YTWWLDD---------------
PLSY_SHESM       GDDLAICLMA-SWVVLVLISRYSSLAAIITALLAPL--YTWWLDD---------------
PLSY_SHEON       GDDLAICLMA-SWVVLVLISRYSSLAAIITALLAPL--YTWWLDD---------------
PLSY_SHEPC       GDDLAICLMA-SWVVLLLISRYSSLAAIITALLAPL--YTWWLDE---------------
PLSY_SHESW       GDDLAICLMA-SWVVLLLISRYSSLAAIITALLAPL--YTWWLDE---------------
PLSY_SHEHH       GHDLALCLLA-SWIVLVLVTRYSSFAAICTALLAPV--YTWWLDD---------------
PLSY_SHESH       GHELALALMV-TWIVMVLISRYSSLAAITTAMLAPI--YTWFLDE---------------
PLSY_SHEWM       GPELALLLMG-SWVLMVLICRYSSLAAIVTALLAPF--YTWYLDD---------------
PLSY_SHELP       GADLSLALIA-TWVIVVLICRYSSLAAIVTALLAPA--YTWYFDE---------------
PLSY_SHEDO       GEDLALFLLA-TWLVFALITRYSSVAAIIAASLAPL--YTWWLDE---------------
PLSY_BLOFL       SINFFIIIII-TWILTVYLFRYASLGSIVTFIVITF--YVWYIQY---------------
PLSY_BLOPB       DLHLSIVMIS-SWTLTVLSFGYSSLGAIVTAFIIPC--YAWHFQS---------------
PLSY_COXB1       SFWIGLFVIA-TWVIVVSIFRYSSVAALVSAVAAPI-YTIIAGRT---------------
PLSY_COXBU       SFWIGLFVIA-TWVIVVSIFRYSSVAALVSAVAAPI-YTIIAGRT---------------
PLSY_COXBN       SFWIGLFVIA-TWVIVVSIFRYSSVAALVSAVAAPI-YTIIAGRT---------------
PLSY_COXBR       SFWIGLFVIA-TWVIVVSIFRYSSVAALVSAVAAPI-YTIIAGRT---------------
PLSY_COXB2       SFWIALFVIA-TWVIVVSIFRYSSVAALVSAVAAPI-YTIIAGRT---------------
PLSY_FRAT1       SWILGLIFVI-TWLCVAIITRYSSLSALVATVIASF-SVIFTSDL---------------
PLSY_FRATT       SWILGLIFVI-TWLCVAIITRYSSLSALVATVIASF-SVIFTSDL---------------
PLSY_FRATF       SWILGLIFVI-TWLCVAIITRYSSLSALVATVIASF-SVIFTSDL---------------
PLSY_FRATH       SWILGLIFVI-TWLCVAIITRYSSLSALVATVIASF-SVIFTSDL---------------
PLSY_FRATN       SWILGLIFVI-TWLCVAIITRYSSLSALVATVIASF-SVIFTSDL---------------
PLSY_FRATO       SWILGLIFVI-TWLCVAIITRYSSLSALVATVIASF-SVIFTSDL---------------
PLSY_FRATM       SWILGLIFVI-TWLCVAIITRYSSLSALVATFIASF-SVIFTSDL---------------
PLSY_FRAP2       SWILGLIFVV-TWLCVAVITRYSSLSALVATVIASF-SVIFTSDL---------------
PLSY_LEGPC       HFVIGVMVAA-TWLLVANFWRYSSLASIASISLAPFYSLILVGNL---------------
PLSY_LEGPH       HFIIGVMVAA-TWLLVANFWRYSSLASIASISLAPFYSLILVGNL---------------
PLSY_LEGPA       HFVIGVMVAA-TWLLVANFWRYSSLASIASISLAPFYSLILVGNL---------------
PLSY_LEGPL       HFVIGVMVAA-TWLLVANFWRYSSLASIASISLAPFYSLILVGNL---------------
PLSY_RUTMC       SYLTGLSFII-TWVFVAKVLKISSLSALISTVLTPVYFYLITNNL---------------
PLSY_AROAE       NAWVALSALF-VWLAVAVLTRYSSAAALAAAVITPISGAVLLGAT---------------
PLSY_LARHH       NPWLALIAAA-VWLAVALLTRYSSLAAMVSAVATAVA-AWFIEPG---------------
PLSY_DECAR       DPMLGLAVAG-TWLFMAYAFRYSSLAAVVAAAMAPVISVLMHGGN---------------
PLSY_NITEC       NLWLGILAIL-TWIIVALVSRISSLSALLSALLAPLYTYFLLQKE---------------
PLSY_NITEU       NPWLGVLTIS-TWMVVALVSRISSLSALLSALLAPLYAYFLLEKG---------------
PLSY_NITMU       NPWMGLLAAT-IWLAVALMWRFSSLAAIVAASLAPFYALFFLGFE---------------
PLSY_METFK       SPLLAGLALL-SWIVVFALTRFSSLAALTAAALAPGFAWLLLPQI---------------
PLSY_BORBR       EPWLAVATIA-TWLIVAVFSRYSSLAALVAAFFAPVYYVFGSGAAW--------------
PLSY_BORPE       EPWLAVATIA-TWLIVAVFSRYSSLAALVAAFFAPVYYVFGSGAAW--------------
PLSY_BORPA       EPWLAVATIA-TWLIVAVFSRYSSLAALVAAFFAPVYYVFGSGAAW--------------
PLSY_BORPD       HPGLALATAA-TWVIIAVFFRYSSLAALVAAFFAPVYYLFGSGVAW--------------
PLSY_BORA1       SPWLALATVA-TWLLVAVVTRYSSLAALVAAFLAPVYYFFGGGTIW--------------
PLSY_BURA4       HPVLGLATAL-TWLIVAFFFRYSSLAALVAAVFAPLFDVFLFGTR---------------
PLSY_BURCM       HPVLGLATAL-TWLIVAFFFRYSSLAALVAAVFAPLFDVFLFGTS---------------
PLSY_BURL3       HPVLGLATAL-TWLIVAFFFRYSSLAALVAAVFAPVFDVFLFGTG---------------
PLSY_BURVG       HPVLGLATAL-TWLIVAFFFRYSSLAALVAAVFAPVFDVFLFGTR---------------
PLSY_BURCA       HPVLGLATAL-TWLIVAFFFRYSSLAALVAAVFAPVFDVFLFGMPG--------------
PLSY_BURCH       HPVLGLATAL-TWLIVAFFFRYSSLAALVAAVFAPVFDVFLFGMPG--------------
PLSY_BURCJ       HPVLGLATAL-TWLIVAFFFRYSSLAALVAAVFAPVFDVFLFGTPG--------------
PLSY_BURCC       HPVLGLATAL-TWLIVAFFFRYSSLAALVAAVFAPVFDVFLFGMPG--------------
PLSY_BURM1       HPVLGLATAL-TWLIIAFFFRYSSLAALVAAVFAPLFDVFLFGTN---------------
PLSY_BURP1       HPVLGLATAL-TWLIVAFFFRYSSLAALVAAVFAPIFDVFLFGTH---------------
PLSY_BURPS       HPVLGLATAL-TWLIVAFFFRYSSLAALVAAVFAPIFDVFLFGTR---------------
PLSY_BURMA       HPVLGLATAL-TWLIVAFFFRYSSLAALVAAVFAPIFDVFLFGTH---------------
PLSY_BURTA       HPALGLATAL-TWLIIAFFFRYSSLAALVAAVFAPVFDVFLFGTR---------------
PLSY_PARPJ       NPILGVATLL-TWLIVAFFTRYSSLAALAAAVFAPIFDGFLFGPH---------------
PLSY_PARXL       NPILGVATLL-TWLIVAFFTRYSSLAALAAAVFAPIFDGFLFGPH---------------
PLSY_PARP8       NPILGIATLL-TWLIVAFFTRYSSLAALCAAIFAPLFDGFLFGAN---------------
PLSY_CUPTR       DPILGLGTLA-TWLIIAFFFRYSSLAALVAAIFAPFFHVLMNGVD---------------
PLSY_CUPNH       DPILGLGTLA-TWLIIAFFFRYSSLAALVAAIFAPFFHVLMNGVD---------------
PLSY_CUPMC       DPILGAGTLA-TWLIIAFFFRYSSLAALISAIFAPFFYVLMNGVD---------------
PLSY_CUPPJ       NPILGLATLA-TWVIIAFFFRYSSLAALVAAIFAPVFYVLMEGID---------------
PLSY_RALPJ       NVWLGLATLA-TWLIIAVFFRYSSLAALVSAVFAPFFYVLMNGFD---------------
PLSY_RALSO       SGWLGLATLA-TWLIIATFFRYSSLAALVSAVFAPFYYVLLFGID---------------
PLSY_HERAR       NGWLGLATLI-TWLVIAYAFRYSSFAALIAAIFAPFYYALMFGPD---------------
PLSY_JANMA       NGWLGLATLV-TWLVIAYAFRYSSLAALIAAIFAPFYYGLLFGPD---------------
PLSY_RHOFT       SPILALATGA-TWLIMAYFFRYVSLASLTAAVFVPVYYVFGDGMAW--------------
PLSY_CHRVO       NPWLALAALA-TWLFMAFVVKISSLSAIVACVLAPVYAFFILGPHS--------------
PLSY_THIDA       DPWLGLACLA-TWVAMALVFRISSLSALVTAVLAPVYAGLLLGWND--------------
PLSY_NEIG1       SPATALVCAL-IWLVMAFGFKVSSLAALVATTAAPLAALFFM-PHT--------------
PLSY_NEIG2       SPATALVCAL-IWLVMAFGFKVSSLAALVATTAAPLAALFFM-PHT--------------
PLSY_NEIMA       SPTTALVCAL-IWLVMAFGFKVSSLAALTATIAAPLAALFFM-PHT--------------
PLSY_NEIMF       SPATALVCAL-IWLVMAFGFKVSSLAALTATIAAPLAALFFM-PHL--------------
PLSY_NEIM0       SPATALVCAL-IWLVMAFGFKVSSLAALTATIAAPLAALFFM-PHT--------------
PLSY_NEIMB       SPATALVCAL-IWLVMAFGFKVSSLAALTATIAAPVAASFFM-PHV--------------
PLSY_METCA       AWPVGLMALL-TWIGVAALFRFSSLSALAAAVLAPVYVWLWL-GSA--------------
PLSY_THISH       QAWVGLAALA-TWLIVAAISRISSLSALTAATLTPVYMYLLT-GER--------------
PLSY_NITOC       SWSLALAVLG-IWLSIFWCWRISSLSALCAAILAPFLAWWLVPDSA--------------
PLSY_HYDCU       SLPIGAAVAG-TWLFVAKVLKISSLSALIATALAPLYIYLLADGNM--------------
PLSY_HALHL       SPLALLATVV-TWLAVAGAFRYSSLAAVVAFAMAPIYMLWLS-ASP--------------
PLSY_PSEA8       YPPAVLLAAA-AWLLTFKLSRTSSLASLVATPLTLPLLAWQQPGA---------------
PLSY_PSEAB       YPPAVLLAAA-AWLLTFKLSRTSSLASLVATPLTLPLLAWQQPGA---------------
PLSY_PSEAE       YPPAVLLAAA-AWLLTFKLSRTSSLASLVATPLTLPLLAWQQPGA---------------
PLSY_PSEA7       YPPAVLLAAA-AWLLTFKLSRTSSLASLVATPLTLPLLAWQQPGA---------------
PLSY_AZOVD       YPPAVLPAVA-AWLLVFAFTRTSSLAALAATPLCLPLLAWRQPEA---------------
PLSY_PSE14       YPPAAALAIA-AWLLTLYLTRTSSLAALIATPLTLPLLAWQEPHA---------------
PLSY_PSEU2       YPPAAALAIV-AWLLTLYLTRTSSLAALIATPLTLPLLAWQEPHA---------------
PLSY_PSESM       YPPAAALAIA-AWLLTLYLTRTSSLAALIATPLTLPLLAWQEPHA---------------
PLSY_PSEFS       YPPAALLAVL-AWLLAFYLTRTSSLAALIATPLTLPLLAWQEPAA---------------
PLSY_PSEPF       YPPAALLAVC-AWLLTFYLTRTSSLAALIATPLTLPLLAWQEPAA---------------
PLSY_PSEF5       YPPAALLAIA-AWALTFYLTRTSSLAALIATPLTLPLLAWQEPEA---------------
PLSY_PSEP1       YFPAALLAIG-AWLLTFYLTRTSSLAALIATPLTLPLLAWREPEA---------------
PLSY_PSEPK       YFPAALLAIG-AWLLTFYLTRTSSLAALIATPLTLPLLAWREPEA---------------
PLSY_PSEPG       YFPAALLAIG-AWLLTFYLTRTSSLAALIATPLTLPLLAWREPEA---------------
PLSY_PSEPW       YFPAALLAIA-AWLLTFYLTRTSSLAALIATPLTLPLLAWREPAA---------------
PLSY_PSEE4       YFPAALLAIG-AWVLTFYLTRTSSLAALIATPLTLPLLAWREPEA---------------
PLSY_CHRSD       ATPVAWVCAL-CWALLAWRSRTAAVASLAAALLAPLASYWLAREA---------------
PLSY_HAHCH       AWQTTLALTL-VWAAVVYWKRISSLASLTAALMAPWVAWRLNPEH---------------
PLSY_RHIE6       APIMVVLFAA-VWLAVAFTTRYSSLSALVAMLVIPVALLILGNE---KVAAV--------
PLSY_RHIEC       APIMVVLFAA-VWLAVAVTTRYSSLSALVAMLVIPVALLILGNE---KVAAV--------
PLSY1_RHIL3      APIMVVLFAA-VWLAVAFTTRYSSLSALVAMLVIPVALWILGNE---KVAAV--------
PLSY_AGRFC       APLMMLAFAL-IWLATAFITRYSSLSALLAMLIIPVALWVLGPE---KTAML--------
PLSY_RHIME       MPVMVLLFAA-IWLAMAKITRYSSLSALVATAAVPIALYAAGNG---KVAGL--------
PLSY_SINMW       VPVMVLLFAA-AWLAVAKISRYSSLSALVATAIIPVALYATGNG---KVALL--------
PLSY_SINFN       APLMVPAFAA-IWLAAAKITRYSSLSALIATAVMPIALYATGYG---KVALL--------
PLSY_AGRVS       FPLMVLVFAI-VWLSIAFLSRYSSLSALVATLVIPVALWILGQP---EAAMI--------
PLSY_BRUA1       AWAGALVFAA-AWIVTALLTRYSSPSALVASLIVPIALYSRGNQ---ALAAL--------
PLSY_BRUA2       AWAGALVFAA-AWIVTALLTRYSSPSALVASLIVPIALYSRGNQ---ALAAL--------
PLSY_BRUAB       AWAGALVFAA-AWIVTALLTRYSSPSALVASLIVPIALYSRGNQ---ALAAL--------
PLSY_BRUC2       AWAGALVFAA-AWIVTALLTRYSSLSALVASLVVPIALYSRGNQ---ALAAL--------
PLSY_BRUSU       AWAGALVFAA-AWIVTALLTRYSSLSALVASLVVPIALYSRGNQ---ALAAL--------
PLSY_BRUMB       AWAGALVFAA-AWIVTALLARYSSLSALVASLVVPIALYSRGNQ---ALAAL--------
PLSY_BRUME       AWAGALVFAA-AWIVTALLARYSSLSALVASLVVPIALYSRGNQ---ALAAL--------
PLSY_BRUO2       AWAGALVFAA-AWIVTALLTRYSSLSALVASLVVPIALYSRGNQ---ALAAL--------
PLSY_BRUSI       AWAGALVFAA-AWIVTALLTRYSSLSALVASLVVPIALYSRGNQ---ALAAL--------
PLSY_OCHA4       AWPGALVFAA-VWIVTALLTRYSSLAALIASIVVPIALYSRGYP---AIAVL--------
PLSY_RHILO       AWQVALIFAV-IWLAMAFLFRYSSLAALTAAVIVPIALYFLSAP---QIAVL--------
PLSY_BRASB       FWPGAIFFCL-VWLATAFAFRYSSVAALVASVLTPIVLWAFGHT---ALAAL--------
PLSY_BRASO       LWPYAIFFCL-VWLATAFASRYSSLAALVASVLTPIVLWAFGHT---ALAAL--------
PLSY_BRADU       FWPAAVVFCL-LWLATAFTTRYSSLSALVASFITPMFLWWFGHL---ALSAL--------
PLSY_RHOP2       FWPGAIVFCL-LWLATAVTARYSSLSALVAAFITPIFLWWFGHP---ALASL--------
PLSY_RHOPS       FWPAALVFCV-LWLATAYTTRYSSLSALVAAFITPIFLWWFGHP---TMASL--------
PLSY_RHOPA       FWPAAVVFCI-MWLATAFTSRYSSLSALVASFVTPIFLWWFGHD---SLASL--------
PLSY_RHOPT       FWPAAVVFCI-MWLATAFTSRYSSLSALVASFVTPIFLWWFGHD---SLASL--------
PLSY_RHOPB       FWPGAIVFCV-LWLATALTARYSSLSALVAAFITPIFLWWFGHL---ALASL--------
PLSY_NITHX       FWPAALAFCA-IWLLVAFTTRYSSLSALIASFATPLLLWWLGHP---QLALL--------
PLSY_NITWN       FWPAALAFCA-IWLLVAFTTRYSSLSALLASLTTPLLLWGFGHP---QFALL--------
PLSY_METC4       SPVTLAAFAA-IWLGLAFALKYSSLAALAASAATPLILWALGHG---AVAAL--------
PLSY_METEP       SPVTLAAFAA-IWLGLAFALKYSSLSALAASAATPLILWALGHG---AVAAL--------
PLSY_METPB       SPLTLAAFAA-IWLGLAFALKYSSLAALAASAATPVILWALGHG---GVAAL--------
PLSY_CAUVN       AWPVGVAAGA-TWLAMAFLFRISSLAALTAAVLAAPFALAFDQPY--PFMGL--------
PLSY_CAUVC       AWPVGVAAGA-TWLAMAFLFRISSLAALTAAVLAAPFALAFDQPY--PFMGL--------
PLSY_RHOS1       AWPVGLACCL-TWLATAALGRISSLSALVAAASGVLWMILLGYG---QMAAL--------
PLSY_RHOS4       AWPVGLACCL-TWLATAALGRISSLSALVAAASGVLWMILLGYG---QMAAL--------
PLSY_RHOSK       AWPVGLACCL-TWLATAALGRISSLSALVAAASGVLWMILLGYG---QMAAL--------
PLSY_RHOS5       AWPVGLACCL-TWLATAAVSRISSLSALMAAASGVVWMLLLGQG---QMAAL--------
PLSY_ROSDO       AFPVGVGCCL-AWLAGAFATRISSMGALVASVAAVPLAFLLGFP---GAVVL--------
PLSY_RUEST       AWPVGIACCL-TWLGVAVLRRISSLAALCAAVAAPVWCLLLGAP---QAAVL--------
PLSY_RUEPO       AWPVGVACCL-SWLAGAAVTRISSMGALVAAASSTFWLVLLDQG---AGFVL--------
PLSY_JANSC       AWPIGLAACA-IWAITAAVFRMSSLAALVAAALSPLAAFTLGLP---SAVVF--------
PLSY_DINSH       SWPLGLAAGA-IWLATAYTFRISSLSALMAALMTPIFAWGFGQR---ELVVL--------
PLSY_MAGSA       AWPVGLACIG-TWLVSAAIFRISSLSALIALAASPGFALYFAGPQY-ALMA---------
PLSY_RHORT       AWPVGLAACA-TWLVVAALFRYSSLAALVCLALAPAYALVLATPAH-AAVF---------
PLSY_MARMM       FWPVGLTVIA-TWLAMAAIFRISSLAALAAALAAPFAALAWGRPDV-AIMA---------
PLSY_HYPNA       SPLHGLVVAAPVWLGLFALTRISSLAALTAAVAVPPGAWLMGERNS-LILAG--------
PLSY_ERYLH       GWGIGLAYAF-VWLVMLAITRISSVAGMSAVVAAAGAAWYFGRP---TFVPP--------
PLSY_NOVAD       AWPIGLVYAV-TWLGVLFLSRISSLGGMSAAVVAPVAAAVLGYA---PYVPV--------
PLSY_GLUOX       CWPVGLACCV-VWLLVARLSRISSAGALAAFLLAPGLMVLLSGR---PLHTP--------
PLSY_GRABC       AWPVGLICCA-LWFAVARTIKISSAAALCAFAFAPLLALAVGGM---GLGPPP-------
PLSY_ZYMMO       WWVAGVVFAV-AWLLSAKISRYSSVGGMVGAIAATISVMFMPASHE-IHQVY--------
PLSY_ANAD2       APWAALAGLV-GYAVAYGLTRISSVGSLTGTALCAAGGFATYGPRH-PVSWA--------
PLSY_ANASK       APWAALAGLV-GYAVAYGLTRISSVGSLTGTTLCAAGGFATYGPRH-PISWA--------
PLSY_ANADE       APWAALAGLV-GYAVAYGLTRISSVGSLTGTALCAAGGFATYGVRH-PVPWA--------
PLSY_ANADF       SPWAALAGAV-TYGVAYGATRISSVGSLSGTAVCVLGTFVAHGWTS-PVSWA--------
PLSY_MYXXD       VPQAALAAAL-VYVAVFAVSRVSSLGSLAAGATAVGTSALTARAVE-YAGLS--------
PLSY_DEIGD       DPVVGGGAFV-VGVGCIWLTRFVSAGSILGALTAVTLAAALAR----PGWLL--------
PLSY1_DEIRA      DPVLGLTTFV-LAIACMWLTRFVSAGSIMGAFIAGALVLVLPR----PTWDR--------
PLSY_THET2       DPALALWTFP-IGLSVILLTRYVSAGSMTGGVAAFVLSLALGR----PLWEV--------
PLSY_THET8       DPVLALWTFP-IGLSVILLTRYVSAGSMTGGVAAFVLSLALGR----PLWEV--------
PLSY_RUBXD       APPVGLGMFA-LWWVVALASRYTSLAAMVVTVVSPFAFLLSGQ----PLPYV--------
PLSY_ROSS1       APLVALPGLA-AWAVTFGITRISAVASLTAAAVCGIAAAVLLALGMLPPAYA--------
PLSY1_DEHM1      LPQHLLILAL-LVFIPLAITRNIALATGIALFSLPFLVWYGSHSEFATL-----------
PLSY1_DEHMC      LPQQLGILAL-LVFIPLALTRNIALATGIALFSLPFLVWYGSHSEFATL-----------
PLSY2_DEHM1      MPEGIPIYIA-CFLVLMAITRFPTLSYGISFLSFILVAWLGQH-DLGKV-----------
PLSY2_DEHMC      MPEGIPIYIA-CFLILMAITRFPTLSYGISFISFILVAWLGQH-DMGKV-----------
PLSY5_DEHM1      APVPALIALG-TAIAFGLFKKMAPGVFLGVAALPFMSGYFHGFFGIREY-----------
PLSY4_DEHMC      APVPALIALS-TALTFGFFKKMAPGVFLGVGALPVMSGYFHGFFGVQEH-----------
PLSY4_DEHM1      ATQPMLIMGG-LGLLVLLFTSSVIAASAVMFGLLWLAVILYGLPGGVVA-----------
PLSY1_MOOTA      YPAAVPPGAA-LMGLLTFLTRNTDLATLLTFSALPIYFWWREGPGCYLA-----------
PLSY1_DESHY      DPMLASAAAG-VFLFVLALTRQFTLSGLAAILGAPILSLIMARPFEQSA-----------
PLSY_NOSS1       NWQVGLATFG-VFAVVVAISRIVSLSSIMGAIAVSIVMVFLQ------------------
PLSY_TRIV2       NWQVGLATFG-VFAVVVAISRIVSLSSIMGAIAVSIVMVVLQ------------------
PLSY_TRIEI       SWVVGLGTLS-VFIVVLTISRIVSLSSIIAAISVSGLMFFTG------------------
PLSY_ACAM1       SWTVGLAALG-IFALVVSLSRIVSLSSISAAISLPVLMFVAK------------------
PLSY2_RHIL3      SWPVGLGAAM-VFGVALAISRIVSLSSMLAALTAIALVCGLE------------------
PLSY_SYNJA       AWPVALATFG-VWLLGIALTRIVSFSSLLAAVAAPLLMWALG------------------
PLSY_SYNJB       AWPVALTTFG-VWLLGLALTRIVSFSSLLAAVAAPVVMWATA------------------
PLSY_SYNE7       SPVVGLSGFG-AFLLLLALFRIVSLGSIAGAITVIVLMLILP------------------
PLSY_SYNP6       SPVVGLSGFG-AFLLLLALFRIVSLGSIAGAITVIVLMLILP------------------
PLSY_CROS5       NPIVALGTLG-SFLAMLSLSRIVSLSSITGVVAVNVLMFGLH------------------
PLSY_RIPO1       NPLVALGALA-SFLFMLGITRIVSLSSITGAIAVNLLMLVLH------------------
PLSY_SYNY3       NIWLALGTLA-TFLTVIFFTRIVSLSSIVAAIAVNGIALALQ------------------
PLSY_THEEB       NAPTALATFG-VFLVVLAVSRIVSLSSMTAAIALPFWFWFFT------------------
PLSY_GLOVI       HWPVALTVAA-VWGVCFAVTRIVSFASIVAAAATPLCFYLWR------------------
PLSY_PROM2       SWKVGLASLG-IFLIVLTKTKFVSLSSISAAILLPIFMFFYL------------------
PLSY_PROMS       SWKVGLASLG-IFLIVLTKTKFVSLSSISAAILLPIFMFFYL------------------
PLSY_PROM0       SWKVGLASLG-FFLIVLTKTKYVSLSSISAAILLPIFMFFYL------------------
PLSY_PROM9       SWKVGLASLG-IFLIVLAKTKFVSLSSISAAIFLPFFMFFYL------------------
PLSY_PROM5       SWKVGFASLG-IFLIILSKSKIVSLSSILAAFFLPLFMFLDI------------------
PLSY_PROMP       SWKIGFASLG-IFLIILAKSKIVSLSSISAAIFLPFLMFLDI------------------
PLSY_PROM1       SWQVGLATLG-VFIIMITLFRIVSLASVSASLALPLIMFLSFS-----------------
PLSY_PROMT       SWQVGLATLG-VFIIMITLFRIVSLASVSASLALPLIMFLSFS-----------------
PLSY_PROM4       SWQVGLASLG-IFMAVLSSSKIVSLSSISAAISLPILMFLSLQ-----------------
PLSY_PROMA       SWQVGLGSLG-IFLLILSIWRIVSLASISAAISLPVLMLINSK-----------------
PLSY_SYNPX       AWPVGLACFG-LFMAVISIFRIVSLSSVVAAIGLPLLMVVS-------------------
PLSY_SYNSC       AWPVGLACFG-LFMAVISIFRIVSLSSVVAAIGLPLLMLLS-------------------
PLSY_SYNS9       AWPVGLACLG-LFMAVISLSRIVSLSSVVAAIGLPVLMLTS-------------------
PLSY_PROMM       SWPVGLACFG-IFLTVLSFSRIVSLSSIIAALSLPLLMILRF------------------
PLSY_DESRM       SPMPLLLAFL-VWLTTVVVSRYVSLGSILGAVSLPIWMALLN------------------
PLSY_DESAP       PPVALATAAA-VWIAVLALTRYVSLASIIAASSVPLAFALGG------------------
PLSY2_MOOTA      APLALFWAFL-IWLAVVIFSRYISLGSIVAAAVAPFLVIYFH------------------
PLSY_CARHZ       SIKVTVVVFF-IWLTVMLISRYVSLGSIVCGLSIPLIMLLFG------------------
PLSY_BACSU       APLLFITMVA-VFFIFLYLTKFVSLSSMLTGIYTVIYS----------------------
PLSY_BACVZ       APLLFVTMVA-VFFVFLFLTKFVSLSSMLTGIYTIIYC----------------------
PLSY_BACLD       QPLLFLTMVA-VFFLFLYITKYVSLSSILTGLYTTVYS----------------------
PLSY_GEOKA       SPLFFLSLIA-VFLVVLAVSRYVSLSSMAAALYAVVYTV---------------------
PLSY_GEOSW       SPFLFVSLLT-VFFIVLYISKYVSLSSMLAGVYAVIYTI---------------------
PLSY3_BACAN      SPVVFAILAV-VFFTLLFTTRYVSLSSMVTAVVAVIAS----------------------
PLSY2_BACHK      SPVVFAILAV-VFFTLLFTTRYVSLSSMVTAVVAVIAS----------------------
PLSY_BACC2       SPVVFAILAV-VFFTLLFTTRYVSLSSMVTAVVAVIAS----------------------
PLSY2_BACCR      SPVVFAILAV-VFFTLLFTTRYVSLSSMVTAVVAVIAS----------------------
PLSY2_BACCZ      SPVVFAILAV-VFFTLLFTTRYVSLSSMVTAVVAVIAS----------------------
PLSY2_BACC1      SPVVFAILAV-VFFSLLFTTRYVSLSSMVTAVVAVIAS----------------------
PLSY_BACCN       APIIFAILAV-VFFTLLFTTRYVSLSSMVTAIAAVIAS----------------------
PLSY2_OCEIH      YPLLFVIMVT-TFLLTLYISKYVSLSSIITGLVSLLIT----------------------
PLSY_LISMC       APLLFVAALV-VFLVTLKLSKYVSLSSMIGALAALIIS----------------------
PLSY_LISMF       APLLFVAALV-VFLVTLKLSKYVSLSSMIGALAALIIS----------------------
PLSY_LISMH       APLLFVAALV-VFLVTLKLSKYVSLSSMIGALAALIIS----------------------
PLSY_LISMO       APLLFVAALV-VFLVTLKLSKYVSLSSMIGALAALIIS----------------------
PLSY_LISIN       APLLFVAALV-VFLLTLKISKYVSLSSMIGALAALIIS----------------------
PLSY_LISW6       APLLFVAALI-IFLLTLKISKYVSLSSMIAALAALLIS----------------------
PLSY2_BACAN      SPLGVLVGFV-VFVLTLLFTKYVSLSSMLAGIALFIYS----------------------
PLSY_EXIS2       SPILFLVLLI-SFLTTLRLSRMVSLSSIVSASIGIVAAITIG------------------
PLSY_STRR6       APIFCLYLAI-IFFGALYLGSMISLSSVTASIAAVIGVLLFP-LFGF-------------
PLSY_STRZJ       APIFCLYLAI-IFFGALYLGSMISLSSVTASIAAVIGVLLFP-LFGF-------------
PLSY_STRZP       APIFCLYLAI-IFFGALYLGSMISLSSVTASIAAVIGVLLFP-LFGF-------------
PLSY_STRP2       APIFCLYLAI-IFFGALYLGSMISLSSVTASIAAVIGVLLFP-LFGF-------------
PLSY_STRPJ       APIFCLYLAI-IFFGALYLGSMISLSSVTASIAAVIGVLLFP-LFGF-------------
PLSY_STRP4       APIFCLYLAI-IFFGALYLGSMISLSSVTASIAAVIGVLLFP-LFGF-------------
PLSY_STRPN       APIFCLYLAI-IFFGALYLGSMISLSSVTASIAAVIGVLLFP-LFGF-------------
PLSY_STRP7       APIFCLYLAI-IFFGALYLGSMISLSSVTASIAAVIGVLLFP-LFGF-------------
PLSY_STRPI       APIFCLYLAI-IFFGALYLGSMISLSSVTASIAAVIGVLLFP-LFGF-------------
PLSY_STRPS       APIFCLYLAI-IFFGALYLGSMISLSSVTASIAAVIGVLLFP-LFGF-------------
PLSY_STRZT       APVFCLYLAV-VFFGTLYLGSMISLSSVTASIAAVIGVLLFP-LFGF-------------
PLSY_STRGC       SPLFFSYLII-IFIVTLYLGSMISLASIVVAGFAIISVLIFP-LLGI-------------
PLSY_STRSV       SPAFFVYLIV-IFASILYLGSMISLASVLSAVIAILSALLFP-LVGF-------------
PLSY_LACLM       SPFFLLYLLV-IFILVLWLFSMISLSSVVAAIFALLGILIFP-SFGF-------------
PLSY_LACLS       SPFFLLYLLV-IFILVLWLFSMISLSSVVAAIFALLGILIFP-SFGF-------------
PLSY_LACLA       SPLFLIYLLV-VFIIVLWLFSMISLSSVIGAVFALLGILIFP-SIGF-------------
PLSY_STRA3       APSFFLYLLV-IFLLTLYLFSMISLSSITVAVVGILSVLIFP-LVGF-------------
PLSY_STRA5       APSFFLYLLV-IFLLTLYLFSMISLSSITVAVVGILSVLIFP-LVGF-------------
PLSY_STRA1       APSFFLYLLV-IFLLTLYLFSMISLSSITVAVVGILSVLIFP-LVGF-------------
PLSY_STRT1       VPLYFVFLLL-VFALTLYLTSMISFSSITAAVVGLITLATFP-AIHF-------------
PLSY_STRT2       VPLYFVFLLL-VFALTLYLTSMISFSSITAAVVGLITLATFP-AIHF-------------
PLSY_STRTD       VPLYFVFLLL-VFALTLYLTSMISFSSITAAVVGLITLATFP-AIHF-------------
PLSY_STREM       APLYLLFLAA-VFVLTLYLFSMISLASLTASVVAVISVLTFP-AAHF-------------
PLSY_STRS7       APLYLLFLAA-VFVLTLYLFSMISLASLTASVVAVISVLTFP-AAHF-------------
PLSY_STRE4       APLYLLFLAA-VFVLTLYLFSMISLASLTASVVAVISVLTFP-AAHF-------------
PLSY_STRPM       APLYLFFLAS-IFVLVLYLFSMISLASVVSAIVGVLSVLTFP-AIHF-------------
PLSY_STRPZ       APLYLFFLAS-IFVLVLYLFSMISLASVVSAIVGVLSVLTFP-AIHF-------------
PLSY_STRP6       APLYLFFLAS-IFVLVLYLFSMISLASVVSAIVGVLSVLTFP-AIHF-------------
PLSY_STRP8       APLYLFFLAS-IFVLVLYLFSMISLASVVSAIVGVLSVLTFP-AIHF-------------
PLSY_STRPB       APLYLFFLAS-IFVLVLYLFSMISLASVVSAIVGVLSVLTFP-AIHF-------------
PLSY_STRPC       APLYLFFLAS-IFVLVLYLFSMISLASVVSAIVGVLSVLTFP-AIHF-------------
PLSY_STRPD       APLYLFFLAS-IFVLVLYLFSMISLASVVSAIVGVLSVLTFP-AIHF-------------
PLSY_STRPF       APLYLFFLAS-IFVLVLYLFSMISLASVVSAIVGVLSVLTFP-AIHF-------------
PLSY_STRPG       APLYLFFLAS-IFVLVLYLFSMISLASVVSAIVGVLSVLTFP-AIHF-------------
PLSY_STRP1       APLYLFFLAS-IFVLVLYLFSMISLASVVSAIVGVLSVLTFP-AIHF-------------
PLSY_STRP3       APLYLFFLAS-IFVLVLYLFSMISLASVVSAIVGVLSVLTFP-AIHF-------------
PLSY_STRMU       APFYLIFLLF-IFFFTLYLTSMISLSSVIAASIAIITVLIFP-ALHF-------------
PLSY_LACBA       NPIMFVIAAG-FWVSLIYWTSIVSLASMIAFTLITLISLVF-------------------
PLSY_LACPL       NWEFFLIASA-IMLLLVYTTSMVSVASMTAFPIVTLIAIFYY------------------
PLSY_LACP3       NPPFFVIAFA-IWFSLILLTSMVSVASTLGMVLITAWSLVY-------------------
PLSY_LACCB       NPPFFVIAFA-IWFSLILLTSMVSVASTLGMVLITAWSLVY-------------------
PLSY_LACSS       NPLFFVIAST-IFISVILITSMVSMASIIGPLLIAILSFYT-------------------
PLSY_LACRD       NPLLFVVACL-IFIFVLCLTSMVSAASMVGISAIFIIALFI-------------------
PLSY_LACRJ       NPLLFVVACL-IFIFVLCLTSMVSAASMVGISAIFIIALFI-------------------
PLSY_LACS1       NPLFFTIAWA-IFIITLYISSMVSVASMLGFTLVSIISLFF-------------------
PLSY_ENTFA       SPTFFIYSAL-IFVICLYLTSMVSLTSMISAVLITLSTIILPFTVPA-------------
PLSY2_LACAC      NVHFFLICAV-IFIPILFITSMVSLTSLISVVLIFIASFFFH------------------
PLSY2_LACJO      NLKFFGLCAL-VFLPMLFITSYVSLSSLVSIVIIFICSFWFH------------------
PLSY_STAA1       NPILLLILAI-IFFIVLKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAA2       NPILLLILAI-IFFIVLKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAA9       NPILLLILAI-IFFIVLKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAAW       NPILLLILAI-IFFIVLKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAAM       NPILLLILAI-IFFIVLKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAAN       NPILLLILAI-IFFIVLKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAAR       NPILLLILAI-IFFIVLKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAAS       NPILLLILAI-IFFIVLKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAAB       NPILLLILAI-IFFIILKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAA3       NPILLLILAI-IFFIVLKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAA8       NPILLLILAI-IFFIVLKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAAT       NPILLLILAI-IFFIVLKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAAC       NPILLLILAI-IFFIVLKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAAE       NPILLLILAI-IFFIVLKIFKYVSLASIVAAICCVIGSLIIQ------------------
PLSY_STAEQ       NPILLLILAI-IFFSVLKIFKYVSLSSIIAAISCVIGSIIIH------------------
PLSY_STAES       NPILLLILAI-IFFSVLKIFKYVSLSSIIAAISCVIGSIIIH------------------
PLSY_STAHJ       NPILLLILAI-IFFGVLYIFKYVSLSSIIAAICCVIGSLIIQ------------------
PLSY_STAS1       NPVLLLILAA-IFFGILYLTKYVSLSSIIASICCVIGALLIR------------------
PLSY_STACT       APILLLILAA-IFFLTLYLTKYVSLSSIVAAICCVIGSLIIH------------------
PLSY_MACCJ       NPVVFLIIAV-IFFTLLFTTRMVSLTSILTSIGNFITTLFFD------------------
PLSY_PELLD       APVSMLIVIG-IFLLTVWLSRYVSVASILAAIAFPLIIAIRKYVFELGGGLDY-------
PLSY_CHLPM       APVSMLMVIG-IFLLTVWFSRYVSVASIFAAVAFPLIIAIRKYVFELGGGLDY-------
PLSY_CHLL2       APVSMLMVIG-IFLLTIYLSRYVSVASMLAAVAFPLIIAIRKYIFELGSGLDY-------
PLSY_PELPB       APVSMLMVVG-IFLLTVYISRHVSVASMLAAIAFPLIIAIRKYIFELGSGLDY-------
PLSY_CHLCH       APVSMLMVIG-VFLLTVYISRHVSVASILAAIAFPLIIAIRKYLFELGAGLDY-------
PLSY_CHLPD       APVSMLIVIG-IFLLTVYVSRYVSVASILAAIAFPLIIAIRKYIFELGGGLDY-------
PLSY_CHLP8       APISMLMVIG-VFILAITLTRYVSVGSILAAIAFPLIIAIRKYLFDLGTGLDY-------
PLSY_CHLTE       APVSMLMVIG-IFLLAVTISRYVSVGSILAAIAFPLIIAIRKYVFDLGSGLDY-------
PLSY_CHLPB       APVTTLIVLG-VFLLVVFLSRYVSVASILAAIAFPVIIAVRKYLFDLGEGLDY-------
PLSY_PROA2       APVSTLIVLA-VFLLTIFVSRYVSVASIIAAIAFPLVILVRKYLFDLGEGLDY-------
PLSY_SALRD       TPLTMAITLA-VFVAVLLSSRYVSLSSITAAVAFPTIVALRRFGFG--------------
PLSY_THEP3       SPLLGLIALA-IGVTVIVLTKYVSLGSITGSVTFVLLNAIF-------------------
PLSY_THEPX       SPLLGLIALA-IGVTVIVLTKYVSLGSITGSVTFVLLNAIF-------------------
PLSY_CALS4       NPLLGLIALA-IGVAVIAITRYVSLGSMTGAITFALLNIFF-------------------
PLSY_ALKMQ       SPLAAIASIS-LGVVILYRYKYVSLSSITAMTILPFF--LF-------------------
PLSY_CLOD6       NPVITLMCLA-VFILVVAITKYVSLGSVVGIGCSPIF-MIM-------------------
PLSY_FINM2       QPLQVLILLI-LFLIVVLMTKYVSLGSVLGCISAVIYGLIY-------------------
PLSY_SYNWW       MPDVTGILLL-IFLAIVYFTRYVSLGSITVACLLPLVSLA--------------------
PLSY2_DESHY      MPKITVMAIV-LFVLVVFLTRYVSVGSVLAALTVGILVFLFN------------------
PLSY_SYMTH       YPLAVLVGIA-AGALAVVPTRWVSLGSLTASLAVVLQLFLLD------------------
PLSY_BACHD       VPLAAVLAGV-IAIGSIVWTRYVSLGSLLFVTLTALLVAVLS------------------
PLSY_BACSK       LFLPALCAGI-VAILSIVFTKYVSLGSLLFAVLTPIAALIML------------------
PLSY3_DEHM1      CPVAAIFGGE-VLIIGAGLSGFASLGSITGVVGAYALLIPLT------------------
PLSY3_DEHMC      CPVAAIFGGE-VLIIGAGLSGFASLGSITGVVGAYALLVPLT------------------
PLSY_AQUAE       SPSVALFSFLVWLGIFLWKR-YVSLASITATISAFLFLFVAGYP----------------
PLSY_HYDS0       SPLLALKMFLVWAFVFYLFR-YVSLASITSVLVGYFLFLEGDFS----------------
PLSY1_BACAN      DYLIALTLVAVFIIFYLIFK-GFTKPGLITIACLPLCMILYS------------------
PLSY1_BACCZ      DYLIALTLVAVFIIFYLIFK-GFTKPGLITIACLPLCMILYS------------------
PLSY1_BACHK      DYLIALTLVTVFIIFYLIFK-GFTKPGLITIACLPLCMILYS------------------
PLSY1_BACC1      DYLIALTLVAVFIIFYLIFK-GFTKPGLITIACLPVCMILYS------------------
PLSY1_BACCR      DYLIALTLLGIFIVFYLIFK-GFTKPGLITIACLPICMILYS------------------
PLSY1_LACAC      DWRAGLATLLIALILTAIMQ-NLTIPPLVFMLLFSVYEFWQ-------------------
PLSY1_LACJO      DWRAGLIALLIGLFLVIIMK-NLTIPPLVYMLGFSIFTWINF------------------
PLSY_MYCCT       NILYLIIFLIVWFISVAISR-KVSVASIFSAFFVLIIMWIPYLNGVSYFIWQWN------
PLSY_MYCMS       NVLYLIIFLIIWFISVAISR-KVSVASMFSALIILLIMWIPYLSGVSYFIWEWN------
PLSY_MESFL       NYLYFLIFFIVWWIFAFKYR-KVSLSSIIGTATILLLMWLPWTYGVMGYSL-FN------
PLSY_MYCAP       NIILFLIAFLIFLLVVGISK-IVSLGSITVAFSLLLFVWMPWMIQGPTGY----------
PLSY_MYCS5       NVLLWPIAGVFFFLLLFKTK-YVSLSSLLTTLIMIGFISIPWMSQGVLSY----------
PLSY_MYCMO       NIILAIIGGIIFFAMIFRWK-IVSLGSFITPFILVIFMIIPWMNSSIIAY----------
PLSY_MYCPU       NIIIAVIGAIVYLLIIIYWKRIVSFTTLITIPSLLPLMFIPWMSQLPLGF----------
PLSY_UREP2       DPIVALIGIITLLVILLITK-YMSLSAMITATFTCFLVLVPGINYIPYYN----------
PLSY_UREPA       DPIVALIGIITLLVILLITK-YMSLSAMITATFTCFLVLVPGINYIPYYN----------
PLSY_UREU1       DPIVAVIGIITLLIILLITK-YMSLSAMITATITCFLVLIPGINYIPYYN----------
PLSY_MYCGE       SLWWFLICLLIWIMITLITK-YVSLASLITFFVLAVIILIPWLDYLYFFN----------
PLSY_MYCPN       SLWWFVICLVLWLLVTLITK-YVSLASLVTFFILAIIILVPWLDYLYFFK----------
PLSY_MYCGA       SPWWFLIIALTWWTITLISK-YVSLASIVCFIIFLFLPYIPWLDYLWWFS----------
PLSY_PSELT       CPICGFTFLATWISITLLTK-YVSLASIVGMYAASFVAFFFNK-----------------
PLSY_THEM4       YPWSGLVFFGVWLFIVAVTK-YVSLASMIGLIFASIFVFFAGK-----------------
PLSY_KOSOT       KASLVPVFFAVWLPIVLITQ-YVSLGSILSLAVITILYFLTDSW----------------
PLSY2_THEMA      SWPTGLVFTLTWLVIVMLTK-YASLGSLVALYVSALLGYLLKGY----------------
PLSY_THEP1       SWPTGIVFTLTWLVIVMLTK-YASLGSLVALYISALLGYLFKGY----------------
PLSY_ANAMF       NIKIFFLFII-TWAVVFMIFRYSSLSSIISIISSCIYCAVTEN-F---------------
PLSY_ANAMM       NIKIFFLFII-TWAVVFMIFRYSSLSSIISIISSCIYCAVTEN-F---------------
PLSY_ANAPZ       NPLMLCVFFI-SWLFTFNNTRYASLSSIVSIIATMIVCYLTES-G---------------
PLSY_EHRCJ       EYKFVIYFTI-FWIIVFVIFRYSSLSSIISTISIMLLVYTHYS-A---------------
PLSY_EHRCR       EYKFVICFLF-IWITLFAIFKYSSLSSIVSTIFVALLVYMYYT-M---------------
PLSY_EHRRG       DYKVALCFLT-FWIICFLLCKYASLSSIVSTLIALLFICTYYT-I---------------
PLSY_EHRRW       DYRVAVCFLT-FWIICFLLCKYASLSSIVSTLIALLFICTCYT-I---------------
PLSY_BARHE       YWPAAIVFIT-AWIVLFLITRYSSLSALIAVIITPIFVHFSYPYL---------------
PLSY_BARQU       YWPAAIVFII-VWIMFFILTRYSSLSALIAVIITPIFVYFSYPHL---------------
PLSY_BART1       YWPAAIIFII-VWSAIFLLMHYSSLSALVAVTITPIFV-FYFSDT---------------
PLSY_BARBK       FWPAVIVFTI-IWIISFLFKRLSSLSALVAVTAVPIFVYLFSPCF---------------
PLSY_PELUB       NIFLGLVFII-SWAVTFLISKYSSLSSLVGSLMVPMYLIVFEN-----------------
PLSY_WOLPM       NIDITLVFVI-IWIIVFLAFRYSSLASLSATSTAVAWSFFFQR-----------------
PLSY_WOLPP       NISIALAFVF-VWLIVFFIFRYSSLASLAATAAAVIASFFFQK-----------------
PLSY_WOLTR       NISLVLAFVF-VWLAVFFAFRYSSLASLTSTIAAVLSSFFFQR-----------------
PLSY_ARCB4       IPYSTLIGAV-VWIVCAKVLKISSLSSLLGLIAAVISAIFIYNGLG--------------
PLSY_SULDN       LPLETIIALV-VWALGAKFIRISSLSSLTALGALIVASFILHPDM---------------
PLSY_WOLSU       LPLEAAIGLV-VWLVVGKTLKISSLSSLLGLGALLISSFLIHPEIPE-------------
PLSY_NITSB       LPVETIIGIV-TWLIVAKTTKISSLSSLSGLVALVVASFIVHPDMPY-------------
PLSY_CAMJ8       LPLEVLTAFI-VWVVIGKIFKISSLASLAALLAFVISSFIFNYDLE--------------
PLSY_CAMJJ       LPLEVLTAFI-VWVVIGKIFKISSLASLAALLAFVISSFIFNYDLE--------------
PLSY_CAMJE       LPLEVLTAFI-VWVVIGKIFKISSLASLAALLAFVVSSFIFNYDLE--------------
PLSY_CAMJR       LPLEVLTAFI-VWVVIGKIFKISSLASLAALLAFVVSSFIFNYDLE--------------
PLSY_CAMJD       LPLEVLTAFI-VWAVTGKIFKISSLASLAALLAFIVSSFIFNYDLE--------------
PLSY_CAMLR       LPFEIICALL-AWFIIGKVFKISSLASLGAMIVLIATSFIFHYDIPV-------------
PLSY_CAMC1       LPVEIIIALV-VWFLVGKFLKISSLASLCALIALIASSFIIHPELDE-------------
PLSY_HELPH       IPIESLIGLT-VWFFVGKVLKISSLASILGVGTATVLIFFVPY-MHIPDSVNI-------
PLSY_HELPJ       IPIESLIGLT-VWFFVGKVLKISSLASILGVGTATVLIFFVPY-MHIPDSVNI-------
PLSY_HELPY       IPIESLIGLT-VWFFVGKVLKISSLASILGVGTATVLIFFVPY-MHIPDSVNI-------
PLSY_HELAH       IPIESLIGLM-VWFFVGKVLKISSLASIVGVGTATILIFFVPY-MHIPDSVNI-------
PLSY_HELHP       IPVEGICGLI-IWGIVGKVFKISSISSLIGVLGTIGLTFVLPYILPLPDCISI-------
PLSY_MYCPE       SPWMFFICFV-LFWSICLISKYVSLASIVTVFLLPIWSLIPHLNYFYMLDVAQANINPIP
PLSY_NEOSM       VLPVFIVAVC-TWGIFFVLFRQPFISSLIACFIGAVYSYALLELY---------------
PLSY1_OCEIH      DWRIALIGIG-VLILFTIATDYLAVGVLSMYISFLITTYYIFGLA---------------
PLSY1_THEMA      TKWEGPMVLGTVFTIFSILHRLRGKNKTTPEEDAFRVMIGFAALLIYTMWKV--------
PLSY2_DEIRA      APWTLLATVT--FALALIPLYRATLQPRLRLNAIPFATVVAVPVG---------------
                                                                             

PLSY_AYWBP       ------NFGTLVPIQNQIQKPELFYFSINFATLIIIAKHYSNILRLIKGTENKFNFKK--
PLSY_ONYPE       ------------------------------------------------------------
PLSY_PHYAS       -------FINHHPGITNISQNQILYFFIGLSTCFIILKHHSNIIRLWQGKEYKFSFIKKR
PLSY_ACHLA       ------IWIPVPNLTISYESQIINLVAISLIVLLIIYMHKKNFIRLMNGTENKIGQKKIQ
PLSY_CLOAB       ----------------ALRLPIEITVCAIIACGLLILRHKDNLIRLVNNEEK--------
PLSY_GEOMG       ----------VVAFLSGRPPLVGVTVVI---ALLVIWKHRENIQRLRAGTENRFKA----
PLSY_GEOSL       ----------FVAAVERRPLLVGMTLVI---AVIVIVKHRENIRRLREGTENRFKA----
PLSY_GEODF       ----------LVALIEKKGLLITMSVII---AALVVFKHRENIRRLRSGTENVFKR----
PLSY_GEOLS       ----------IIFFRPHSPQLLIATVLI---AAVVIIKHHSNISRLIAGTESKFKA----
PLSY_PELCD       ----------LVYFTEGNPALVATTMFI---SLIVICRHHQNIQRLLNGSENRFKA----
PLSY_KORVE       ----------VVYFLYRNQYPAATYAIMGASSLLIIWRHRSNIQRLIAGTENRFPASKPT
PLSY_FUSNN       ----------FTFFTHKDSYLFALSVII---AVFVIYRHKTNISRLLSGTENKFKF----
PLSY_UNCTG       ----------TSYFLGYSTEVVIFTFAI---TLLIIYRHRTNIKRLIERSENKLRIFKKK
PLSY_DESAD       -----------FTLVTGSVGMVPLACGM---TVLLFWTHRENIRRLAKGQENSWKKKK--
PLSY_DESMR       -----------LCAWLGPVFLVPAAAII---GGLVIHKHRDNIARLRSGQEKSWRKDRAK
PLSY_DESAG       -----------MLLITGNFTYIPLALVV---MTLVFWSHRENIGRLARGEEKPWQKKKHK
PLSY_DESVH       -----------MLLLGGHWKLVPLALVV---MVLVYWSHRENIGRLSRGEEKPWQKKHHD
PLSY_DESDA       -----------ALAVSGQWGWLPLSLAV---WAVVVWKHRENIVRLRSGTEKSWLKSKNK
PLSY_LAWIP       -----------ILFITGKFAYIPLSLII---MALIFWSHKQNIQRLIKGEEKVWKHSESI
PLSY_LEPBJ       ----------LLLHEEVSYWILGTMVFI---SIGIILTHRENIFRILNRSELFAVKNEDE
PLSY_LEPBL       ----------LLLHEEVSYWILGTMVFI---SIGIILTHRENIFRILNRSELFAVKNEDE
PLSY_LEPIC       ----------LLLHEEVSYWVLGTMVFI---SFGIILTHRENIIRILNRSELFAVKGE--
PLSY_LEPIN       ----------LLLHEEVSYWVLGTMVFI---SFGIILTHRENIIRILNRSELFAVKGE--
PLSY_DESPS       ----------WLYLLGASQLKIITAGFV---ALLIWIKHRKNIKRLMTGTEKSWKKK---
PLSY_ECOLI       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SHIB3       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SHISS       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SHIBS       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SHIDS       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECO24       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECO27       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECO45       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECO55       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECO57       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECO5E       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECO7I       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECO81       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECO8A       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECOBW       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECODH       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECOHS       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECOK1       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECOL5       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECOL6       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECOLC       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECOLU       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECOSE       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECOSM       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ECOUT       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SHIF8       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SHIFL       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ESCF3       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALSV       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALTI       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALTY       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALA4       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALCH       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALDC       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALEP       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALG2       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALHS       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALNS       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALPA       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALPB       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALPK       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_CITK8       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_SALAR       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_ENT38       ----------------------QFTFPVSMLSCLILLRHHDNIQRLWRRQETKIW-----
PLSY_CROS8       ----------------------QFTFPVAMLSCLILLRHHDNIQRLWRGQESKIW-----
PLSY_KLEP3       ----------------------QYTFPVSMLSCLILLRHHDNIQRLWRRQESKIW-----
PLSY_KLEP7       ----------------------QYTFPVSMLSCLILLRHHDNIQRLWRRQESKIW-----
PLSY_PECAS       ----------------------QFTFPVAMLSCLILMRHHDNIQRLWRGQESKIW-----
PLSY_PECCP       ----------------------QFTFPVAMLSCLILMRHHDNIQRLWRGQESKIW-----
PLSY_YERP3       ----------------------QFTFPVAMLSCLILMRHHDNIQRLWRGKEGKIW-----
PLSY_YERPA       ----------------------QFTFPVAMLSCLILMRHHDNIQRLWRGKEGKIW-----
PLSY_YERPB       ----------------------QFTFPVAMLSCLILMRHHDNIQRLWRGKEGKIW-----
PLSY_YERPE       ----------------------QFTFPVAMLSCLILMRHHDNIQRLWRGKEGKIW-----
PLSY_YERPN       ----------------------QFTFPVAMLSCLILMRHHDNIQRLWRGKEGKIW-----
PLSY_YERPP       ----------------------QFTFPVAMLSCLILMRHHDNIQRLWRGKEGKIW-----
PLSY_YERPS       ----------------------QFTFPVAMLSCLILMRHHDNIQRLWRGKEGKIW-----
PLSY_YERPY       ----------------------QFTFPVAMLSCLILMRHHDNIQRLWRGKEGKIW-----
PLSY_YERE8       ----------------------QFTFPVAMLSCLILMRHHDNIQRLWRGKESKIW-----
PLSY_SERP5       ----------------------QFTFPVAMLSCLILMRHHDNIQRLWRGQEGKIW-----
PLSY_ERWT9       ----------------------QFTFPVAMLSCLILLRHHDNIQRLWRGQETRVW-----
PLSY_EDWI9       ----------------------QFTFPVAMLSCLILVRHHDNIQRLWRGKEGKIW-----
PLSY_PHOLL       ----------------------EFTFPVAMLCCLVLLRHHDNIQRLWRGQENRLW-----
PLSY_PROMH       ----------------------EFTYPVALLSCLVLYRHHDNIQRLWRGQESRIW-----
PLSY_SODGM       ----------------------QFTFPVAMLSCLVLLRHHDNIQRLWHGQESRIW-----
PLSY_HAEI8       ----------------------EFTFPVALVCCLLIYRHHDNIQRLWRGQEDKVW-----
PLSY_HAEIG       ----------------------EFTFPVALVCCLLIYRHHDNIQRLWRGQEDKVW-----
PLSY_HAEIN       ----------------------EFTFPVALVCCLLIYRHHDNIQRLWRGQEDKVW-----
PLSY_HAEIE       ----------------------EFTFPVALVCCLLIYRHHDNIQRLWRGQEDKVW-----
PLSY_PASMU       ----------------------EFTFPVALVCCLLIYRHHDNIQRLWRGQEDKVW-----
PLSY_ACTSZ       ----------------------EFTFPVALVCCLLVYRHHDNIQRLWRGQEDRIW-----
PLSY_MANSM       ----------------------EFTFPVALVCCLLVYRHHENIQRLWRGQEDKVW-----
PLSY_HAES1       ----------------------EFTFPVALVCCLLVYRHHENIQRLWRGQEDKIW-----
PLSY_ACTP2       ----------------------EFTFPVALVCCLLVYRHHDNIQRLWRGQEQPMW-----
PLSY_ACTP7       ----------------------EFTFPVALVCCLLVYRHHDNIQRLWRGQEQPMW-----
PLSY_ACTPJ       ----------------------EFTFPVALVCCLLVYRHHDNIQRLWRGQEQPMW-----
PLSY_HAEDU       ----------------------EFTFPVALICCLLIYRHHDNIQRLWRGQEERLW-----
PLSY_HAEPS       ----------------------ELTFPVALVCCLLVYRHHDNIQRLWRGQEDRGW-----
PLSY_AERS4       ----------------------EYTLPVSLLSCLILIRHHENIARLLKGEEPRVW-----
PLSY_TOLAT       ----------------------EYTLPVAMLCCLIILRHHENISRLLQGHEPQVW-----
PLSY_ALIF1       ----------------------QYTLPVAMLSCLIVLKHHENIKRFFEGKETKIW-----
PLSY_ALIFM       ----------------------QYTLPVAMLSCLIVLKHHENIKRFFEGKETKIW-----
PLSY_ALISL       ----------------------QYTLPVAMLSCLIVLKHHENIRRFFAGKEKKIW-----
PLSY_PHOPR       ----------------------EYTMAVSMLSCLIVLRHHDNLRRLFEGKETKIW-----
PLSY_VIBC3       ----------------------QYTLPVAMLCCLIVLRHHQNVKRLFAGTEPKVG-----
PLSY_VIBCH       ----------------------QYTLPVAMLCCLIVLRHHQNVKRLFAGTEPKVG-----
PLSY_VIBCM       ----------------------QYTLPVAMLCCLIVLRHHQNVKRLFAGTEPKVG-----
PLSY_VIBCB       ----------------------QYTLPVAMLCCLIVFKHHQNIRRLLSGEEPKIG-----
PLSY_VIBPA       ----------------------QYTLPVAMLCCLIVFKHHQNIRRLLSGEEPKIG-----
PLSY_VIBTL       ----------------------QYTLPVAMLCCLIVLRHHQNIRRLLDGSEPKLG-----
PLSY_VIBVU       ----------------------QYTLPVGMLCCLIVLRHHQNIRRLFTGEEPKIG-----
PLSY_VIBVY       ----------------------QYTLPVGMLCCLIVLRHHQNIRRLFTGEEPKIG-----
PLSY_IDILO       ----------------------QYTVPVIMISLLILWRHQANILRLSSGEEKAFK-----
PLSY_PSEA6       ----------------------AYTAPVTMLCILIIVRHRQNIIRLMSGQESKIW-----
PLSY_COLP3       ----------------------LYVYPTLMLSALILFRHRDNIKRLLKGTESKIT-----
PLSY_PSEHT       ----------------------LYTLPVTFITVLIIFRHRSNIARLFSGNEPKVG-----
PLSY_SHEB2       ----------------------RFTIPVAMLSTLIIIRHKDNIQRLLKGEESKVS-----
PLSY_SHEB5       ----------------------RFTIPVAMLSTLIIIRHKDNIQRLLKGEESKVS-----
PLSY_SHEB8       ----------------------RFTIPVAMLSTLIIIRHKDNIQRLLKGEESKVS-----
PLSY_SHEB9       ----------------------RFTIPVAMLSTLIIIRHKDNIQRLLKGEESKVS-----
PLSY_SHESA       ----------------------RFTIPVAMLSTLIIIRHKENIQRLLKGEESKVS-----
PLSY_SHESR       ----------------------RFTIPVAMLSTLIIIRHKENIQRLLKGEESKVS-----
PLSY_SHESM       ----------------------RFTIPVAMLSTLIIIRHKENIQRLLKGEESKVS-----
PLSY_SHEON       ----------------------RFTIPVAMLSTLIIIRHKDNIKRLLKGEESKVS-----
PLSY_SHEPC       ----------------------RFTIPVAMLSTLIIIRHKDNIQRLLKGEESKVS-----
PLSY_SHESW       ----------------------RFTIPVAMLSTLIIIRHKDNIQRLLKGEESKVS-----
PLSY_SHEHH       ----------------------RFTIPVAMLSTLIVIRHKDNIKRLLKGEESKVS-----
PLSY_SHESH       ----------------------RFTIPVAMLSTLIVIRHRDNIHRLLKGEESKVS-----
PLSY_SHEWM       ----------------------RFVLPVAMLSALIIIRHKENIQRLLKGEESKFS-----
PLSY_SHELP       ----------------------RFTVPVAMLSLLIIIRHKENIHRLLKGEESKVS-----
PLSY_SHEDO       ----------------------RFTIPVAMLSVLIVIRHKDNIHRLWTGEETKLS-----
PLSY_BLOFL       ----------------------HHFEYIILLSLIILSQHKNNIKRLWNHQEKHIW-----
PLSY_BLOPB       ----------------------QYLLPTIIISSLVVIKHAANIKRLWHHKENRIW-----
PLSY_COXB1       ----------------------DYLFPVLIIAILIIWKHWENFQRLRKGTEDKVKL----
PLSY_COXBU       ----------------------DYLFPVLIIAILIIWKHWENFQRLRKGTEDKVKL----
PLSY_COXBN       ----------------------DYLFPVLIIAILIIWKHWENFQRLRKGTEDKVKL----
PLSY_COXBR       ----------------------DYLFPVLIIAILIIWKHWENFQRLRKGTEDKVKL----
PLSY_COXB2       ----------------------DYLFPVLIIAILLIWKHWENFQRLRKGTEDKVKL----
PLSY_FRAT1       ----------------------QVAAPFLIIAIIILVKHKGNIQRLISRQESKIG-----
PLSY_FRATT       ----------------------QVAAPFLIIAIIILVKHKGNIQRLISRQESKIG-----
PLSY_FRATF       ----------------------QVAAPFLIIAIIILVKHKGNIQRLISGQESKIG-----
PLSY_FRATH       ----------------------QVAAPFLIIAIIILVKHKGNIQRLISGQESKIG-----
PLSY_FRATN       ----------------------QVAAPFLIIAIIILVKHKGNIQRLISGQESKIG-----
PLSY_FRATO       ----------------------QVAAPFLIIAIIILVKHKGNIQRLISGQESKIG-----
PLSY_FRATM       ----------------------QVAAPFLIIAIIILVKHKGNIQRLISGQESKIG-----
PLSY_FRAP2       ----------------------QVATPFLIIAIIILVKHKGNIQRLISGQESKIG-----
PLSY_LEGPC       ----------------------NIFPPLFMITILVLYKHRDNFNRLIDGKEPKIKFKHSV
PLSY_LEGPH       ----------------------NIFPPLFMITILVLYKHRDNFNRLIDGKEPKIKFKHSV
PLSY_LEGPA       ----------------------NIFPPLFMITILVLYKHRDNFNRLIDGKEPKIKFKHSV
PLSY_LEGPL       ----------------------NIFPPLFMITILVLYKHRDNFNRLIDGKEPKIKFKHSV
PLSY_RUTMC       ----------------------ASTYVIILICLWIFYTHQSNIKRLLNSQENKIN-----
PLSY_AROAE       ----------------------PTVAVLALIAGILVWRHAPNIRKLMNGSESKIG-----
PLSY_LARHH       ----------------------VYAGLTIVIALLLVRRHKQNILNLVSGTESRIG-----
PLSY_DECAR       ----------------------GQTVVVGILGMALIGKHWQNIQRLMAGQESKIG-----
PLSY_NITEC       ----------------------MLTITVLIISILLILKHQSNIANLIAGKETRIG-----
PLSY_NITEU       ----------------------ILIMAVSIISVLLILKHRLNIANLMAGKEARIG-----
PLSY_NITMU       ----------------------ARTLVVFIMSLLLIWRHKSNIAGLIAGSESRIG-----
PLSY_METFK       ----------------------GYIIVVFVLSLLLIWRHRSNIRKLLDGSEAGFG-----
PLSY_BORBR       ------------------HARLEVGLAIAVISALLFYRHRANIARLLKGTESRIG-----
PLSY_BORPE       ------------------HARLEVGLAIAVISALLFYRHRANIARLLKGTESRIG-----
PLSY_BORPA       ------------------HARLEVGLAIAVISALLFYRHRANIARLLKGTESRIG-----
PLSY_BORPD       ------------------YAQGPVGVALAIITLLLFYRHRANIARLLAGTESRIG-----
PLSY_BORA1       ------------------PLNAPTAAALVGVSALLFYRHSANIDRLIKGKESRIG-----
PLSY_BURA4       --------------------HNPVAWAVLAMSVLLVWRHRGNISKLLAGQESRIG-----
PLSY_BURCM       --------------------HNPVAWAVLAMSVLLVWRHRGNISKLLAGQESRIG-----
PLSY_BURL3       --------------------HNPVAWAVLAMSVLLVWRHRGNISKLLAGQESRIG-----
PLSY_BURVG       --------------------NNPIAWAVLAMSVLLVWRHRGNIAKLLAGQESRIG-----
PLSY_BURCA       --------------------HNPIAWAVLAMSVLLVWRHRGNISKLLAGQESRIG-----
PLSY_BURCH       --------------------HNPIAWAVLAMSVLLVWRHRGNISKLLAGQESRIG-----
PLSY_BURCJ       --------------------HNPVAWAVLAMSVLLVWRHRGNISKLLAGQESRIG-----
PLSY_BURCC       --------------------HNPVAWAVLAMSVLLVWRHRGNISKLLAGQESRIG-----
PLSY_BURM1       --------------------HNPIAWAVLAMSVLLVWRHRGNIAKLLAGEESRIG-----
PLSY_BURP1       --------------------DNPVAWAVLAMSVLLIWRHRSNISKLLAGEESRIG-----
PLSY_BURPS       --------------------DNPVAWAVLAMSVLLIWRHRSNISKLLAGEESRIG-----
PLSY_BURMA       --------------------DNPVAWAVLAMSVLLIWRHRSNISKLLAGEESRIG-----
PLSY_BURTA       --------------------NNPVAWAVIAMSALLIWRHRSNISKLLAGEESRIG-----
PLSY_PARPJ       ----------------------VIALAIVVMSSLLVWRHRGNIAKLMRGQESRIG-----
PLSY_PARXL       ----------------------IIALAIVVMSSLLVWRHRGNIAKLMRGQESRIG-----
PLSY_PARP8       ----------------------VIALSIVAMSALLIWRHRANIAKLVAGQESRIG-----
PLSY_CUPTR       ----------------------VMAGAIFVISVLLIARHRQNIAKLLAGKESRIG-----
PLSY_CUPNH       ----------------------VMTGAIFVISVLLIARHRQNIAKLLAGKESRIG-----
PLSY_CUPMC       ----------------------IMAGAILVISVLLIARHRANIAKLLAGKESRIG-----
PLSY_CUPPJ       ----------------------AMAGAVLIIAILLIARHRQNIAKLLTGKESRIG-----
PLSY_RALPJ       ----------------------WIAGAVALMAVLLIARHRANIAKLLAGKESRIG-----
PLSY_RALSO       ----------------------PLAGAIAVMSVLLIARHRANIAKLLAGKESRIG-----
PLSY_HERAR       ----------------------AILLAVVAMSVLLIYRHGKNIGNLLAGKESRIG-----
PLSY_JANMA       ----------------------VILLAVLAMSILLVYRHSKNIGNLLAGKESRLG-----
PLSY_RHOFT       ------------------YLSKGVLAALCAMSLLLIYRHAENISRLIKGTESRLG-----
PLSY_CHRVO       ------------------VY----FGTCIIIAIVVVHRHKSNLIKLMTGQEDKIG-----
PLSY_THIDA       ------------------S-----ATTVLVIALLLVYRHKANLLKLVTGQEARIG-----
PLSY_NEIG1       ------------------SW----IFATLAIAILVLLRHKSNILNLIKGKESKIG-----
PLSY_NEIG2       ------------------SW----IFATLAIAILVLLRHKSNILNLIKGKESKIG-----
PLSY_NEIMA       ------------------SW----IFATLAIAILVLLRHKSNILNLIKGKESKIG-----
PLSY_NEIMF       ------------------SW----IWATLLIALLVLFRHKSNISNLLKGKEGKIG-----
PLSY_NEIM0       ------------------SW----IWATLLIALLVLFRHKSNIVKLLEGRESKIG-----
PLSY_NEIMB       ------------------SW----VWATVAIALLVLFRHKSNIVKLLEGRESKIG-----
PLSY_METCA       ------------------EL----VVATLFMSMLLVYRHKGNIERLLKGEEARLG-----
PLSY_THISH       ------------------WY----VAAGVLLAALIYWRHRANIRRLLRGEEPKIG-----
PLSY_NITOC       ------------------IR----FAV-VLLAIFLLWRHQDNIRRLLSGQEDRAS-----
PLSY_HYDCU       ------------------AW----VSVTAIMTLILFWRHRSNIERLLKGEEDLIK-----
PLSY_HALHL       ------------------VL----TAATAILTAAIVWRHRENIVRLAAGEESRIG-----
PLSY_PSEA8       ------------------------LLPMTVLTGLIVWRHRANLRDLFAGRERHF------
PLSY_PSEAB       ------------------------LLPMTVLTGLIVWRHRANLRDLFAGRERHF------
PLSY_PSEAE       ------------------------LLPMTVLTGLIVWRHRANLRDLFAGRERHF------
PLSY_PSEA7       ------------------------LLPMTVLTALIVWRHRANLRDLFAGRERHF------
PLSY_AZOVD       ------------------------LLPMLLLYGVIVWRHRGNLHALFAGRERHF------
PLSY_PSE14       ------------------------LLPMSVLTLLIVWRHRGNLRDLLAGRERHF------
PLSY_PSEU2       ------------------------LLPMSVLTLLIVWRHRGNLRDLLAGRERHF------
PLSY_PSESM       ------------------------LLPMSVLTLLIVWRHRGNLRDLLAGRERHF------
PLSY_PSEFS       ------------------------LVPMSVLTLLIVWRHRGNLRDLFAGRERHF------
PLSY_PSEPF       ------------------------LLPMSTLTLLIVWRHRGNLRDLFAGRERHF------
PLSY_PSEF5       ------------------------LLPMSVLTLLIVWRHRGNLRDLFAGRERHF------
PLSY_PSEP1       ------------------------LLPISVLTVMIVWRHRNNLRDLFAGRERHF------
PLSY_PSEPK       ------------------------LLPISVLTVMIVWRHRNNLRDLFAGRERHF------
PLSY_PSEPG       ------------------------LLPITVLTAMIVWRHRKNLRDLFAGRERHF------
PLSY_PSEPW       ------------------------LLPISVLTVMIVWRHRNNLRDLFAGRERHF------
PLSY_PSEE4       ------------------------LLPMTVLTLMIVWRHRSNLRDLFAGRERHF------
PLSY_CHRSD       ------------------------TLVVSVFSALVLVRHAWNIRRLGQGGEPGLK-----
PLSY_HAHCH       ------------------------LALFLILSLFILIRHRENIINLAKGKERSL------
PLSY_RHIE6       ---------------------------MAIMTVISYWKHKANISRLMGGTETKIGAKG--
PLSY_RHIEC       ---------------------------MAIMTVISYWKHRANISRLMGGTESKIGAKG--
PLSY1_RHIL3      ---------------------------MAIMTLISYWKHKANISRLMGGTESKIGAKG--
PLSY_AGRFC       ---------------------------VTLLSVISWWKHRENIRRLMAGTESRIGQKG--
PLSY_RHIME       ---------------------------FAVMTAIAWIKHRANIQRLLSGTESRIGEKG--
PLSY_SINMW       ---------------------------FAVMTLIAWVKHRANIQRLMSGTESRIGEKG--
PLSY_SINFN       ---------------------------FALMTVITWIKHRANIQRLLSGTESRIGEKG--
PLSY_AGRVS       ---------------------------TSAMTVITWGKHKANIERLISGTESKIGKKG--
PLSY_BRUA1       ---------------------------FAIMTVIVFIKHRANISRLLNGTESKIGAKG--
PLSY_BRUA2       ---------------------------FAIMTVIVFIKHRANISRLLNGTESKIGAKG--
PLSY_BRUAB       ---------------------------FAIMTVIVFIKHRANISRLLNGTESKIGAKG--
PLSY_BRUC2       ---------------------------FAIMTVIVFIKHRANIRRLLNGTESKIGAKG--
PLSY_BRUSU       ---------------------------FAIMTVIVFIKHRANIRRLLNGTESKIGAKG--
PLSY_BRUMB       ---------------------------FAIMTVIVFIKHRANISRLLNGTESKIGAKG--
PLSY_BRUME       ---------------------------FAIMTVIVFIKHRANISRLLNGTESKIGAKG--
PLSY_BRUO2       ---------------------------FAIMTVIVFIKHRANISRLLNGTESKIGAKG--
PLSY_BRUSI       ---------------------------FAIMTVIVFIKHRANISRLLNGTESKIGAKG--
PLSY_OCHA4       ---------------------------FAIMTVIVIFKHKANITRLLNGTESKIGAKG--
PLSY_RHILO       ---------------------------FVVMSIIVFIKHRANISRLLAGTEGKIGAKG--
PLSY_BRASB       ---------------------------FALLTLLLIYMHRENIRRLQAGTEGKIGAKK--
PLSY_BRASO       ---------------------------FALLTLLLIYMHRENIKRLRAGTESKIGAKK--
PLSY_BRADU       ---------------------------FAVLTLLLFYAHRENIKRLQSGKESRIGEKA--
PLSY_RHOP2       ---------------------------FAVLTLLLFWMHRENIKRLQAGTESKIGEKK--
PLSY_RHOPS       ---------------------------FAVLTLLLFWMHRDNIKRLQSGTESRIGEKK--
PLSY_RHOPA       ---------------------------FAVLTLLLFWMHRENIKRLQAGTESKIGQKK--
PLSY_RHOPT       ---------------------------FAVLTLLLFWMHRENIKRLQAGTESKIGQKK--
PLSY_RHOPB       ---------------------------FAILTLLLVWMHSENIKRLMAGTEGKIGEKK--
PLSY_NITHX       ---------------------------LAVLTLLLWFKHRENIRRLASGSEGRIGAKA--
PLSY_NITWN       ---------------------------FAVLTVLLWFKHRENIRRLFAGSEGRIGAKA--
PLSY_METC4       ---------------------------FLVLAALLWWKHAPNIRRLAAGTEGRIGKKG--
PLSY_METEP       ---------------------------FLVLAALLWWKHAPNIRRLAAGTEGRIGKKG--
PLSY_METPB       ---------------------------FLVLAALLWWKHAPNIRRLAAGTEGRIGQKG--
PLSY_CAUVN       ---------------------------CLFMAVLIFIRHRENIARLLKGEEPKIGKKKPA
PLSY_CAUVC       ---------------------------CLFMAVLIFIRHRENIARLLKGEEPKIGKKKPA
PLSY_RHOS1       ---------------------------GAVLAVLIFIRHHANIRRILAGTEPRIGKK---
PLSY_RHOS4       ---------------------------GAVLAVLIFIRHHANIRRILAGTEPRIGKK---
PLSY_RHOSK       ---------------------------GAVLAVLIFIRHHANIRRILAGTEPRIGKK---
PLSY_RHOS5       ---------------------------GLVLAVLIFIRHHENIRRIANGTEPRIGKKASQ
PLSY_ROSDO       ---------------------------LILLGALIFWRHRGNIARIRTGTEPKIGQKK--
PLSY_RUEST       ---------------------------SALLALVILWRHRENIARLRAGTEPKIGQK---
PLSY_RUEPO       ---------------------------GIVLTLMVFWRHRANIARLKARTEPKIGQKSA-
PLSY_JANSC       ---------------------------CAALATLIFLRHRGNISRIAKGQEPKIGKTS--
PLSY_DINSH       ---------------------------SLFLGFLIWIRHRENIIRLLSGTEPRIGAKKR-
PLSY_MAGSA       ----------------------------AGLAVMGFYRHKANIIRLIRGEEPRIGGKKKT
PLSY_RHORT       ----------------------------ALLALLAWIRHRANIARLLKGEESRIGAKKKA
PLSY_MARMM       ----------------------------GLLTVLIYWLHRANISRLLKGEEPRIGGKKSE
PLSY_HYPNA       ---------------------------LALLSVFVFWTHRENIGRLLKGTEPRFGAKKKD
PLSY_ERYLH       ---------------------------LVIIAVIIIWLHRANIRRLLRGEEPRVGNKP--
PLSY_NOVAD       ---------------------------LALLALLVLYLHRENIARLRAGTEPKVGSRK--
PLSY_GLUOX       -----------------------IPVATLLISLLIWARHSSNIARLVTGREPRVKVDQAS
PLSY_GRABC       -----LA-----------QSHWQAAAAFMLIAVLVFLRHADNIARLRAGTESRIGTRS--
PLSY_ZYMMO       ------------------------IALFSGMTILLLWRHRGNIKRLLSGQESRIGDPQ--
PLSY_ANAD2       ---------------------------GLAIALLIFVRHRENIRRLVRGEEKKV------
PLSY_ANASK       ---------------------------GLAIALLIFLRHRENIRRLVRGEEKKV------
PLSY_ANADE       ---------------------------GLAIALLIFLRHRENIRRLVRGEEKKV------
PLSY_ANADF       ---------------------------GLALAALIVVRHRENIRRLVRGEEKRMRV----
PLSY_MYXXD       ---------------------------ALLFALMLWT-HRGNILRLARRTERRF------
PLSY_DEIGD       -------------------------LIVAFLAALLTWQHRDNIRRLQAGNERRLGEKKD-
PLSY1_DEIRA      -------------------------AAVLFLAALLVWQHRENIRKLQAGTERRLGEKVS-
PLSY_THET2       -------------------------ATVFLMALLIFWTHRENLKRLQEGTERRLGERAEA
PLSY_THET8       -------------------------ATVFLMALLIFWTHRENLKRLREGTERRLGERVEA
PLSY_RUBXD       -------------------------LYTVVGGAAVLWRHRENARALLRGTERKFGGRSGG
PLSY_ROSS1       -------------------------IFVWGAVAAIVFLHRSNIHRLRTGTENRFEKLF--
PLSY1_DEHM1      --------------------------ISVLLFLMIGIKFVLDNRKNLRDPANRRNLIVDH
PLSY1_DEHMC      --------------------------ISVLLFLMIGGKFVLDNRKSLRDPANRRNLIVDH
PLSY2_DEHM1      --------------------------LFSLLVVMIPIIMYIPRMKEIKNKAGSGNAKRAI
PLSY2_DEHMC      --------------------------LFSLLVVMIPILMYIPRMKEIKNKAGSGNAKRAI
PLSY5_DEHM1      --------------------------QTISWGFIGIFLIMVTRRLMAPDNEYAHTVSKAE
PLSY4_DEHMC      --------------------------QTVTWGFAGLFLIMIVRRLMAPDSEYSSTVSKAE
PLSY4_DEHM1      --------------------------YSIGLPVVVGLTHFIRSRKNRL------------
PLSY1_MOOTA      --------------------------FGLGLAAIMLLRHGPLVISLFYNLKERR------
PLSY1_DESHY      --------------------------GLAVLAIFILLAHRKNIREMLNKSSQRRR-----
PLSY_NOSS1       -------------------QPLPYILFGIAGGLYVILRHRSNIERLLAGTEPKIGQKLVT
PLSY_TRIV2       -------------------QPLPYILFGIAGGLYVILRHRSNIERLLAGTEPKIGQKLTT
PLSY_TRIEI       -------------------QPLPYQIFAITGGIYVIWRHISNIERLLACKEPRIGQKLST
PLSY_ACAM1       -------------------EPLAYVLFSITAGVYVVWRHWANIQRLLAGTEPRLGQKKAV
PLSY2_RHIL3      -------------------QPLPYRLLVIAGGIYVIARHRTNIRRLLAGTEPRLGKVA--
PLSY_SYNJA       -------------------QPLPYLLFALAGGVYVIAAHRRNIERLLAGSEPRIGQKWAQ
PLSY_SYNJB       -------------------QPLPYLLFALAGGVYVIGAHRRNIERLLAGSEPRIGQKWTQ
PLSY_SYNE7       -------------------EPLPNKILGIASGIYVIYRHRSNLDRLRRGEEPRIGQRLST
PLSY_SYNP6       -------------------EPLPNKILGIASGIYVIYRHRSNLDRLRRGEEPRIGQRLST
PLSY_CROS5       -------------------QPLPYCLFGVIVGLYVTFRHRTNIIRLLQGTEPRLGQKLQQ
PLSY_RIPO1       -------------------QPLAYILFAILAGIYVIVRHKTNISRILQGTEPKIGQKLTE
PLSY_SYNY3       -------------------LPPPYLAFTFLAGMYVIVRHRTNIERILQGTEPKLGEKVSS
PLSY_THEEB       -------------------QSWPFVGFSVIAGAFVIWRHQSNIQRLLAGTEPRLGASQG-
PLSY_GLOVI       -------------------APLPFTLFGLLGGIYIVWRHRGNIERLLQGTEPKIGDPAAH
PLSY_PROM2       -----------------GEFIHTYFFISLIVALLVIWKHRTNITRLIKGEESKINQNQ--
PLSY_PROMS       -----------------GKFIHSYFFISLIVALLVIWKHRTNIKRLIKGEESKINQNQ--
PLSY_PROM0       -----------------GKFMHSYFFISLIVALLVIWKHRTNITRLLKGEESKINQTQ--
PLSY_PROM9       -----------------GNYMHSYFFISLIVALLVIWKHRTNITRLLKGEESKINQNQ--
PLSY_PROM5       -----------------GVTNHPYFLISLVVSILVILKHRTNIRRLIKGEESKINSLNK-
PLSY_PROMP       -----------------GSTNHPYFFISLVVSILVIWKHRTNIRRLLKGEELKINDINK-
PLSY_PROM1       ----------------GSNISLPFLIVSLLAMLLVIWRHRENIVRLIRGKEPRIGQP---
PLSY_PROMT       ----------------GSNLSLPFLIVSLLAMILVIWRHRENIVRLIRGKEPRIGQP---
PLSY_PROM4       ----------------EASFLNAYIIASFAAMIMVLWRHRANLKRLLNGDEPRIGKIN--
PLSY_PROMA       ----------------E-TFSIPYIVISFIAMILVLWRHRSNLIRLIKGQEPRIGKSN--
PLSY_SYNPX       -----------------GGSS-AYVVVSLVASLMVLWRHRSNIERLIAGTEPKIGQKA--
PLSY_SYNSC       -----------------GSSS-AYVVVSLVASLMVLWRHRSNIERLLAGTEPKIGAKAKG
PLSY_SYNS9       -----------------GGSS-AYVAVSVVASLMVLWRHRSNIERLLAGTEPRIGEKGKS
PLSY_PROMM       ----------------QGNSPPAYLAVAFAAMAMVVWRHRSNLQRLLAGTEPRLGQSS--
PLSY_DESRM       -------------------QNRHYLIFSVLVASFAVWKHSSNIGRLIKGTEFKIGQKKT-
PLSY_DESAP       -------------------VGWRHVLFGLFLALVAVYKHRANIDRLLKGKESRFSFRK--
PLSY2_MOOTA      -------------------RPWPYVLFTFVAAALVIYRHRPNIKRLLAGTEHKLGERS--
PLSY_CARHZ       -------------------LDLSYIYLGIFLAVMIFYRHRDNIKRLRSGTENKIGTRKNG
PLSY_BACSU       ----------------FFVHDTYLLIVVTLLTIFVIYRHRANIKRIINKTEPKVKWL---
PLSY_BACVZ       ----------------LFVKDPYLLVVVTLLTAFVIYRHRANIKRIINKTEPKIKWF---
PLSY_BACLD       ----------------LFTKDLLLVAVVAFLTAFVVYRHRTNIKRIIDKTEPKIKWMSGK
PLSY_GEOKA       ----------------FFTDDIPLTVAVLLLASFIFYRHRANIQRILNKTEPKVKWPGKR
PLSY_GEOSW       ----------------FFTDDIPLMIAVSLLTAFIFYRHRANIKRIVNKTEPKIKWLGRK
PLSY3_BACAN      ----------------IVTGDKIFIIAMCLLAGMVIYKHRANIGRIINKTEPKANFSKKQ
PLSY2_BACHK      ----------------IVSGDKIFIIAMCLLASMVIYKHRANIGRIINKTEPKANFSKKQ
PLSY_BACC2       ----------------IVSGDKIFIIAMCLLAGMVIYKHRANIGRIINKTEPKANFSKKQ
PLSY2_BACCR      ----------------IVSGDKIFIIAMCLLAGMVIYKHRANIGRIINKTEPKANFSKKQ
PLSY2_BACCZ      ----------------IVSGDKIFIIAMCLLAGMVIYKHRANIGRIINKTEPKANFSKKQ
PLSY2_BACC1      ----------------IVSGDKIFIIAMCLLAGMVIYKHRANIGRIINKTEPKANFSKKQ
PLSY_BACCN       ----------------IVNGDKIFIVAMCLLAGMVIYRHRANIGRIINKTEPKANFTKKQ
PLSY2_OCEIH      ----------------IFYQDLGLSIVVFLLSAIVCYRHRENIKRIKNGTEPKISWM---
PLSY_LISMC       ----------------LFMGDWILIILVACIALFVIWRHRANITRIRNGEEPKIKWM---
PLSY_LISMF       ----------------LFMGDWILIILVACIALFVIWRHRANITRIRNGEEPKIKWM---
PLSY_LISMH       ----------------LFMGDWILIILVACIALFVIWRHRANITRIRNGEEPKIKWM---
PLSY_LISMO       ----------------LFMGDWILIVLVACIALFVIWRHRANITRIRNGEEPKIKWM---
PLSY_LISIN       ----------------FFMGDWILIILVACIALFVIWRHRANITRIRNGEEPKIKWM---
PLSY_LISW6       ----------------LFMGDWILIILIACITLFVVWRHRANITRIRNGEEPKIKWM---
PLSY2_BACAN      ----------------LIFEDKVIIALSLLIIVSIIILHRQNIKRILNGTENKIV-----
PLSY_EXIS2       ----------------IVEQDWIVPTFFTILALFVIFKHRENISRIRQGTESKIGMFAKD
PLSY_STRR6       ---------------ILSNYDSLFIAIILALASLIIIRHKDNIARIKNKTENLVPWGLNL
PLSY_STRZJ       ---------------ILSNYDSLFIAIILALASLIIIRHKDNIARIKNKTENLVPWGLNL
PLSY_STRZP       ---------------ILSNYDSLFIAIILALASLIIIRHKDNIARIKNKTENLVPWGLNL
PLSY_STRP2       ---------------ILSNYDSLFIAIILALASLIIIRHKDNIARIKNKTENLVPWGLNL
PLSY_STRPJ       ---------------ILSNYDSLFIAIILALASLIIIRHKDNIARIKNKTENLVPWGLNL
PLSY_STRP4       ---------------ILSNYDSLFIAIILALASLIIIRHKDNIARIKNKTENLVPWGLNL
PLSY_STRPN       ---------------ILSNYDSLFIAIILALASLIIIRHKDNIARIKNKTENLVPWGLNL
PLSY_STRP7       ---------------ILSNYDSLFIAIILALASLIIIRHKDNIARIKNKTENLVPWGLNL
PLSY_STRPI       ---------------ILSNYDSLFITIILALASLIIIRHKDNIARIKNKTENLVPWGLNL
PLSY_STRPS       ---------------ILSNYDFLFIAIILALASLIIIRHKDNIARIKNKTENLVPWGLNL
PLSY_STRZT       ---------------ILNNYDPLFIAIILALASLIIIRHKDNIARIKNKTENLVPWGLNL
PLSY_STRGC       ---------------ILPSYDLLFTLIIILLASIILIRHRDNMERIKNKSENLIPWGINI
PLSY_STRSV       ---------------ILPSYDLFFTLIIIALALIIILRHKDNIQRIKQKKENLIPWGLNI
PLSY_LACLM       ---------------ILTSYDLLFSIIIFALAIIIIFRHKTNLKRIKNHCESLVPFGLNL
PLSY_LACLS       ---------------ILTSYDLLFSIIIFALAIIIIFRHKTNLKRIKNHCESLVPFGLNL
PLSY_LACLA       ---------------ILTSYDLLFSIIIFVLAIIIILRHRTNLKRIKNHCESLVPFGLNL
PLSY_STRA3       ---------------ILTDYDWIFTTVVILMALTIIIRHQDNIKRIRKRQENLVPFGLNL
PLSY_STRA5       ---------------ILTDYDWIFTTVVILMALTIIIRHQDNIKRIRKRQENLVPFGLNL
PLSY_STRA1       ---------------ILTDYDWIFTTVVILMALTIIIRHQDNIKRIRKRQENLVPFGLNL
PLSY_STRT1       ---------------LLDGYDPIFSAVLIIIALVIIFRHTENIARIRNHRENLVPFGLNL
PLSY_STRT2       ---------------LLDGYDPIFSAVLIIIALVIIFRHTENIARIRNHRENLVPFGLNL
PLSY_STRTD       ---------------LLDGYDPIFSAVLIIIVLVIIFRHTENIARIRNHRENLVPFGLNL
PLSY_STREM       ---------------LLPGYDWLLTITIVVLAAIIILRHQDNMKRIKQQSENLIPWGLNL
PLSY_STRS7       ---------------LLPGYDWLLTITIVVLAAIIILRHQDNMKRIKQQSENLIPWGLNL
PLSY_STRE4       ---------------LLPSYDWLLTITIVVLAAIIILRHQDNMKRIKQQSENLIPWGLNL
PLSY_STRPM       ---------------LLPNYDYFLTFIVILLAFIIIIRHKDNISRIKHHTENLIPWGLNL
PLSY_STRPZ       ---------------LLPNYDYFLTFIVILLAFIIIIRHKDNISRIKHHTENLIPWGLNL
PLSY_STRP6       ---------------LLPNYDYFLTFIVILLAFIIIIRHKDNISRIKHHTENLIPWGLNL
PLSY_STRP8       ---------------LLPNYDYFLTFIVILLAFIIIIRHKDNISRIKHHTENLIPWGLNL
PLSY_STRPB       ---------------LLPNYDYFLTFIVILLAFIIIIRHKDNISRIKHHTENLIPWGLNL
PLSY_STRPC       ---------------LLPNYDYFLTFIVILLAFIIIIRHKDNISRIKHHTENLIPWGLNL
PLSY_STRPD       ---------------LLPNYDYFLTFIVILLAFIIIIRHKDNISRIKHHTENLIPWGLNL
PLSY_STRPF       ---------------LLPNYDYFLTFIVILLAFIIIIRHKDNISRIKHHTENLIPWGLNL
PLSY_STRPG       ---------------LLPNYDYFLTFIVILLAFIIIIRHKDNISRIKHHTENLIPWGLNL
PLSY_STRP1       ---------------LLPNYDYFLTFIVILLAFIIIIRHKDNISRIKHHTENLIPWGLNL
PLSY_STRP3       ---------------LLPNYDYFLTFIVILLAFIIIIRHKDNISRIKHHTENLIPWGLNL
PLSY_STRMU       ---------------LLKDYDFLFVLIVISAGSLIIIRHRENLVRIKNKTESLVPFGLNI
PLSY_LACBA       -------------------QDWYLTGIALVLTVFVFYRHRSNIQRIRQGTESMVPFGRGY
PLSY_LACPL       -------------------QDWLLSLVAFALTLFIFYRHRSNIARIKNGTESLVHFGLGW
PLSY_LACP3       -------------------HDWLLTTVACGLLVVFLIKHRANFKRIKAGDENMVPFGLGQ
PLSY_LACCB       -------------------HDWLLTTVACGLLVVFLIKHRANFKRIKAGDENMVPFGLGQ
PLSY_LACSS       -------------------HDWLLGTIATLVLIFLTYRHRENISRIKNGTENLVPFGLYY
PLSY_LACRD       -------------------HAWILAIVAGILTGVVFYRHRSNIHRILSGKESMVSFGLGY
PLSY_LACRJ       -------------------HAWILAIVAGILTGVVFYRHRSNIHRILSGKESMVSFGLGY
PLSY_LACS1       -------------------NDRVLTIVAIVLTVFVFARHWKNIERIKNGTENMVPFGLGY
PLSY_ENTFA       ---------------ILPTFNWLLTVIAIALTTFIFVRHRENIQRIKNGTESRLSFGLRA
PLSY2_LACAC      --------------------DIALSIISGLLVILIYWSHRSNIARIEKHQENMVPFGVVY
PLSY2_LACJO      --------------------DIFLTIITGIMMILLFVRHRSNIKRLINHEENIVPFGLWY
PLSY_STAA1       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAA2       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAA9       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAAW       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAAM       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAAN       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAAR       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAAS       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAAB       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAA3       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAA8       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAAT       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAAC       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAAE       --------------------DYILLVVSFLVSIILIIRHRSNIARIFRGEEPKIKWM---
PLSY_STAEQ       --------------------DYILLAVSGIVSIILIIRHKSNIVRIFKGEEPKIKWM---
PLSY_STAES       --------------------DYILLAVSGIVSIILIIRHKSNIVRIFKGEEPKIKWM---
PLSY_STAHJ       --------------------DYILFGMSLLVSIILIVRHRTNIVRIFKGEEPKIKWM---
PLSY_STAS1       --------------------DYILFIVSIGVGVLLIIRHRTNIVRIFKGEEPKIKWM---
PLSY_STACT       --------------------DYILLVVSIIVAILLIFRHRTNIVRIFKGEEPKIKWM---
PLSY_MACCJ       --------------------DIILQIISFLIMLLIIIRHSSNIKRIISGTEPKIQFKK--
PLSY_PELLD       -----YIRLFGESFSFHDSLDYHLMIFGLIVALAILYTHRANIRRLISGTENRITFGKSA
PLSY_CHLPM       -----YIRLFGESFSFHDSLDYHLIIFGLLVAFAILFTHRANIRRLISGTENRVTFRKHA
PLSY_CHLL2       -----YIKLFGEQLSFHDSLDYHLMIFGLIVALGILYTHRANIRRLLSGTENRVTFGKHS
PLSY_PELPB       -----YIGLFGSPISFHDSLDYHLMIFGLIVALAILYTHRTNIRRLISGTESRVTFGKKH
PLSY_CHLCH       -----YIKLFNAKFFFHDSLDYHLIIFGLIVAIAIIYTHRANIKRLLAGTENRISFGKH-
PLSY_CHLPD       -----YVKLFGERFSFHDSLDYHLMIFGLIVALAILYTHRANIRRLLSGTENRIKFGRHS
PLSY_CHLP8       -----H---FFGKWLVHDSLDYHLLIFGGIVAAAIIYTHRANIKRLFSGTENRLTFGRRS
PLSY_CHLTE       -----R---FFDHWFVHDSLDYHLLIFGGIVAVAIIYTHRANIKRLFSGTENRLSFGRKN
PLSY_CHLPB       -----YIRMFNTNVFIHDSLDYHLLIFGFIVAAAIMYTHRANIRRLLSGKENRVKFHGHS
PLSY_PROA2       -----YIRMFNGHVFIHDSLDFHLLIFGMIVAFAIIYTHRANIGRLLSGNENRVTFGRHA
PLSY_SALRD       -----------------ADLDPSLLVFGGLLALSIVVAHRSNIQRLLNGTESQISSFEPA
PLSY_THEP3       -----------------WNSTQIF-IFSLILASLAIFQHRSNIKRLLAGTESKLGQKTEI
PLSY_THEPX       -----------------WNSTQIF-IFSLILASLAIFQHRSNIKRLLAGTESKLGQKTEI
PLSY_CALS4       -----------------PNSVQVL-TFAIVLALLVIFQHRSNIKRLINGTESKIGQRAQI
PLSY_ALKMQ       -----------------SYGLEYF-IFGLVLSVMAIYRHRENIKRLRTGTEKKIGRKTSV
PLSY_CLOD6       -----------------VKNKAGL-IVALFLTASVIYNHRANIKRLLNGTERKIGQKKE-
PLSY_FINM2       -----------------IRKDFYIGLIYILLGIISLFKHRSNINRLIHGKESKLGKN---
PLSY_SYNWW       -----------------MGKPWSYVVIGILMAALVVYHHRENIDRLRNGSEAKITDKA--
PLSY2_DESHY      -------------------EPMAYKVFAVIAVSGVVIRHRTNIQRVLKGTENKFNLKR--
PLSY_SYMTH       -------------------APLSHRLLVVALAVVIYVRHWENMKRIAAGTENRLGVKARP
PLSY_BACHD       ---------------QWFGYPVAYIYLTIIVAILSMWRHRSNIQRLLSGTENKLGRKKET
PLSY_BACSK       ---------------PFFHYPLEYIYLAVLLAILSLWRHRTNMGRLIAGTENKLGKKHA-
PLSY3_DEHM1      ---------------FISGFPTEYIVYAVLGSLLITIMHRDNIKRLLAGKERKLNEKSR-
PLSY3_DEHMC      ---------------LISGFPTEYMIYAVIGSLLITIMHRDNIKRLLAGKERKLNEKAR-
PLSY_AQUAE       ---------------------VNVLFMAIVIGALIIYRHRENINRLLTGREHRF------
PLSY_HYDS0       ---------------------TSQKLGATMIAFLILYKHKDNVFRLLRKEEHKFK-----
PLSY1_BACAN      ----------YSIVTTILSALIIVLILYVNHE----------------------------
PLSY1_BACCZ      ----------YSIVTTILSALIIVLILYVNRE----------------------------
PLSY1_BACHK      ----------YSIVTTILSVLIIVLILYVNRE----------------------------
PLSY1_BACC1      ----------YSIVTTILSALIIVLILYVNRD----------------------------
PLSY1_BACCR      ----------YSIVTTILSGIIIVLILYVNRE----------------------------
PLSY1_LACAC      ----------NQEAGIVFMVITLIMVYKFWQDIIDFFTGHGKRVDILYSIKKKLGIKSE-
PLSY1_LACJO      ----------GWEQGLIFLIATLIMIFQFRKDIVDFFTGKGKRVDVLVTIKKKLGIYK--
PLSY_MYCCT       ---GLEQFSVAWKNYILFSLLNSFHYWFSNI----WASGMLEGNIIVLIGGLILGLRHSQ
PLSY_MYCMS       ---GLEKFRVAWKNYILFSLLNSFHYWFSNT----WASGILEGNIIILIGGLILAWRHSQ
PLSY_MESFL       ---GYDSFIVAWDKHIVFSFYNLFHKFSSNIHGSNFADGMLTGQIVILIGMVILVVRHKS
PLSY_MYCAP       ---WTNAVEYTNSFTTLVNYWYVSPIIYTLCAFLVLVSHRDNFKRLINKSERKFAIKKAV
PLSY_MYCS5       ---ATSGF----------GQFWVNIIIYLFAAALIFWKHRENIKRLLSKTENKMKFKK--
PLSY_MYCMO       ---VGYSDFYQPVRESFQGAWYLSSLFLFLAALIILFTHIPNIKKLIKKEESVLKFSKKS
PLSY_MYCPU       ---IAY-----------QWPWWISPLVYVLIILLVIWSHHENISRMIKGQEKVIKWNKTS
PLSY_UREP2       ---QNFTTYFFDLNYVIKGIWYVWFFLLVSASLLIYRHKTNILSIATKQERKTILFHTKS
PLSY_UREPA       ---QNFTTYFFDLNYVIKGIWYVWFFLLVSASLLIYRHKTNILSIATKQERKTILFHTKS
PLSY_UREU1       ---EHFVEYLFDLNHVIKGTWYVWLFLLISASILIYRHKTNILSIATKQERKTFLFQPKP
PLSY_MYCGE       ---SDPLKSITYQNEWYIILFFC--LWYWPLTVVVFWLHRANIIRILHGKESKITQLN--
PLSY_MYCPN       ---PNPINAISYQNDWYIILFFV--LWYWPLTIAVFWLHRKNIHRLLNKTENKVTQLN--
PLSY_MYCGA       ---LDKITFLTYQSDWYIIVFFA--IANTILSTIIIWKHRGNIVRLINKQENKITKKV--
PLSY_PSELT       ----------------------DYGVLFLLLSTLSTLRHSENIERLVNKSERKTDLIKII
PLSY_THEM4       ----------------------DFWVIFLALSLFSILRHKDNIQRLINGNERKTDVIGYF
PLSY_KOSOT       ----------------------QTGIWMLALFLLTTYRHRGNIVRLIRGEERKTDLIAAF
PLSY2_THEMA      ----------------------DTGMLFLILAVLSTLRHSENIQRLLNGTERKVNLFKR-
PLSY_THEP1       ----------------------DTGMLILILAVLSTLRHSENIQRLLNGTERKVNLFKR-
PLSY_ANAMF       ----------------------NSSIFYIAMSIIVLIKHRDNVIRMINGTEKKLF-----
PLSY_ANAMM       ----------------------NSSIFYIAMSIIVLIKHRDNVIRMINGTEKKLF-----
PLSY_ANAPZ       ----------------------VVALLYTVQSILILFKHRENIVRLIKREEKKVI-----
PLSY_EHRCJ       ----------------------NESITFLVMSLLVIVQHIENIVRIIKGKENKI------
PLSY_EHRCR       ----------------------NDTAVFIAMSLLIITQHADNIARMLSGKENKLNIGL--
PLSY_EHRRG       ----------------------VQSVIFAITALLIITQHTDNIIRMLNKSENKINLKL--
PLSY_EHRRW       ----------------------VQSVIFTITALLIITQHTDNIIRMLNKSENKINLKL--
PLSY_BARHE       ----------------------YAHCILVIMSLLVMIKHHANIGRLLVGKESKIGTQNGG
PLSY_BARQU       ----------------------YAHCILVMMSIFVIIKHHANIARLLIGKESKIGTQNRD
PLSY_BART1       ----------------------YFCCMLIAMSLFVFIKHSANISRLLIGEENKIGTQNRD
PLSY_BARBK       ----------------------YTNCTIAIMSVLVIIKHHANIRRLLIGKERKVTIKKRN
PLSY_PELUB       ----------------------YNSIFFIIMFVLIFYTHRENVKRLKNKEETKTKIY---
PLSY_WOLPM       ----------------------NLFLTLLIIGALVFLKHHRNIVNLLQGKEYKFYR----
PLSY_WOLPP       ----------------------ELFLILLTVAILIFLKHYKNIANLLQGRERKFL-----
PLSY_WOLTR       ----------------------DLFFTLLTVAILIFFKHYRNIVNLLQGRERKFS-----
PLSY_ARCB4       ---------------------INSNIPMYLIAFIILYKHIPNIVRLIKGQEGKVI-----
PLSY_SULDN       -----------------------AHAPVIIIGFVLLYKHIPNIIRLFKGEEKRVV-----
PLSY_WOLSU       ---------------------IGTHAPLLIIAFVIFYKHIPNLVRLFQGKEGRVV-----
PLSY_NITSB       ---------------------VHSHAPLLLLAFIIFYKHLPNIKRLLTGQEGKVAA----
PLSY_CAMJ8       ---------------------IHTHAPVFIIAFIIVYKHLPNIKRLIFKEECKVI-----
PLSY_CAMJJ       ---------------------IHTHAPVFIIAFIIIYKHLPNIKRLIFKEECKVI-----
PLSY_CAMJE       ---------------------IHTHAPVFIIAFIIVYKHLPNIKRLIFKEECKVI-----
PLSY_CAMJR       ---------------------IHTHAPVFIIAFIIVYKHLPNIKRLIFKEECKVI-----
PLSY_CAMJD       ---------------------IHTHAPVFIIAFIIVYKHLPNIKRLIFKEECKVI-----
PLSY_CAMLR       ---------------------INTHAPIFIIAFIVVYKHIPNILRLIGKQECKVI-----
PLSY_CAMC1       ---------------------IYTHAPILIIAFLVVYKHIPNIVRLLSGKEQKVV-----
PLSY_HELPH       ------------------LKEVDTQTPMVLIFIFTLIKHAGNIFNLLAGKEKKVL-----
PLSY_HELPJ       ------------------LKEVGTQTPMVLIFIFTLIKHAGNIFNLLTGKEKKVL-----
PLSY_HELPY       ------------------LKEVGTQTPMVLIFIFTLIKHAGNIFNLLAGKEKKVL-----
PLSY_HELAH       ------------------LKEVGTQTPMVLIFIFTLIKHVGNIFNLLAGKEKKVL-----
PLSY_HELHP       ------------------IKQINTHTPLVLIGLFIFYTHIPNIKRLFSGEENKVL-----
PLSY_MYCPE       PFNRPFEIAAIFNYSLNWWYILVTFLLELLTAVLVIYRHKENIVRLIKGEERKAFAKKTN
PLSY_NEOSM       -----------------------VFLPILAGTVLIFIRHTSNVREFLQAR----------
PLSY1_OCEIH      -----------------------PFFIVVGLSVLSIYKHIENYKRIIGKEETKLSSMFGK
PLSY1_THEMA      -----------------FNGMPELAILYFGNFLIVFYKHRLELRRYLKGV----------
PLSY2_DEIRA      ---------------------LLIASRLGGGAEFLAGSAAMGIRAVHLLAEQRA------
                                                                             

PLSY_AYWBP       ------------------------------------------------------------
PLSY_ONYPE       ------------------------------------------------------------
PLSY_PHYAS       K-----------------------------------------------------------
PLSY_ACHLA       NITK--------------------------------------------------------
PLSY_CLOAB       ------------------------------------------------------------
PLSY_GEOMG       ------------------------------------------------------------
PLSY_GEOSL       ------------------------------------------------------------
PLSY_GEODF       ------------------------------------------------------------
PLSY_GEOLS       ------------------------------------------------------------
PLSY_PELCD       ------------------------------------------------------------
PLSY_KORVE       EGKA--------------------------------------------------------
PLSY_FUSNN       ------------------------------------------------------------
PLSY_UNCTG       ------------------------------------------------------------
PLSY_DESAD       ------------------------------------------------------------
PLSY_DESMR       AA----------------------------------------------------------
PLSY_DESAG       EHE---------------------------------------------------------
PLSY_DESVH       AAQGTDAGAAPEAAADAAHAGTVDCGCDCGCDAHKPSTEAAPSQETSDASAHGAEAPVAA
PLSY_DESDA       GAAAGNAAEGDDTQNMNPQDAGRKDG----------------------------------
PLSY_LAWIP       ------------------------------------------------------------
PLSY_LEPBJ       ERNGDSERNRR-------------------------------------------------
PLSY_LEPBL       ERNGDSERNRR-------------------------------------------------
PLSY_LEPIC       EQDGDSERNRR-------------------------------------------------
PLSY_LEPIN       EQDGDSERNRR-------------------------------------------------
PLSY_DESPS       ------------------------------------------------------------
PLSY_ECOLI       ---------------------------------------TKFKRKREKDPE---------
PLSY_SHIB3       ---------------------------------------TKFKRKREKDPE---------
PLSY_SHISS       ---------------------------------------TKFKRKREKDPE---------
PLSY_SHIBS       ---------------------------------------TKFKRKREKDPE---------
PLSY_SHIDS       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECO24       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECO27       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECO45       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECO55       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECO57       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECO5E       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECO7I       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECO81       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECO8A       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECOBW       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECODH       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECOHS       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECOK1       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECOL5       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECOL6       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECOLC       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECOLU       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECOSE       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECOSM       ---------------------------------------TKFKRKREKDPE---------
PLSY_ECOUT       ---------------------------------------TKFKRKREKDPE---------
PLSY_SHIF8       ---------------------------------------TKFKRKREKDPE---------
PLSY_SHIFL       ---------------------------------------TKFKRKREKDPE---------
PLSY_ESCF3       ---------------------------------------TKLKRKREKDPE---------
PLSY_SALSV       ---------------------------------------TKLKKKRQKDSE---------
PLSY_SALTI       ---------------------------------------TKLKKKRQKD-----------
PLSY_SALTY       ---------------------------------------TKLKKKRQKD-----------
PLSY_SALA4       ---------------------------------------TKLKKKRQKD-----------
PLSY_SALCH       ---------------------------------------TKLKKKRQKD-----------
PLSY_SALDC       ---------------------------------------TKLKKKRQKD-----------
PLSY_SALEP       ---------------------------------------TKLKKKRQKD-----------
PLSY_SALG2       ---------------------------------------TKLKKKRQKD-----------
PLSY_SALHS       ---------------------------------------TKLKKKRQKD-----------
PLSY_SALNS       ---------------------------------------TKLKKKRQKD-----------
PLSY_SALPA       ---------------------------------------TKLKKKRQKD-----------
PLSY_SALPB       ---------------------------------------TKLKKKRQKD-----------
PLSY_SALPK       ---------------------------------------TKLKKKRQKD-----------
PLSY_CITK8       ---------------------------------------TKLKKKREKDPQ---------
PLSY_SALAR       ---------------------------------------TKLKKKREKESK---------
PLSY_ENT38       ---------------------------------------TKLKKKKAPK-----------
PLSY_CROS8       ---------------------------------------SRFRKKRPQKKE---------
PLSY_KLEP3       ---------------------------------------TRMKKKKAPEQK---------
PLSY_KLEP7       ---------------------------------------TREKKKKTPEQK---------
PLSY_PECAS       ---------------------------------------DKLRKKKQ--PEDEDTSPEE-
PLSY_PECCP       ---------------------------------------NKLRKKKQ--PEDEKTSPEE-
PLSY_YERP3       ---------------------------------------DKLRKKKQKTPAEEAAELEEK
PLSY_YERPA       ---------------------------------------DKLRKKKQKTPAEEAAELEEK
PLSY_YERPB       ---------------------------------------DKLRKKKQKTPAEEAAELEEK
PLSY_YERPE       ---------------------------------------DKLRKKKQKTPAEEAAELEEK
PLSY_YERPN       ---------------------------------------DKLRKKKQKTPAEEAAELEEK
PLSY_YERPP       ---------------------------------------DKLRKKKQKTPAEEAAELEEK
PLSY_YERPS       ---------------------------------------DKLRKKKQKTPAEEAAELEEK
PLSY_YERPY       ---------------------------------------DKLRKKKQKTPAEEAAELEEK
PLSY_YERE8       ---------------------------------------DKLRKKKQKTPAEEAAELEEK
PLSY_SERP5       ---------------------------------------GVFRKKKN-----DAAEQEEK
PLSY_ERWT9       ---------------------------------------KKKDRRKG--PGKT-------
PLSY_EDWI9       ---------------------------------------RKKGAKSAQNSERPASASPPH
PLSY_PHOLL       ---------------------------------------NKLKKKKEMTEKEKKRTEKEQ
PLSY_PROMH       ---------------------------------------HKLKKKTEKTDKEIIQEAKEQ
PLSY_SODGM       ---------------------------------------HRRQKDRDID--------RQQ
PLSY_HAEI8       ---------------------------------------AKFKKK---------------
PLSY_HAEIG       ---------------------------------------AKFKKK---------------
PLSY_HAEIN       ---------------------------------------AKFKKK---------------
PLSY_HAEIE       ---------------------------------------AKFKKK---------------
PLSY_PASMU       ---------------------------------------NKLKNKKD-------------
PLSY_ACTSZ       ---------------------------------------GKKSNKK--------------
PLSY_MANSM       ---------------------------------------AKFKKKEDSQGE---------
PLSY_HAES1       ---------------------------------------SKFKK----------------
PLSY_ACTP2       ---------------------------------------ARK------------------
PLSY_ACTP7       ---------------------------------------ARK------------------
PLSY_ACTPJ       ---------------------------------------ARK------------------
PLSY_HAEDU       ---------------------------------------DKLKSK---------------
PLSY_HAEPS       ---------------------------------------KKKHSRQNGY-----------
PLSY_AERS4       ---------------------------------------GRQAQRRQEEVGEMDDVAQKR
PLSY_TOLAT       ---------------------------------------SRHPLKRHRR-----------
PLSY_ALIF1       ---------------------------------------QRKRD----------------
PLSY_ALIFM       ---------------------------------------QRKRD----------------
PLSY_ALISL       ------------------------------------------------------------
PLSY_PHOPR       ---------------------------------------QKISRKAKLK-----------
PLSY_VIBC3       ---------------------------------------EKNKKPSDDEESRVV------
PLSY_VIBCH       ---------------------------------------EKNKKPSDDEESRVV------
PLSY_VIBCM       ---------------------------------------EKNKKPSDDEESRVV------
PLSY_VIBCB       ---------------------------------------EKKLIEKNSA-----------
PLSY_VIBPA       ---------------------------------------EKKLTEKNSA-----------
PLSY_VIBTL       ---------------------------------------QKK-----SA-----------
PLSY_VIBVU       ---------------------------------------EKKLQMPKSQ-----------
PLSY_VIBVY       ---------------------------------------EKKLQMPKSQ-----------
PLSY_IDILO       ---------------------------------------RRR------------------
PLSY_PSEA6       ---------------------------------------DKGRTKE--------------
PLSY_COLP3       ---------------------------------------HKI------------------
PLSY_PSEHT       ---------------------------------------AKKAPTDEKSDI---------
PLSY_SHEB2       ---------------------------------------RKKRPKKS-------------
PLSY_SHEB5       ---------------------------------------RKKRPKKS-------------
PLSY_SHEB8       ---------------------------------------RKKRPKKS-------------
PLSY_SHEB9       ---------------------------------------RKKRPKKS-------------
PLSY_SHESA       ---------------------------------------RKKRPKAP-------------
PLSY_SHESR       ---------------------------------------RKKRPKAP-------------
PLSY_SHESM       ---------------------------------------RKKRPKTP-------------
PLSY_SHEON       ---------------------------------------RKRRPKIP-------------
PLSY_SHEPC       ---------------------------------------RKKRPKNP-------------
PLSY_SHESW       ---------------------------------------RKKRPKNP-------------
PLSY_SHEHH       ---------------------------------------RKKT-----------------
PLSY_SHESH       ---------------------------------------RKKKG----------------
PLSY_SHEWM       ---------------------------------------RKKTPKT--------------
PLSY_SHELP       ---------------------------------------RKKRTDGN-------------
PLSY_SHEDO       ---------------------------------------RKKRDKKTT------------
PLSY_BLOFL       ---------------------------------------NR-------------------
PLSY_BLOPB       ---------------------------------------RK-------------------
PLSY_COXB1       ------------------------------------------------------------
PLSY_COXBU       ------------------------------------------------------------
PLSY_COXBN       ------------------------------------------------------------
PLSY_COXBR       ------------------------------------------------------------
PLSY_COXB2       ------------------------------------------------------------
PLSY_FRAT1       ---------------------------------------DKAKAKNDSN-----------
PLSY_FRATT       ---------------------------------------DKAKAKNDSN-----------
PLSY_FRATF       ---------------------------------------DKAKAKNDSN-----------
PLSY_FRATH       ---------------------------------------DKAKAKNDSN-----------
PLSY_FRATN       ---------------------------------------DKAKAKNDSN-----------
PLSY_FRATO       ---------------------------------------DKAKAKNDSN-----------
PLSY_FRATM       ---------------------------------------DKAKAKNDSN-----------
PLSY_FRAP2       ---------------------------------------DKAKAKNDSN-----------
PLSY_LEGPC       IEEIMEASPATSAEQEFPGKEVIDTNIDETEKTEQAEAVKKPKVKKATTKAKKTTSKEET
PLSY_LEGPH       IEEIMEASPATSAEQEFPGKEVIDTNIDETEKTEQAEAVKKPKVKKATTKAKKTTSKEET
PLSY_LEGPA       IEEIMEASPATSAEQEFPGKEVIDTNIDETEKTEQAEAVKKPKAKKATTKAKKTASKEET
PLSY_LEGPL       IEEIMEASPATSAEQEFPGKEVIDTNIDEAEKTEQAEAVKKPKAKKATTKAKKTTSKEET
PLSY_RUTMC       ------------------------------------------------------------
PLSY_AROAE       ---------------------------------------ASKS-----------------
PLSY_LARHH       ---------------------------------------GKKKS----------------
PLSY_DECAR       ---------------------------------------SKKKA----------------
PLSY_NITEC       ---------------------------------------KSS------------------
PLSY_NITEU       ---------------------------------------KSS------------------
PLSY_NITMU       ---------------------------------------KRSTS----------------
PLSY_METFK       ---------------------------------------KKS------------------
PLSY_BORBR       ---------------------------------------KKK------------------
PLSY_BORPE       ---------------------------------------KKK------------------
PLSY_BORPA       ---------------------------------------KKK------------------
PLSY_BORPD       ---------------------------------------AKKK-----------------
PLSY_BORA1       ---------------------------------------SKKA-----------------
PLSY_BURA4       ---------------------------------------DKKKAAANGGAQDGGKL----
PLSY_BURCM       ---------------------------------------DKKKAAADGGAQDGGKL----
PLSY_BURL3       ---------------------------------------DKKKAAADGGAQDGGKA----
PLSY_BURVG       ---------------------------------------DKKKAAADGGAQGGGKV----
PLSY_BURCA       ---------------------------------------DKKKAAADGGAQDGGKA----
PLSY_BURCH       ---------------------------------------DKKKAAADGGAQDGGKA----
PLSY_BURCJ       ---------------------------------------DKKKAAADGGAQDGGKA----
PLSY_BURCC       ---------------------------------------DKKKAAADGGKA---------
PLSY_BURM1       ---------------------------------------DKKKAAANGNAQDGGKA----
PLSY_BURP1       ---------------------------------------QKKKTGA--------------
PLSY_BURPS       ---------------------------------------QKKKTGA--------------
PLSY_BURMA       ---------------------------------------QKKKTGV--------------
PLSY_BURTA       ---------------------------------------QKK-TDA--------------
PLSY_PARPJ       ---------------------------------------DKKKADAAAKPAGGSDV----
PLSY_PARXL       ---------------------------------------DRKKADAAAKPTAGSDV----
PLSY_PARP8       ---------------------------------------DKKKAEAAASHKH--------
PLSY_CUPTR       ---------------------------------------EKKKV----------------
PLSY_CUPNH       ---------------------------------------EKKKV----------------
PLSY_CUPMC       ---------------------------------------EKKKV----------------
PLSY_CUPPJ       ---------------------------------------EKKKV----------------
PLSY_RALPJ       ---------------------------------------EKKKAA---------------
PLSY_RALSO       ---------------------------------------EKKKPT---------------
PLSY_HERAR       ---------------------------------------SKKK-----------------
PLSY_JANMA       ---------------------------------------SKKK-----------------
PLSY_RHOFT       ---------------------------------------KKARTERKS------------
PLSY_CHRVO       ---------------------------------------NKGDAG---------------
PLSY_THIDA       ---------------------------------------KRS------------------
PLSY_NEIG1       ---------------------------------------EKR------------------
PLSY_NEIG2       ---------------------------------------EKR------------------
PLSY_NEIMA       ---------------------------------------EKR------------------
PLSY_NEIMF       ---------------------------------------EKR------------------
PLSY_NEIM0       ---------------------------------------GSR------------------
PLSY_NEIMB       ---------------------------------------GSR------------------
PLSY_METCA       ---------------------------------------AKRL-----------------
PLSY_THISH       ---------------------------------------NKTKNKSEV------------
PLSY_NITOC       ---------------------------------------KQN------------------
PLSY_HYDCU       ---------------------------------------KQPGASDPKE-----------
PLSY_HALHL       ---------------------------------------SSGS-----------------
PLSY_PSEA8       ------------------------------------------------------------
PLSY_PSEAB       ------------------------------------------------------------
PLSY_PSEAE       ------------------------------------------------------------
PLSY_PSEA7       ------------------------------------------------------------
PLSY_AZOVD       ------------------------------------------------------------
PLSY_PSE14       ------------------------------------------------------------
PLSY_PSEU2       ------------------------------------------------------------
PLSY_PSESM       ------------------------------------------------------------
PLSY_PSEFS       ------------------------------------------------------------
PLSY_PSEPF       ------------------------------------------------------------
PLSY_PSEF5       ------------------------------------------------------------
PLSY_PSEP1       ------------------------------------------------------------
PLSY_PSEPK       ------------------------------------------------------------
PLSY_PSEPG       ------------------------------------------------------------
PLSY_PSEPW       ------------------------------------------------------------
PLSY_PSEE4       ------------------------------------------------------------
PLSY_CHRSD       ---------------------------------------REERIKPPEE-----------
PLSY_HAHCH       ------------------------------------------------------------
PLSY_RHIE6       ------------------------------------------------------------
PLSY_RHIEC       ------------------------------------------------------------
PLSY1_RHIL3      ------------------------------------------------------------
PLSY_AGRFC       ------------------------------------------------------------
PLSY_RHIME       ------------------------------------------------------------
PLSY_SINMW       ------------------------------------------------------------
PLSY_SINFN       ------------------------------------------------------------
PLSY_AGRVS       ------------------------------------------------------------
PLSY_BRUA1       ------------------------------------------------------------
PLSY_BRUA2       ------------------------------------------------------------
PLSY_BRUAB       ------------------------------------------------------------
PLSY_BRUC2       ------------------------------------------------------------
PLSY_BRUSU       ------------------------------------------------------------
PLSY_BRUMB       ------------------------------------------------------------
PLSY_BRUME       ------------------------------------------------------------
PLSY_BRUO2       ------------------------------------------------------------
PLSY_BRUSI       ------------------------------------------------------------
PLSY_OCHA4       ------------------------------------------------------------
PLSY_RHILO       ------------------------------------------------------------
PLSY_BRASB       ------------------------------------------------------------
PLSY_BRASO       ------------------------------------------------------------
PLSY_BRADU       ------------------------------------------------------------
PLSY_RHOP2       ------------------------------------------------------------
PLSY_RHOPS       ------------------------------------------------------------
PLSY_RHOPA       ------------------------------------------------------------
PLSY_RHOPT       ------------------------------------------------------------
PLSY_RHOPB       ------------------------------------------------------------
PLSY_NITHX       ------------------------------------------------------------
PLSY_NITWN       ------------------------------------------------------------
PLSY_METC4       ------------------------------------------------------------
PLSY_METEP       ------------------------------------------------------------
PLSY_METPB       ------------------------------------------------------------
PLSY_CAUVN       EEAPPAPDAP--------------------------------------------------
PLSY_CAUVC       EEAPPAPDAP--------------------------------------------------
PLSY_RHOS1       ------------------------------------------------------------
PLSY_RHOS4       ------------------------------------------------------------
PLSY_RHOSK       ------------------------------------------------------------
PLSY_RHOS5       DQSAEQ------------------------------------------------------
PLSY_ROSDO       ------------------------------------------------------------
PLSY_RUEST       ------------------------------------------------------------
PLSY_RUEPO       ------------------------------------------------------------
PLSY_JANSC       ------------------------------------------------------------
PLSY_DINSH       ------------------------------------------------------------
PLSY_MAGSA       ESEG--------------------------------------------------------
PLSY_RHORT       AP----------------------------------------------------------
PLSY_MARMM       TSADVSDGDDPDTPAT--------------------------------------------
PLSY_HYPNA       APEA--------------------------------------------------------
PLSY_ERYLH       ------------------------------------------------------------
PLSY_NOVAD       ------------------------------------------------------------
PLSY_GLUOX       RR----------------------------------------------------------
PLSY_GRABC       ------------------------------------------------------------
PLSY_ZYMMO       ------------------------------------------------------------
PLSY_ANAD2       ------------------------------------------------------------
PLSY_ANASK       ------------------------------------------------------------
PLSY_ANADE       ------------------------------------------------------------
PLSY_ANADF       ------------------------------------------------------------
PLSY_MYXXD       ------------------------------------------------------------
PLSY_DEIGD       ------------------------------------------------------------
PLSY1_DEIRA      ------------------------------------------------------------
PLSY_THET2       R-----------------------------------------------------------
PLSY_THET8       R-----------------------------------------------------------
PLSY_RUBXD       GG----------------------------------------------------------
PLSY_ROSS1       ------------------------------------------------------------
PLSY1_DEHM1      WKRPDKNS----------------------------------------------------
PLSY1_DEHMC      WKRPDKG-----------------------------------------------------
PLSY2_DEHM1      FRKNLKERL---------------------------------------------------
PLSY2_DEHMC      FRRNLKERL---------------------------------------------------
PLSY5_DEHM1      LIFNRMFLDRDIRSRSVWINRNSAPAEESPNIL---------------------------
PLSY4_DEHMC      LVFNRMFLDRDIRSRSVWINRNTAAHKEGLGI----------------------------
PLSY4_DEHM1      ------------------------------------------------------------
PLSY1_MOOTA      ------------------------------------------------------------
PLSY1_DESHY      ------------------------------------------------------------
PLSY_NOSS1       ETEQSA------------------------------------------------------
PLSY_TRIV2       ETEQSA------------------------------------------------------
PLSY_TRIEI       EQKMNK------------------------------------------------------
PLSY_ACAM1       STDAT-------------------------------------------------------
PLSY2_RHIL3      ------------------------------------------------------------
PLSY_SYNJA       SP----------------------------------------------------------
PLSY_SYNJB       SP----------------------------------------------------------
PLSY_SYNE7       NR----------------------------------------------------------
PLSY_SYNP6       NR----------------------------------------------------------
PLSY_CROS5       EGS---------------------------------------------------------
PLSY_RIPO1       EAETV-------------------------------------------------------
PLSY_SYNY3       VPDRKGVA----------------------------------------------------
PLSY_THEEB       ------------------------------------------------------------
PLSY_GLOVI       ------------------------------------------------------------
PLSY_PROM2       ------------------------------------------------------------
PLSY_PROMS       ------------------------------------------------------------
PLSY_PROM0       ------------------------------------------------------------
PLSY_PROM9       ------------------------------------------------------------
PLSY_PROM5       ------------------------------------------------------------
PLSY_PROMP       ------------------------------------------------------------
PLSY_PROM1       ------------------------------------------------------------
PLSY_PROMT       ------------------------------------------------------------
PLSY_PROM4       ------------------------------------------------------------
PLSY_PROMA       ------------------------------------------------------------
PLSY_SYNPX       ------------------------------------------------------------
PLSY_SYNSC       ------------------------------------------------------------
PLSY_SYNS9       ------------------------------------------------------------
PLSY_PROMM       ------------------------------------------------------------
PLSY_DESRM       ------------------------------------------------------------
PLSY_DESAP       ------------------------------------------------------------
PLSY2_MOOTA      ------------------------------------------------------------
PLSY_CARHZ       ------------------------------------------------------------
PLSY_BACSU       ------------------------------------------------------------
PLSY_BACVZ       ------------------------------------------------------------
PLSY_BACLD       R-----------------------------------------------------------
PLSY_GEOKA       S-----------------------------------------------------------
PLSY_GEOSW       ------------------------------------------------------------
PLSY3_BACAN      K-----------------------------------------------------------
PLSY2_BACHK      K-----------------------------------------------------------
PLSY_BACC2       K-----------------------------------------------------------
PLSY2_BACCR      K-----------------------------------------------------------
PLSY2_BACCZ      K-----------------------------------------------------------
PLSY2_BACC1      K-----------------------------------------------------------
PLSY_BACCN       K-----------------------------------------------------------
PLSY2_OCEIH      ------------------------------------------------------------
PLSY_LISMC       ------------------------------------------------------------
PLSY_LISMF       ------------------------------------------------------------
PLSY_LISMH       ------------------------------------------------------------
PLSY_LISMO       ------------------------------------------------------------
PLSY_LISIN       ------------------------------------------------------------
PLSY_LISW6       ------------------------------------------------------------
PLSY2_BACAN      ------------------------------------------------------------
PLSY_EXIS2       KKDTD-------------------------------------------------------
PLSY_STRR6       THQDPKK-----------------------------------------------------
PLSY_STRZJ       THQDPKK-----------------------------------------------------
PLSY_STRZP       THQDPKK-----------------------------------------------------
PLSY_STRP2       THQDPKK-----------------------------------------------------
PLSY_STRPJ       THQDPKK-----------------------------------------------------
PLSY_STRP4       THQDPKK-----------------------------------------------------
PLSY_STRPN       THQDPKK-----------------------------------------------------
PLSY_STRP7       THQDPKK-----------------------------------------------------
PLSY_STRPI       THQDPKK-----------------------------------------------------
PLSY_STRPS       THQDPKK-----------------------------------------------------
PLSY_STRZT       THQDPKK-----------------------------------------------------
PLSY_STRGC       TKQVPKK-----------------------------------------------------
PLSY_STRSV       THQNPEAKK---------------------------------------------------
PLSY_LACLM       SRQKEK------------------------------------------------------
PLSY_LACLS       SGQKEK------------------------------------------------------
PLSY_LACLA       SKQKEK------------------------------------------------------
PLSY_STRA3       SKQK-NK-----------------------------------------------------
PLSY_STRA5       SKQK-NK-----------------------------------------------------
PLSY_STRA1       SKQK-NK-----------------------------------------------------
PLSY_STRT1       TKQNPNK-----------------------------------------------------
PLSY_STRT2       TKQNPNK-----------------------------------------------------
PLSY_STRTD       TKQNPKK-----------------------------------------------------
PLSY_STREM       SKQQPASHH---------------------------------------------------
PLSY_STRS7       SKQQPTNHH---------------------------------------------------
PLSY_STRE4       SKQQPASHH---------------------------------------------------
PLSY_STRPM       SKQVPKK-----------------------------------------------------
PLSY_STRPZ       SKQVPKK-----------------------------------------------------
PLSY_STRP6       SKQVPKK-----------------------------------------------------
PLSY_STRP8       SKQVPKK-----------------------------------------------------
PLSY_STRPB       SKQVPKK-----------------------------------------------------
PLSY_STRPC       SKQVPKK-----------------------------------------------------
PLSY_STRPD       SKQVPKK-----------------------------------------------------
PLSY_STRPF       SKQVPKK-----------------------------------------------------
PLSY_STRPG       SKQVPKK-----------------------------------------------------
PLSY_STRP1       SKQVPKK-----------------------------------------------------
PLSY_STRP3       SKQVPKK-----------------------------------------------------
PLSY_STRMU       TKQKTH------------------------------------------------------
PLSY_LACBA       HRRQAK------------------------------------------------------
PLSY_LACPL       RRQQRANRK---------------------------------------------------
PLSY_LACP3       YLRQHRGRS---------------------------------------------------
PLSY_LACCB       YLRQHRGRS---------------------------------------------------
PLSY_LACSS       RYKQKKRQ----------------------------------------------------
PLSY_LACRD       YLREKKQNK---------------------------------------------------
PLSY_LACRJ       YLREKKQNK---------------------------------------------------
PLSY_LACS1       RRRQKNTK----------------------------------------------------
PLSY_ENTFA       KKIKKKAVNK--------------------------------------------------
PLSY2_LACAC      WLKNKHTKSK--------------------------------------------------
PLSY2_LACJO      WYKKSHGLLKKNAKNK--------------------------------------------
PLSY_STAA1       ------------------------------------------------------------
PLSY_STAA2       ------------------------------------------------------------
PLSY_STAA9       ------------------------------------------------------------
PLSY_STAAW       ------------------------------------------------------------
PLSY_STAAM       ------------------------------------------------------------
PLSY_STAAN       ------------------------------------------------------------
PLSY_STAAR       ------------------------------------------------------------
PLSY_STAAS       ------------------------------------------------------------
PLSY_STAAB       ------------------------------------------------------------
PLSY_STAA3       ------------------------------------------------------------
PLSY_STAA8       ------------------------------------------------------------
PLSY_STAAT       ------------------------------------------------------------
PLSY_STAAC       ------------------------------------------------------------
PLSY_STAAE       ------------------------------------------------------------
PLSY_STAEQ       ------------------------------------------------------------
PLSY_STAES       ------------------------------------------------------------
PLSY_STAHJ       ------------------------------------------------------------
PLSY_STAS1       ------------------------------------------------------------
PLSY_STACT       ------------------------------------------------------------
PLSY_MACCJ       ------------------------------------------------------------
PLSY_PELLD       ------------------------------------------------------------
PLSY_CHLPM       ------------------------------------------------------------
PLSY_CHLL2       ------------------------------------------------------------
PLSY_PELPB       ------------------------------------------------------------
PLSY_CHLCH       ------------------------------------------------------------
PLSY_CHLPD       ------------------------------------------------------------
PLSY_CHLP8       ------------------------------------------------------------
PLSY_CHLTE       ------------------------------------------------------------
PLSY_CHLPB       ------------------------------------------------------------
PLSY_PROA2       ------------------------------------------------------------
PLSY_SALRD       QGMLGRGEL---------------------------------------------------
PLSY_THEP3       K-----------------------------------------------------------
PLSY_THEPX       K-----------------------------------------------------------
PLSY_CALS4       K-----------------------------------------------------------
PLSY_ALKMQ       ------------------------------------------------------------
PLSY_CLOD6       ------------------------------------------------------------
PLSY_FINM2       ------------------------------------------------------------
PLSY_SYNWW       ------------------------------------------------------------
PLSY2_DESHY      ------------------------------------------------------------
PLSY_SYMTH       RA----------------------------------------------------------
PLSY_BACHD       T-----------------------------------------------------------
PLSY_BACSK       ------------------------------------------------------------
PLSY3_DEHM1      ------------------------------------------------------------
PLSY3_DEHMC      ------------------------------------------------------------
PLSY_AQUAE       ------------------------------------------------------------
PLSY_HYDS0       ------------------------------------------------------------
PLSY1_BACAN      ------------------------------------------------------------
PLSY1_BACCZ      ------------------------------------------------------------
PLSY1_BACHK      ------------------------------------------------------------
PLSY1_BACC1      ------------------------------------------------------------
PLSY1_BACCR      ------------------------------------------------------------
PLSY1_LACAC      ------------------------------------------------------------
PLSY1_LACJO      ------------------------------------------------------------
PLSY_MYCCT       NIKRIKNKTEPDTFPRKKQAIKN-------------------------------------
PLSY_MYCMS       NIKRIKNKTEPDTFPKKVKPVR--------------------------------------
PLSY_MESFL       NIVKLKNKTEQPIYPKKEKNV---------------------------------------
PLSY_MYCAP       ------------------------------------------------------------
PLSY_MYCS5       ------------------------------------------------------------
PLSY_MYCMO       KKLA--------------------------------------------------------
PLSY_MYCPU       K-----------------------------------------------------------
PLSY_UREP2       KDNLSDVNK---------------------------------------------------
PLSY_UREPA       KDNLSDVNK---------------------------------------------------
PLSY_UREU1       KNNI--------------------------------------------------------
PLSY_MYCGE       ------------------------------------------------------------
PLSY_MYCPN       ------------------------------------------------------------
PLSY_MYCGA       ------------------------------------------------------------
PLSY_PSELT       KKRG--------------------------------------------------------
PLSY_THEM4       FGKGKKN-----------------------------------------------------
PLSY_KOSOT       TKRNKNKKEG--------------------------------------------------
PLSY2_THEMA      ------------------------------------------------------------
PLSY_THEP1       ------------------------------------------------------------
PLSY_ANAMF       ------------------------------------------------------------
PLSY_ANAMM       ------------------------------------------------------------
PLSY_ANAPZ       ------------------------------------------------------------
PLSY_EHRCJ       ------------------------------------------------------------
PLSY_EHRCR       ------------------------------------------------------------
PLSY_EHRRG       ------------------------------------------------------------
PLSY_EHRRW       ------------------------------------------------------------
PLSY_BARHE       K-----------------------------------------------------------
PLSY_BARQU       K-----------------------------------------------------------
PLSY_BART1       K-----------------------------------------------------------
PLSY_BARBK       G-----------------------------------------------------------
PLSY_PELUB       ------------------------------------------------------------
PLSY_WOLPM       ------------------------------------------------------------
PLSY_WOLPP       ------------------------------------------------------------
PLSY_WOLTR       ------------------------------------------------------------
PLSY_ARCB4       ------------------------------------------------------------
PLSY_SULDN       ------------------------------------------------------------
PLSY_WOLSU       ------------------------------------------------------------
PLSY_NITSB       ------------------------------------------------------------
PLSY_CAMJ8       ------------------------------------------------------------
PLSY_CAMJJ       ------------------------------------------------------------
PLSY_CAMJE       ------------------------------------------------------------
PLSY_CAMJR       ------------------------------------------------------------
PLSY_CAMJD       ------------------------------------------------------------
PLSY_CAMLR       ------------------------------------------------------------
PLSY_CAMC1       ------------------------------------------------------------
PLSY_HELPH       ------------------------------------------------------------
PLSY_HELPJ       ------------------------------------------------------------
PLSY_HELPY       ------------------------------------------------------------
PLSY_HELAH       ------------------------------------------------------------
PLSY_HELHP       ------------------------------------------------------------
PLSY_MYCPE       TH----------------------------------------------------------
PLSY_NEOSM       ------------------------------------------------------------
PLSY1_OCEIH      KAS---------------------------------------------------------
PLSY1_THEMA      ------------------------------------------------------------
PLSY2_DEIRA      ------------------------------------------------------------
                                                                             

PLSY_AYWBP       ------------------------------------------------------------
PLSY_ONYPE       ------------------------------------------------------------
PLSY_PHYAS       ------------------------------------------------------------
PLSY_ACHLA       ------------------------------------------------------------
PLSY_CLOAB       ------------------------------------------------------------
PLSY_GEOMG       ------------------------------------------------------------
PLSY_GEOSL       ------------------------------------------------------------
PLSY_GEODF       ------------------------------------------------------------
PLSY_GEOLS       ------------------------------------------------------------
PLSY_PELCD       ------------------------------------------------------------
PLSY_KORVE       ------------------------------------------------------------
PLSY_FUSNN       ------------------------------------------------------------
PLSY_UNCTG       ------------------------------------------------------------
PLSY_DESAD       ------------------------------------------------------------
PLSY_DESMR       ------------------------------------------------------------
PLSY_DESAG       ------------------------------------------------------------
PLSY_DESVH       DEGDKRENEEHDNAPEASAAESKPEDKPAGKTVGKPASRSVAKPASKSAGKTGGKAADKS
PLSY_DESDA       ------------------------------------------------------------
PLSY_LAWIP       ------------------------------------------------------------
PLSY_LEPBJ       ------------------------------------------------------------
PLSY_LEPBL       ------------------------------------------------------------
PLSY_LEPIC       ------------------------------------------------------------
PLSY_LEPIN       ------------------------------------------------------------
PLSY_DESPS       ------------------------------------------------------------
PLSY_ECOLI       ------------------------------------------------------------
PLSY_SHIB3       ------------------------------------------------------------
PLSY_SHISS       ------------------------------------------------------------
PLSY_SHIBS       ------------------------------------------------------------
PLSY_SHIDS       ------------------------------------------------------------
PLSY_ECO24       ------------------------------------------------------------
PLSY_ECO27       ------------------------------------------------------------
PLSY_ECO45       ------------------------------------------------------------
PLSY_ECO55       ------------------------------------------------------------
PLSY_ECO57       ------------------------------------------------------------
PLSY_ECO5E       ------------------------------------------------------------
PLSY_ECO7I       ------------------------------------------------------------
PLSY_ECO81       ------------------------------------------------------------
PLSY_ECO8A       ------------------------------------------------------------
PLSY_ECOBW       ------------------------------------------------------------
PLSY_ECODH       ------------------------------------------------------------
PLSY_ECOHS       ------------------------------------------------------------
PLSY_ECOK1       ------------------------------------------------------------
PLSY_ECOL5       ------------------------------------------------------------
PLSY_ECOL6       ------------------------------------------------------------
PLSY_ECOLC       ------------------------------------------------------------
PLSY_ECOLU       ------------------------------------------------------------
PLSY_ECOSE       ------------------------------------------------------------
PLSY_ECOSM       ------------------------------------------------------------
PLSY_ECOUT       ------------------------------------------------------------
PLSY_SHIF8       ------------------------------------------------------------
PLSY_SHIFL       ------------------------------------------------------------
PLSY_ESCF3       ------------------------------------------------------------
PLSY_SALSV       ------------------------------------------------------------
PLSY_SALTI       ------------------------------------------------------------
PLSY_SALTY       ------------------------------------------------------------
PLSY_SALA4       ------------------------------------------------------------
PLSY_SALCH       ------------------------------------------------------------
PLSY_SALDC       ------------------------------------------------------------
PLSY_SALEP       ------------------------------------------------------------
PLSY_SALG2       ------------------------------------------------------------
PLSY_SALHS       ------------------------------------------------------------
PLSY_SALNS       ------------------------------------------------------------
PLSY_SALPA       ------------------------------------------------------------
PLSY_SALPB       ------------------------------------------------------------
PLSY_SALPK       ------------------------------------------------------------
PLSY_CITK8       ------------------------------------------------------------
PLSY_SALAR       ------------------------------------------------------------
PLSY_ENT38       ------------------------------------------------------------
PLSY_CROS8       ------------------------------------------------------------
PLSY_KLEP3       ------------------------------------------------------------
PLSY_KLEP7       ------------------------------------------------------------
PLSY_PECAS       ------------------------------------------------------------
PLSY_PECCP       ------------------------------------------------------------
PLSY_YERP3       ED----------------------------------------------------------
PLSY_YERPA       ED----------------------------------------------------------
PLSY_YERPB       ED----------------------------------------------------------
PLSY_YERPE       ED----------------------------------------------------------
PLSY_YERPN       ED----------------------------------------------------------
PLSY_YERPP       ED----------------------------------------------------------
PLSY_YERPS       ED----------------------------------------------------------
PLSY_YERPY       ED----------------------------------------------------------
PLSY_YERE8       EED---------------------------------------------------------
PLSY_SERP5       KEE---------------------------------------------------------
PLSY_ERWT9       ------------------------------------------------------------
PLSY_EDWI9       DDEPQTPR----------------------------------------------------
PLSY_PHOLL       RKED--------------------------------------------------------
PLSY_PROMH       EKED--------------------------------------------------------
PLSY_SODGM       SKH---------------------------------------------------------
PLSY_HAEI8       ------------------------------------------------------------
PLSY_HAEIG       ------------------------------------------------------------
PLSY_HAEIN       ------------------------------------------------------------
PLSY_HAEIE       ------------------------------------------------------------
PLSY_PASMU       ------------------------------------------------------------
PLSY_ACTSZ       ------------------------------------------------------------
PLSY_MANSM       ------------------------------------------------------------
PLSY_HAES1       ------------------------------------------------------------
PLSY_ACTP2       ------------------------------------------------------------
PLSY_ACTP7       ------------------------------------------------------------
PLSY_ACTPJ       ------------------------------------------------------------
PLSY_HAEDU       ------------------------------------------------------------
PLSY_HAEPS       ------------------------------------------------------------
PLSY_AERS4       DERDKK------------------------------------------------------
PLSY_TOLAT       ------------------------------------------------------------
PLSY_ALIF1       ------------------------------------------------------------
PLSY_ALIFM       ------------------------------------------------------------
PLSY_ALISL       ------------------------------------------------------------
PLSY_PHOPR       ------------------------------------------------------------
PLSY_VIBC3       ------------------------------------------------------------
PLSY_VIBCH       ------------------------------------------------------------
PLSY_VIBCM       ------------------------------------------------------------
PLSY_VIBCB       ------------------------------------------------------------
PLSY_VIBPA       ------------------------------------------------------------
PLSY_VIBTL       ------------------------------------------------------------
PLSY_VIBVU       ------------------------------------------------------------
PLSY_VIBVY       ------------------------------------------------------------
PLSY_IDILO       ------------------------------------------------------------
PLSY_PSEA6       ------------------------------------------------------------
PLSY_COLP3       ------------------------------------------------------------
PLSY_PSEHT       ------------------------------------------------------------
PLSY_SHEB2       ------------------------------------------------------------
PLSY_SHEB5       ------------------------------------------------------------
PLSY_SHEB8       ------------------------------------------------------------
PLSY_SHEB9       ------------------------------------------------------------
PLSY_SHESA       ------------------------------------------------------------
PLSY_SHESR       ------------------------------------------------------------
PLSY_SHESM       ------------------------------------------------------------
PLSY_SHEON       ------------------------------------------------------------
PLSY_SHEPC       ------------------------------------------------------------
PLSY_SHESW       ------------------------------------------------------------
PLSY_SHEHH       ------------------------------------------------------------
PLSY_SHESH       ------------------------------------------------------------
PLSY_SHEWM       ------------------------------------------------------------
PLSY_SHELP       ------------------------------------------------------------
PLSY_SHEDO       ------------------------------------------------------------
PLSY_BLOFL       ------------------------------------------------------------
PLSY_BLOPB       ------------------------------------------------------------
PLSY_COXB1       ------------------------------------------------------------
PLSY_COXBU       ------------------------------------------------------------
PLSY_COXBN       ------------------------------------------------------------
PLSY_COXBR       ------------------------------------------------------------
PLSY_COXB2       ------------------------------------------------------------
PLSY_FRAT1       ------------------------------------------------------------
PLSY_FRATT       ------------------------------------------------------------
PLSY_FRATF       ------------------------------------------------------------
PLSY_FRATH       ------------------------------------------------------------
PLSY_FRATN       ------------------------------------------------------------
PLSY_FRATO       ------------------------------------------------------------
PLSY_FRATM       ------------------------------------------------------------
PLSY_FRAP2       ------------------------------------------------------------
PLSY_LEGPC       TKKPKSTKPKTKTVKEKE------------------------------------------
PLSY_LEGPH       TKKPKSTKPKTKTVKEKE------------------------------------------
PLSY_LEGPA       TKKPRSTKPKTKTVKEKE------------------------------------------
PLSY_LEGPL       AKKPKSTKPKTKTVKEKE------------------------------------------
PLSY_RUTMC       ------------------------------------------------------------
PLSY_AROAE       ------------------------------------------------------------
PLSY_LARHH       ------------------------------------------------------------
PLSY_DECAR       ------------------------------------------------------------
PLSY_NITEC       ------------------------------------------------------------
PLSY_NITEU       ------------------------------------------------------------
PLSY_NITMU       ------------------------------------------------------------
PLSY_METFK       ------------------------------------------------------------
PLSY_BORBR       ------------------------------------------------------------
PLSY_BORPE       ------------------------------------------------------------
PLSY_BORPA       ------------------------------------------------------------
PLSY_BORPD       ------------------------------------------------------------
PLSY_BORA1       ------------------------------------------------------------
PLSY_BURA4       ------------------------------------------------------------
PLSY_BURCM       ------------------------------------------------------------
PLSY_BURL3       ------------------------------------------------------------
PLSY_BURVG       ------------------------------------------------------------
PLSY_BURCA       ------------------------------------------------------------
PLSY_BURCH       ------------------------------------------------------------
PLSY_BURCJ       ------------------------------------------------------------
PLSY_BURCC       ------------------------------------------------------------
PLSY_BURM1       ------------------------------------------------------------
PLSY_BURP1       ------------------------------------------------------------
PLSY_BURPS       ------------------------------------------------------------
PLSY_BURMA       ------------------------------------------------------------
PLSY_BURTA       ------------------------------------------------------------
PLSY_PARPJ       ------------------------------------------------------------
PLSY_PARXL       ------------------------------------------------------------
PLSY_PARP8       ------------------------------------------------------------
PLSY_CUPTR       ------------------------------------------------------------
PLSY_CUPNH       ------------------------------------------------------------
PLSY_CUPMC       ------------------------------------------------------------
PLSY_CUPPJ       ------------------------------------------------------------
PLSY_RALPJ       ------------------------------------------------------------
PLSY_RALSO       ------------------------------------------------------------
PLSY_HERAR       ------------------------------------------------------------
PLSY_JANMA       ------------------------------------------------------------
PLSY_RHOFT       ------------------------------------------------------------
PLSY_CHRVO       ------------------------------------------------------------
PLSY_THIDA       ------------------------------------------------------------
PLSY_NEIG1       ------------------------------------------------------------
PLSY_NEIG2       ------------------------------------------------------------
PLSY_NEIMA       ------------------------------------------------------------
PLSY_NEIMF       ------------------------------------------------------------
PLSY_NEIM0       ------------------------------------------------------------
PLSY_NEIMB       ------------------------------------------------------------
PLSY_METCA       ------------------------------------------------------------
PLSY_THISH       ------------------------------------------------------------
PLSY_NITOC       ------------------------------------------------------------
PLSY_HYDCU       ------------------------------------------------------------
PLSY_HALHL       ------------------------------------------------------------
PLSY_PSEA8       ------------------------------------------------------------
PLSY_PSEAB       ------------------------------------------------------------
PLSY_PSEAE       ------------------------------------------------------------
PLSY_PSEA7       ------------------------------------------------------------
PLSY_AZOVD       ------------------------------------------------------------
PLSY_PSE14       ------------------------------------------------------------
PLSY_PSEU2       ------------------------------------------------------------
PLSY_PSESM       ------------------------------------------------------------
PLSY_PSEFS       ------------------------------------------------------------
PLSY_PSEPF       ------------------------------------------------------------
PLSY_PSEF5       ------------------------------------------------------------
PLSY_PSEP1       ------------------------------------------------------------
PLSY_PSEPK       ------------------------------------------------------------
PLSY_PSEPG       ------------------------------------------------------------
PLSY_PSEPW       ------------------------------------------------------------
PLSY_PSEE4       ------------------------------------------------------------
PLSY_CHRSD       ------------------------------------------------------------
PLSY_HAHCH       ------------------------------------------------------------
PLSY_RHIE6       ------------------------------------------------------------
PLSY_RHIEC       ------------------------------------------------------------
PLSY1_RHIL3      ------------------------------------------------------------
PLSY_AGRFC       ------------------------------------------------------------
PLSY_RHIME       ------------------------------------------------------------
PLSY_SINMW       ------------------------------------------------------------
PLSY_SINFN       ------------------------------------------------------------
PLSY_AGRVS       ------------------------------------------------------------
PLSY_BRUA1       ------------------------------------------------------------
PLSY_BRUA2       ------------------------------------------------------------
PLSY_BRUAB       ------------------------------------------------------------
PLSY_BRUC2       ------------------------------------------------------------
PLSY_BRUSU       ------------------------------------------------------------
PLSY_BRUMB       ------------------------------------------------------------
PLSY_BRUME       ------------------------------------------------------------
PLSY_BRUO2       ------------------------------------------------------------
PLSY_BRUSI       ------------------------------------------------------------
PLSY_OCHA4       ------------------------------------------------------------
PLSY_RHILO       ------------------------------------------------------------
PLSY_BRASB       ------------------------------------------------------------
PLSY_BRASO       ------------------------------------------------------------
PLSY_BRADU       ------------------------------------------------------------
PLSY_RHOP2       ------------------------------------------------------------
PLSY_RHOPS       ------------------------------------------------------------
PLSY_RHOPA       ------------------------------------------------------------
PLSY_RHOPT       ------------------------------------------------------------
PLSY_RHOPB       ------------------------------------------------------------
PLSY_NITHX       ------------------------------------------------------------
PLSY_NITWN       ------------------------------------------------------------
PLSY_METC4       ------------------------------------------------------------
PLSY_METEP       ------------------------------------------------------------
PLSY_METPB       ------------------------------------------------------------
PLSY_CAUVN       ------------------------------------------------------------
PLSY_CAUVC       ------------------------------------------------------------
PLSY_RHOS1       ------------------------------------------------------------
PLSY_RHOS4       ------------------------------------------------------------
PLSY_RHOSK       ------------------------------------------------------------
PLSY_RHOS5       ------------------------------------------------------------
PLSY_ROSDO       ------------------------------------------------------------
PLSY_RUEST       ------------------------------------------------------------
PLSY_RUEPO       ------------------------------------------------------------
PLSY_JANSC       ------------------------------------------------------------
PLSY_DINSH       ------------------------------------------------------------
PLSY_MAGSA       ------------------------------------------------------------
PLSY_RHORT       ------------------------------------------------------------
PLSY_MARMM       ------------------------------------------------------------
PLSY_HYPNA       ------------------------------------------------------------
PLSY_ERYLH       ------------------------------------------------------------
PLSY_NOVAD       ------------------------------------------------------------
PLSY_GLUOX       ------------------------------------------------------------
PLSY_GRABC       ------------------------------------------------------------
PLSY_ZYMMO       ------------------------------------------------------------
PLSY_ANAD2       ------------------------------------------------------------
PLSY_ANASK       ------------------------------------------------------------
PLSY_ANADE       ------------------------------------------------------------
PLSY_ANADF       ------------------------------------------------------------
PLSY_MYXXD       ------------------------------------------------------------
PLSY_DEIGD       ------------------------------------------------------------
PLSY1_DEIRA      ------------------------------------------------------------
PLSY_THET2       ------------------------------------------------------------
PLSY_THET8       ------------------------------------------------------------
PLSY_RUBXD       ------------------------------------------------------------
PLSY_ROSS1       ------------------------------------------------------------
PLSY1_DEHM1      ------------------------------------------------------------
PLSY1_DEHMC      ------------------------------------------------------------
PLSY2_DEHM1      ------------------------------------------------------------
PLSY2_DEHMC      ------------------------------------------------------------
PLSY5_DEHM1      ------------------------------------------------------------
PLSY4_DEHMC      ------------------------------------------------------------
PLSY4_DEHM1      ------------------------------------------------------------
PLSY1_MOOTA      ------------------------------------------------------------
PLSY1_DESHY      ------------------------------------------------------------
PLSY_NOSS1       ------------------------------------------------------------
PLSY_TRIV2       ------------------------------------------------------------
PLSY_TRIEI       ------------------------------------------------------------
PLSY_ACAM1       ------------------------------------------------------------
PLSY2_RHIL3      ------------------------------------------------------------
PLSY_SYNJA       ------------------------------------------------------------
PLSY_SYNJB       ------------------------------------------------------------
PLSY_SYNE7       ------------------------------------------------------------
PLSY_SYNP6       ------------------------------------------------------------
PLSY_CROS5       ------------------------------------------------------------
PLSY_RIPO1       ------------------------------------------------------------
PLSY_SYNY3       ------------------------------------------------------------
PLSY_THEEB       ------------------------------------------------------------
PLSY_GLOVI       ------------------------------------------------------------
PLSY_PROM2       ------------------------------------------------------------
PLSY_PROMS       ------------------------------------------------------------
PLSY_PROM0       ------------------------------------------------------------
PLSY_PROM9       ------------------------------------------------------------
PLSY_PROM5       ------------------------------------------------------------
PLSY_PROMP       ------------------------------------------------------------
PLSY_PROM1       ------------------------------------------------------------
PLSY_PROMT       ------------------------------------------------------------
PLSY_PROM4       ------------------------------------------------------------
PLSY_PROMA       ------------------------------------------------------------
PLSY_SYNPX       ------------------------------------------------------------
PLSY_SYNSC       ------------------------------------------------------------
PLSY_SYNS9       ------------------------------------------------------------
PLSY_PROMM       ------------------------------------------------------------
PLSY_DESRM       ------------------------------------------------------------
PLSY_DESAP       ------------------------------------------------------------
PLSY2_MOOTA      ------------------------------------------------------------
PLSY_CARHZ       ------------------------------------------------------------
PLSY_BACSU       ------------------------------------------------------------
PLSY_BACVZ       ------------------------------------------------------------
PLSY_BACLD       ------------------------------------------------------------
PLSY_GEOKA       ------------------------------------------------------------
PLSY_GEOSW       ------------------------------------------------------------
PLSY3_BACAN      ------------------------------------------------------------
PLSY2_BACHK      ------------------------------------------------------------
PLSY_BACC2       ------------------------------------------------------------
PLSY2_BACCR      ------------------------------------------------------------
PLSY2_BACCZ      ------------------------------------------------------------
PLSY2_BACC1      ------------------------------------------------------------
PLSY_BACCN       ------------------------------------------------------------
PLSY2_OCEIH      ------------------------------------------------------------
PLSY_LISMC       ------------------------------------------------------------
PLSY_LISMF       ------------------------------------------------------------
PLSY_LISMH       ------------------------------------------------------------
PLSY_LISMO       ------------------------------------------------------------
PLSY_LISIN       ------------------------------------------------------------
PLSY_LISW6       ------------------------------------------------------------
PLSY2_BACAN      ------------------------------------------------------------
PLSY_EXIS2       ------------------------------------------------------------
PLSY_STRR6       ------------------------------------------------------------
PLSY_STRZJ       ------------------------------------------------------------
PLSY_STRZP       ------------------------------------------------------------
PLSY_STRP2       ------------------------------------------------------------
PLSY_STRPJ       ------------------------------------------------------------
PLSY_STRP4       ------------------------------------------------------------
PLSY_STRPN       ------------------------------------------------------------
PLSY_STRP7       ------------------------------------------------------------
PLSY_STRPI       ------------------------------------------------------------
PLSY_STRPS       ------------------------------------------------------------
PLSY_STRZT       ------------------------------------------------------------
PLSY_STRGC       ------------------------------------------------------------
PLSY_STRSV       ------------------------------------------------------------
PLSY_LACLM       ------------------------------------------------------------
PLSY_LACLS       ------------------------------------------------------------
PLSY_LACLA       ------------------------------------------------------------
PLSY_STRA3       ------------------------------------------------------------
PLSY_STRA5       ------------------------------------------------------------
PLSY_STRA1       ------------------------------------------------------------
PLSY_STRT1       ------------------------------------------------------------
PLSY_STRT2       ------------------------------------------------------------
PLSY_STRTD       ------------------------------------------------------------
PLSY_STREM       ------------------------------------------------------------
PLSY_STRS7       ------------------------------------------------------------
PLSY_STRE4       ------------------------------------------------------------
PLSY_STRPM       ------------------------------------------------------------
PLSY_STRPZ       ------------------------------------------------------------
PLSY_STRP6       ------------------------------------------------------------
PLSY_STRP8       ------------------------------------------------------------
PLSY_STRPB       ------------------------------------------------------------
PLSY_STRPC       ------------------------------------------------------------
PLSY_STRPD       ------------------------------------------------------------
PLSY_STRPF       ------------------------------------------------------------
PLSY_STRPG       ------------------------------------------------------------
PLSY_STRP1       ------------------------------------------------------------
PLSY_STRP3       ------------------------------------------------------------
PLSY_STRMU       ------------------------------------------------------------
PLSY_LACBA       ------------------------------------------------------------
PLSY_LACPL       ------------------------------------------------------------
PLSY_LACP3       ------------------------------------------------------------
PLSY_LACCB       ------------------------------------------------------------
PLSY_LACSS       ------------------------------------------------------------
PLSY_LACRD       ------------------------------------------------------------
PLSY_LACRJ       ------------------------------------------------------------
PLSY_LACS1       ------------------------------------------------------------
PLSY_ENTFA       ------------------------------------------------------------
PLSY2_LACAC      ------------------------------------------------------------
PLSY2_LACJO      ------------------------------------------------------------
PLSY_STAA1       ------------------------------------------------------------
PLSY_STAA2       ------------------------------------------------------------
PLSY_STAA9       ------------------------------------------------------------
PLSY_STAAW       ------------------------------------------------------------
PLSY_STAAM       ------------------------------------------------------------
PLSY_STAAN       ------------------------------------------------------------
PLSY_STAAR       ------------------------------------------------------------
PLSY_STAAS       ------------------------------------------------------------
PLSY_STAAB       ------------------------------------------------------------
PLSY_STAA3       ------------------------------------------------------------
PLSY_STAA8       ------------------------------------------------------------
PLSY_STAAT       ------------------------------------------------------------
PLSY_STAAC       ------------------------------------------------------------
PLSY_STAAE       ------------------------------------------------------------
PLSY_STAEQ       ------------------------------------------------------------
PLSY_STAES       ------------------------------------------------------------
PLSY_STAHJ       ------------------------------------------------------------
PLSY_STAS1       ------------------------------------------------------------
PLSY_STACT       ------------------------------------------------------------
PLSY_MACCJ       ------------------------------------------------------------
PLSY_PELLD       ------------------------------------------------------------
PLSY_CHLPM       ------------------------------------------------------------
PLSY_CHLL2       ------------------------------------------------------------
PLSY_PELPB       ------------------------------------------------------------
PLSY_CHLCH       ------------------------------------------------------------
PLSY_CHLPD       ------------------------------------------------------------
PLSY_CHLP8       ------------------------------------------------------------
PLSY_CHLTE       ------------------------------------------------------------
PLSY_CHLPB       ------------------------------------------------------------
PLSY_PROA2       ------------------------------------------------------------
PLSY_SALRD       ------------------------------------------------------------
PLSY_THEP3       ------------------------------------------------------------
PLSY_THEPX       ------------------------------------------------------------
PLSY_CALS4       ------------------------------------------------------------
PLSY_ALKMQ       ------------------------------------------------------------
PLSY_CLOD6       ------------------------------------------------------------
PLSY_FINM2       ------------------------------------------------------------
PLSY_SYNWW       ------------------------------------------------------------
PLSY2_DESHY      ------------------------------------------------------------
PLSY_SYMTH       ------------------------------------------------------------
PLSY_BACHD       ------------------------------------------------------------
PLSY_BACSK       ------------------------------------------------------------
PLSY3_DEHM1      ------------------------------------------------------------
PLSY3_DEHMC      ------------------------------------------------------------
PLSY_AQUAE       ------------------------------------------------------------
PLSY_HYDS0       ------------------------------------------------------------
PLSY1_BACAN      ------------------------------------------------------------
PLSY1_BACCZ      ------------------------------------------------------------
PLSY1_BACHK      ------------------------------------------------------------
PLSY1_BACC1      ------------------------------------------------------------
PLSY1_BACCR      ------------------------------------------------------------
PLSY1_LACAC      ------------------------------------------------------------
PLSY1_LACJO      ------------------------------------------------------------
PLSY_MYCCT       ------------------------------------------------------------
PLSY_MYCMS       ------------------------------------------------------------
PLSY_MESFL       ------------------------------------------------------------
PLSY_MYCAP       ------------------------------------------------------------
PLSY_MYCS5       ------------------------------------------------------------
PLSY_MYCMO       ------------------------------------------------------------
PLSY_MYCPU       ------------------------------------------------------------
PLSY_UREP2       ------------------------------------------------------------
PLSY_UREPA       ------------------------------------------------------------
PLSY_UREU1       ------------------------------------------------------------
PLSY_MYCGE       ------------------------------------------------------------
PLSY_MYCPN       ------------------------------------------------------------
PLSY_MYCGA       ------------------------------------------------------------
PLSY_PSELT       ------------------------------------------------------------
PLSY_THEM4       ------------------------------------------------------------
PLSY_KOSOT       ------------------------------------------------------------
PLSY2_THEMA      ------------------------------------------------------------
PLSY_THEP1       ------------------------------------------------------------
PLSY_ANAMF       ------------------------------------------------------------
PLSY_ANAMM       ------------------------------------------------------------
PLSY_ANAPZ       ------------------------------------------------------------
PLSY_EHRCJ       ------------------------------------------------------------
PLSY_EHRCR       ------------------------------------------------------------
PLSY_EHRRG       ------------------------------------------------------------
PLSY_EHRRW       ------------------------------------------------------------
PLSY_BARHE       ------------------------------------------------------------
PLSY_BARQU       ------------------------------------------------------------
PLSY_BART1       ------------------------------------------------------------
PLSY_BARBK       ------------------------------------------------------------
PLSY_PELUB       ------------------------------------------------------------
PLSY_WOLPM       ------------------------------------------------------------
PLSY_WOLPP       ------------------------------------------------------------
PLSY_WOLTR       ------------------------------------------------------------
PLSY_ARCB4       ------------------------------------------------------------
PLSY_SULDN       ------------------------------------------------------------
PLSY_WOLSU       ------------------------------------------------------------
PLSY_NITSB       ------------------------------------------------------------
PLSY_CAMJ8       ------------------------------------------------------------
PLSY_CAMJJ       ------------------------------------------------------------
PLSY_CAMJE       ------------------------------------------------------------
PLSY_CAMJR       ------------------------------------------------------------
PLSY_CAMJD       ------------------------------------------------------------
PLSY_CAMLR       ------------------------------------------------------------
PLSY_CAMC1       ------------------------------------------------------------
PLSY_HELPH       ------------------------------------------------------------
PLSY_HELPJ       ------------------------------------------------------------
PLSY_HELPY       ------------------------------------------------------------
PLSY_HELAH       ------------------------------------------------------------
PLSY_HELHP       ------------------------------------------------------------
PLSY_MYCPE       ------------------------------------------------------------
PLSY_NEOSM       ------------------------------------------------------------
PLSY1_OCEIH      ------------------------------------------------------------
PLSY1_THEMA      ------------------------------------------------------------
PLSY2_DEIRA      ------------------------------------------------------------
                                                                             

PLSY_AYWBP       ----------
PLSY_ONYPE       ----------
PLSY_PHYAS       ----------
PLSY_ACHLA       ----------
PLSY_CLOAB       ----------
PLSY_GEOMG       ----------
PLSY_GEOSL       ----------
PLSY_GEODF       ----------
PLSY_GEOLS       ----------
PLSY_PELCD       ----------
PLSY_KORVE       ----------
PLSY_FUSNN       ----------
PLSY_UNCTG       ----------
PLSY_DESAD       ----------
PLSY_DESMR       ----------
PLSY_DESAG       ----------
PLSY_DESVH       AGKSGKSSGQ
PLSY_DESDA       ----------
PLSY_LAWIP       ----------
PLSY_LEPBJ       ----------
PLSY_LEPBL       ----------
PLSY_LEPIC       ----------
PLSY_LEPIN       ----------
PLSY_DESPS       ----------
PLSY_ECOLI       ----------
PLSY_SHIB3       ----------
PLSY_SHISS       ----------
PLSY_SHIBS       ----------
PLSY_SHIDS       ----------
PLSY_ECO24       ----------
PLSY_ECO27       ----------
PLSY_ECO45       ----------
PLSY_ECO55       ----------
PLSY_ECO57       ----------
PLSY_ECO5E       ----------
PLSY_ECO7I       ----------
PLSY_ECO81       ----------
PLSY_ECO8A       ----------
PLSY_ECOBW       ----------
PLSY_ECODH       ----------
PLSY_ECOHS       ----------
PLSY_ECOK1       ----------
PLSY_ECOL5       ----------
PLSY_ECOL6       ----------
PLSY_ECOLC       ----------
PLSY_ECOLU       ----------
PLSY_ECOSE       ----------
PLSY_ECOSM       ----------
PLSY_ECOUT       ----------
PLSY_SHIF8       ----------
PLSY_SHIFL       ----------
PLSY_ESCF3       ----------
PLSY_SALSV       ----------
PLSY_SALTI       ----------
PLSY_SALTY       ----------
PLSY_SALA4       ----------
PLSY_SALCH       ----------
PLSY_SALDC       ----------
PLSY_SALEP       ----------
PLSY_SALG2       ----------
PLSY_SALHS       ----------
PLSY_SALNS       ----------
PLSY_SALPA       ----------
PLSY_SALPB       ----------
PLSY_SALPK       ----------
PLSY_CITK8       ----------
PLSY_SALAR       ----------
PLSY_ENT38       ----------
PLSY_CROS8       ----------
PLSY_KLEP3       ----------
PLSY_KLEP7       ----------
PLSY_PECAS       ----------
PLSY_PECCP       ----------
PLSY_YERP3       ----------
PLSY_YERPA       ----------
PLSY_YERPB       ----------
PLSY_YERPE       ----------
PLSY_YERPN       ----------
PLSY_YERPP       ----------
PLSY_YERPS       ----------
PLSY_YERPY       ----------
PLSY_YERE8       ----------
PLSY_SERP5       ----------
PLSY_ERWT9       ----------
PLSY_EDWI9       ----------
PLSY_PHOLL       ----------
PLSY_PROMH       ----------
PLSY_SODGM       ----------
PLSY_HAEI8       ----------
PLSY_HAEIG       ----------
PLSY_HAEIN       ----------
PLSY_HAEIE       ----------
PLSY_PASMU       ----------
PLSY_ACTSZ       ----------
PLSY_MANSM       ----------
PLSY_HAES1       ----------
PLSY_ACTP2       ----------
PLSY_ACTP7       ----------
PLSY_ACTPJ       ----------
PLSY_HAEDU       ----------
PLSY_HAEPS       ----------
PLSY_AERS4       ----------
PLSY_TOLAT       ----------
PLSY_ALIF1       ----------
PLSY_ALIFM       ----------
PLSY_ALISL       ----------
PLSY_PHOPR       ----------
PLSY_VIBC3       ----------
PLSY_VIBCH       ----------
PLSY_VIBCM       ----------
PLSY_VIBCB       ----------
PLSY_VIBPA       ----------
PLSY_VIBTL       ----------
PLSY_VIBVU       ----------
PLSY_VIBVY       ----------
PLSY_IDILO       ----------
PLSY_PSEA6       ----------
PLSY_COLP3       ----------
PLSY_PSEHT       ----------
PLSY_SHEB2       ----------
PLSY_SHEB5       ----------
PLSY_SHEB8       ----------
PLSY_SHEB9       ----------
PLSY_SHESA       ----------
PLSY_SHESR       ----------
PLSY_SHESM       ----------
PLSY_SHEON       ----------
PLSY_SHEPC       ----------
PLSY_SHESW       ----------
PLSY_SHEHH       ----------
PLSY_SHESH       ----------
PLSY_SHEWM       ----------
PLSY_SHELP       ----------
PLSY_SHEDO       ----------
PLSY_BLOFL       ----------
PLSY_BLOPB       ----------
PLSY_COXB1       ----------
PLSY_COXBU       ----------
PLSY_COXBN       ----------
PLSY_COXBR       ----------
PLSY_COXB2       ----------
PLSY_FRAT1       ----------
PLSY_FRATT       ----------
PLSY_FRATF       ----------
PLSY_FRATH       ----------
PLSY_FRATN       ----------
PLSY_FRATO       ----------
PLSY_FRATM       ----------
PLSY_FRAP2       ----------
PLSY_LEGPC       ----------
PLSY_LEGPH       ----------
PLSY_LEGPA       ----------
PLSY_LEGPL       ----------
PLSY_RUTMC       ----------
PLSY_AROAE       ----------
PLSY_LARHH       ----------
PLSY_DECAR       ----------
PLSY_NITEC       ----------
PLSY_NITEU       ----------
PLSY_NITMU       ----------
PLSY_METFK       ----------
PLSY_BORBR       ----------
PLSY_BORPE       ----------
PLSY_BORPA       ----------
PLSY_BORPD       ----------
PLSY_BORA1       ----------
PLSY_BURA4       ----------
PLSY_BURCM       ----------
PLSY_BURL3       ----------
PLSY_BURVG       ----------
PLSY_BURCA       ----------
PLSY_BURCH       ----------
PLSY_BURCJ       ----------
PLSY_BURCC       ----------
PLSY_BURM1       ----------
PLSY_BURP1       ----------
PLSY_BURPS       ----------
PLSY_BURMA       ----------
PLSY_BURTA       ----------
PLSY_PARPJ       ----------
PLSY_PARXL       ----------
PLSY_PARP8       ----------
PLSY_CUPTR       ----------
PLSY_CUPNH       ----------
PLSY_CUPMC       ----------
PLSY_CUPPJ       ----------
PLSY_RALPJ       ----------
PLSY_RALSO       ----------
PLSY_HERAR       ----------
PLSY_JANMA       ----------
PLSY_RHOFT       ----------
PLSY_CHRVO       ----------
PLSY_THIDA       ----------
PLSY_NEIG1       ----------
PLSY_NEIG2       ----------
PLSY_NEIMA       ----------
PLSY_NEIMF       ----------
PLSY_NEIM0       ----------
PLSY_NEIMB       ----------
PLSY_METCA       ----------
PLSY_THISH       ----------
PLSY_NITOC       ----------
PLSY_HYDCU       ----------
PLSY_HALHL       ----------
PLSY_PSEA8       ----------
PLSY_PSEAB       ----------
PLSY_PSEAE       ----------
PLSY_PSEA7       ----------
PLSY_AZOVD       ----------
PLSY_PSE14       ----------
PLSY_PSEU2       ----------
PLSY_PSESM       ----------
PLSY_PSEFS       ----------
PLSY_PSEPF       ----------
PLSY_PSEF5       ----------
PLSY_PSEP1       ----------
PLSY_PSEPK       ----------
PLSY_PSEPG       ----------
PLSY_PSEPW       ----------
PLSY_PSEE4       ----------
PLSY_CHRSD       ----------
PLSY_HAHCH       ----------
PLSY_RHIE6       ----------
PLSY_RHIEC       ----------
PLSY1_RHIL3      ----------
PLSY_AGRFC       ----------
PLSY_RHIME       ----------
PLSY_SINMW       ----------
PLSY_SINFN       ----------
PLSY_AGRVS       ----------
PLSY_BRUA1       ----------
PLSY_BRUA2       ----------
PLSY_BRUAB       ----------
PLSY_BRUC2       ----------
PLSY_BRUSU       ----------
PLSY_BRUMB       ----------
PLSY_BRUME       ----------
PLSY_BRUO2       ----------
PLSY_BRUSI       ----------
PLSY_OCHA4       ----------
PLSY_RHILO       ----------
PLSY_BRASB       ----------
PLSY_BRASO       ----------
PLSY_BRADU       ----------
PLSY_RHOP2       ----------
PLSY_RHOPS       ----------
PLSY_RHOPA       ----------
PLSY_RHOPT       ----------
PLSY_RHOPB       ----------
PLSY_NITHX       ----------
PLSY_NITWN       ----------
PLSY_METC4       ----------
PLSY_METEP       ----------
PLSY_METPB       ----------
PLSY_CAUVN       ----------
PLSY_CAUVC       ----------
PLSY_RHOS1       ----------
PLSY_RHOS4       ----------
PLSY_RHOSK       ----------
PLSY_RHOS5       ----------
PLSY_ROSDO       ----------
PLSY_RUEST       ----------
PLSY_RUEPO       ----------
PLSY_JANSC       ----------
PLSY_DINSH       ----------
PLSY_MAGSA       ----------
PLSY_RHORT       ----------
PLSY_MARMM       ----------
PLSY_HYPNA       ----------
PLSY_ERYLH       ----------
PLSY_NOVAD       ----------
PLSY_GLUOX       ----------
PLSY_GRABC       ----------
PLSY_ZYMMO       ----------
PLSY_ANAD2       ----------
PLSY_ANASK       ----------
PLSY_ANADE       ----------
PLSY_ANADF       ----------
PLSY_MYXXD       ----------
PLSY_DEIGD       ----------
PLSY1_DEIRA      ----------
PLSY_THET2       ----------
PLSY_THET8       ----------
PLSY_RUBXD       ----------
PLSY_ROSS1       ----------
PLSY1_DEHM1      ----------
PLSY1_DEHMC      ----------
PLSY2_DEHM1      ----------
PLSY2_DEHMC      ----------
PLSY5_DEHM1      ----------
PLSY4_DEHMC      ----------
PLSY4_DEHM1      ----------
PLSY1_MOOTA      ----------
PLSY1_DESHY      ----------
PLSY_NOSS1       ----------
PLSY_TRIV2       ----------
PLSY_TRIEI       ----------
PLSY_ACAM1       ----------
PLSY2_RHIL3      ----------
PLSY_SYNJA       ----------
PLSY_SYNJB       ----------
PLSY_SYNE7       ----------
PLSY_SYNP6       ----------
PLSY_CROS5       ----------
PLSY_RIPO1       ----------
PLSY_SYNY3       ----------
PLSY_THEEB       ----------
PLSY_GLOVI       ----------
PLSY_PROM2       ----------
PLSY_PROMS       ----------
PLSY_PROM0       ----------
PLSY_PROM9       ----------
PLSY_PROM5       ----------
PLSY_PROMP       ----------
PLSY_PROM1       ----------
PLSY_PROMT       ----------
PLSY_PROM4       ----------
PLSY_PROMA       ----------
PLSY_SYNPX       ----------
PLSY_SYNSC       ----------
PLSY_SYNS9       ----------
PLSY_PROMM       ----------
PLSY_DESRM       ----------
PLSY_DESAP       ----------
PLSY2_MOOTA      ----------
PLSY_CARHZ       ----------
PLSY_BACSU       ----------
PLSY_BACVZ       ----------
PLSY_BACLD       ----------
PLSY_GEOKA       ----------
PLSY_GEOSW       ----------
PLSY3_BACAN      ----------
PLSY2_BACHK      ----------
PLSY_BACC2       ----------
PLSY2_BACCR      ----------
PLSY2_BACCZ      ----------
PLSY2_BACC1      ----------
PLSY_BACCN       ----------
PLSY2_OCEIH      ----------
PLSY_LISMC       ----------
PLSY_LISMF       ----------
PLSY_LISMH       ----------
PLSY_LISMO       ----------
PLSY_LISIN       ----------
PLSY_LISW6       ----------
PLSY2_BACAN      ----------
PLSY_EXIS2       ----------
PLSY_STRR6       ----------
PLSY_STRZJ       ----------
PLSY_STRZP       ----------
PLSY_STRP2       ----------
PLSY_STRPJ       ----------
PLSY_STRP4       ----------
PLSY_STRPN       ----------
PLSY_STRP7       ----------
PLSY_STRPI       ----------
PLSY_STRPS       ----------
PLSY_STRZT       ----------
PLSY_STRGC       ----------
PLSY_STRSV       ----------
PLSY_LACLM       ----------
PLSY_LACLS       ----------
PLSY_LACLA       ----------
PLSY_STRA3       ----------
PLSY_STRA5       ----------
PLSY_STRA1       ----------
PLSY_STRT1       ----------
PLSY_STRT2       ----------
PLSY_STRTD       ----------
PLSY_STREM       ----------
PLSY_STRS7       ----------
PLSY_STRE4       ----------
PLSY_STRPM       ----------
PLSY_STRPZ       ----------
PLSY_STRP6       ----------
PLSY_STRP8       ----------
PLSY_STRPB       ----------
PLSY_STRPC       ----------
PLSY_STRPD       ----------
PLSY_STRPF       ----------
PLSY_STRPG       ----------
PLSY_STRP1       ----------
PLSY_STRP3       ----------
PLSY_STRMU       ----------
PLSY_LACBA       ----------
PLSY_LACPL       ----------
PLSY_LACP3       ----------
PLSY_LACCB       ----------
PLSY_LACSS       ----------
PLSY_LACRD       ----------
PLSY_LACRJ       ----------
PLSY_LACS1       ----------
PLSY_ENTFA       ----------
PLSY2_LACAC      ----------
PLSY2_LACJO      ----------
PLSY_STAA1       ----------
PLSY_STAA2       ----------
PLSY_STAA9       ----------
PLSY_STAAW       ----------
PLSY_STAAM       ----------
PLSY_STAAN       ----------
PLSY_STAAR       ----------
PLSY_STAAS       ----------
PLSY_STAAB       ----------
PLSY_STAA3       ----------
PLSY_STAA8       ----------
PLSY_STAAT       ----------
PLSY_STAAC       ----------
PLSY_STAAE       ----------
PLSY_STAEQ       ----------
PLSY_STAES       ----------
PLSY_STAHJ       ----------
PLSY_STAS1       ----------
PLSY_STACT       ----------
PLSY_MACCJ       ----------
PLSY_PELLD       ----------
PLSY_CHLPM       ----------
PLSY_CHLL2       ----------
PLSY_PELPB       ----------
PLSY_CHLCH       ----------
PLSY_CHLPD       ----------
PLSY_CHLP8       ----------
PLSY_CHLTE       ----------
PLSY_CHLPB       ----------
PLSY_PROA2       ----------
PLSY_SALRD       ----------
PLSY_THEP3       ----------
PLSY_THEPX       ----------
PLSY_CALS4       ----------
PLSY_ALKMQ       ----------
PLSY_CLOD6       ----------
PLSY_FINM2       ----------
PLSY_SYNWW       ----------
PLSY2_DESHY      ----------
PLSY_SYMTH       ----------
PLSY_BACHD       ----------
PLSY_BACSK       ----------
PLSY3_DEHM1      ----------
PLSY3_DEHMC      ----------
PLSY_AQUAE       ----------
PLSY_HYDS0       ----------
PLSY1_BACAN      ----------
PLSY1_BACCZ      ----------
PLSY1_BACHK      ----------
PLSY1_BACC1      ----------
PLSY1_BACCR      ----------
PLSY1_LACAC      ----------
PLSY1_LACJO      ----------
PLSY_MYCCT       ----------
PLSY_MYCMS       ----------
PLSY_MESFL       ----------
PLSY_MYCAP       ----------
PLSY_MYCS5       ----------
PLSY_MYCMO       ----------
PLSY_MYCPU       ----------
PLSY_UREP2       ----------
PLSY_UREPA       ----------
PLSY_UREU1       ----------
PLSY_MYCGE       ----------
PLSY_MYCPN       ----------
PLSY_MYCGA       ----------
PLSY_PSELT       ----------
PLSY_THEM4       ----------
PLSY_KOSOT       ----------
PLSY2_THEMA      ----------
PLSY_THEP1       ----------
PLSY_ANAMF       ----------
PLSY_ANAMM       ----------
PLSY_ANAPZ       ----------
PLSY_EHRCJ       ----------
PLSY_EHRCR       ----------
PLSY_EHRRG       ----------
PLSY_EHRRW       ----------
PLSY_BARHE       ----------
PLSY_BARQU       ----------
PLSY_BART1       ----------
PLSY_BARBK       ----------
PLSY_PELUB       ----------
PLSY_WOLPM       ----------
PLSY_WOLPP       ----------
PLSY_WOLTR       ----------
PLSY_ARCB4       ----------
PLSY_SULDN       ----------
PLSY_WOLSU       ----------
PLSY_NITSB       ----------
PLSY_CAMJ8       ----------
PLSY_CAMJJ       ----------
PLSY_CAMJE       ----------
PLSY_CAMJR       ----------
PLSY_CAMJD       ----------
PLSY_CAMLR       ----------
PLSY_CAMC1       ----------
PLSY_HELPH       ----------
PLSY_HELPJ       ----------
PLSY_HELPY       ----------
PLSY_HELAH       ----------
PLSY_HELHP       ----------
PLSY_MYCPE       ----------
PLSY_NEOSM       ----------
PLSY1_OCEIH      ----------
PLSY1_THEMA      ----------
PLSY2_DEIRA      ----------