CLUSTAL format seed alignment for MF_01057

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRMB_TRIV2      ------------------------------------------------------------
TRMB_NOSS1      ------------------------------------------------------------
TRMB_MICAN      ------------------------------------------------------------
TRMB_SYNP6      ------------------------------------------------------------
TRMB_SYNE7      ------------------------------------------------------------
TRMB_TRIEI      ------------------------------------------------------------
TRMB_SYNY3      ------------------------------------------------------------
TRMB_THEEB      ------------------------------------------------------------
TRMB_SYNJA      ---------------------------------------MEADVQRAQQA---QLEKGSS
TRMB_SYNJB      ---------------------------------------MEAEVQQGQQSPEGQLEKRPP
TRMB_PROMM      ------------------------------------------------------------
TRMB_PROM3      ------------------------------------------------------------
TRMB_SYNSC      ------------------------------------------------------------
TRMB_SYNPX      ------------------------------------------------------------
TRMB_SYNS9      ------------------------------------------------------------
TRMB_SYNS3      ------------------------------------------------------------
TRMB_SYNPW      ------------------------------------------------------------
TRMB_PROMA      ------------------------------------------------------------
TRMB_PROMT      ------------------------------------------------------------
TRMB_PROM1      ------------------------------------------------------------
TRMB_PROMS      ------------------------------------------------------------
TRMB_PROM2      ------------------------------------------------------------
TRMB_PROM9      ------------------------------------------------------------
TRMB_PROMP      ------------------------------------------------------------
TRMB_PROM5      ------------------------------------------------------------
TRMB_GEOSL      ------------------------------------------------------------
TRMB_GEOMG      ------------------------------------------------------------
TRMB_PELCD      ------------------------------------------------------------
TRMB_MYXXD      ------------------------------------------------------------
TRMB_ANADE      ------------------------------------------------------------
TRMB_THET8      ------------------------------------------------------------
TRMB_THET2      ------------------------------------------------------------
TRMB_DEIGD      ------------------------------------------------------------
TRMB_DEIRA      ------------------------------------------------------------
TRMB_CHLAB      ------------------------------------------------------------
TRMB_CHLCV      ------------------------------------------------------------
TRMB_CHLFF      ------------------------------------------------------------
TRMB_CHLTR      ------------------------------------------------------------
TRMB_CHLTA      ------------------------------------------------------------
TRMB_CHLMU      ------------------------------------------------------------
TRMB_CHLPN      ------------------------------------------------------------
TRMB_PARUW      ------------------------------------------------------------
TRMB_LEPIN      ------------------------------------------------------------
TRMB_LEPIC      ------------------------------------------------------------
TRMB_LEPBJ      ------------------------------------------------------------
TRMB_LEPBL      ------------------------------------------------------------
TRMB_NITEU      ------------------------------------------------------------
TRMB_NITEC      ------------------------------------------------------------
TRMB_NITMU      ---------------------------------------------M--------------
TRMB_BURVG      ---------MMHDDPNEAGLPPDD--AALPDEAADGADEV--------------------
TRMB_BURCM      ---------MMHDDPNEAGLPPDD--AALPDEAADGADEV--------------------
TRMB_BURL3      ---------MMHDDPNEAGLPPHD--DAIPDEAAEGADAV--------------------
TRMB_BURCH      ---------MMHDDPNEAGLPPHN--DAIPDETAEGADEV--------------------
TRMB_BURCA      ---------MMHDDPNEAGLPPHN--DAIPDETAEGADEV--------------------
TRMB_BURPS      --------MIHDDDPNAPGAPHDDDATAAPASATRAAPAAGDDDD---------------
TRMB_BURP1      --------MIHDDDPNAPGAPHDDDATAAPASATRAAPAAGDDDD---------------
TRMB_BURMA      --------MIHDDDPNAPGAPHDD-ATAAPASATRAAPAAGDDDD---------------
TRMB_BURTA      ---------MNHDDPNASGVPHDDANDAAPASASDAARATGHADDE--------------
TRMB_PARXL      ---------MIHD-PNDAGLPDQLPTPSSEAENSPAGDTTPPE-----------------
TRMB_THIDA      -------------------------------MTADGGARP--------------------
TRMB_METFK      ---------------------------MAQEMTGNENIGK--------------------
TRMB_CUPNH      ------------MLPQDPSTEPTPADDAAPVD-SAGQASAPSPADP--------------
TRMB_CUPPJ      ------------MHPQDASTEQTPVDD------DQVESSQPVHA-P--------------
TRMB_CUPMC      ------------MLPQDTNTDPLPGDDAESASGKSADASQGTPNPG--------------
TRMB_RALSO      ------------MQPNE-QPGTGPADT----------TLEQQDTAA--------------
TRMB_ACISJ      -------------------MTQTLSSQDPQAPAAPPMPGAA-GSAP--------------
TRMB_ACIAC      --------------------MHSIPADTGHTPSRAPAGN---GSPP--------------
TRMB_VEREI      -------MAPKLQWPIVTELTTASASRGAATGSRGVAPAVPRGGAP--------------
TRMB_POLSJ      -----------------------------MIENPSPSAANLPEHPS--------------
TRMB_POLNA      -----------------------------MIESSSPTPPALHEGAP--------------
TRMB_RHOFT      --------------------------------------------MP--------------
TRMB_NEIMB      ----------------------------------MTDTAENQTQNN--------------
TRMB_NEIMA      ----------------------------------MTDTAENQTQNN--------------
TRMB_NEIMF      ----------------------------------MTDTAENQTQNN--------------
TRMB_NEIM0      ----------------------------------MTDTAENQTPND--------------
TRMB_NEIG1      ----------------------------------MTDTPENQTPND--------------
TRMB_CHRVO      ----------------------------------MENPA---------------------
TRMB_AZOSB      -------------MSEADNKP-------VSATVELIAQDRPE-HRP--------------
TRMB_AROAE      -------------MTFPSHNPPETGHPSAAPDEALPAAEAPVPGDP--------------
TRMB_DECAR      ----------------------------MSDTPLIQPANVGEGVYE--------------
TRMB_BORBR      ----------------MNTNTPAHPP-EGAPLSEATQAALASAEHA--------------
TRMB_BORPA      ----------------MNTNTPAHPP-EGAPLSEATQAALASAEHA--------------
TRMB_BORPE      ----------------MNTNTPAHPP-EGAPLSEATQAALASAEHA--------------
TRMB_BORA1      ----------------MNANTPTPIDGQPTELTPSTQAALEPANHA--------------
TRMB_NITOC      ------------------------------------MSNSITLEER--------------
TRMB_ALKEH      -----------------------------------------MERRA--------------
TRMB_HALHL      ------------------------------------------------------------
TRMB_LEIXX      ---------------------------------------------M--------------
TRMB_XYLFA      -----------------------------MMNLLSNDGVQVLPRPF--------------
TRMB_XYLFT      ------------------------------MNLLSSDGVQVLPRPF--------------
TRMB_XANC5      -----------------------------MTDPFTSDGAKMPPKPF--------------
TRMB_XANAC      -----------------------------MTDPFTSDGAKMPPKPF--------------
TRMB_XANOM      -----------------------------MTDPFTSDGAKMPPKPF--------------
TRMB_XANOR      -----------------------------MTDPFTSDGAKMPPKPF--------------
TRMB_XANCP      -----------------------------MTDPFTSDGAKMPPKPF--------------
TRMB_XANC8      -----------------------------MTDPFTSDGAKMPPKPF--------------
TRMB_METCA      -----------------------------MTDTLMNAD---PP-----------------
TRMB_STRAW      MSDSLHTPEEPRPGPGEQLAHAHDGSLRHTRAKGEPRFPDGPKADP--------------
TRMB_STRCO      MSDSHHTPE------------AASASLRHVRAKGEPRFPDGPKADP--------------
TRMB_SHESM      -----------------------------MSEV-------TTAEFN--------------
TRMB_SHESA      -----------------------------MSEV-------TTAEFN--------------
TRMB_SHESR      -----------------------------MSEV-------TTAEFN--------------
TRMB_SHEON      -----------------------------MSEV-------TTAEFN--------------
TRMB_SHEPC      -----------------------------MSEV-------TTAEFN--------------
TRMB_SHESW      -----------------------------MSEV-------TTAEFN--------------
TRMB_SHEB8      -----------------------------MSEV-------TTAEFN--------------
TRMB_SHEB5      -----------------------------MSEV-------TTAEFN--------------
TRMB_SHEB9      -----------------------------MSEV-------TTAEFN--------------
TRMB_SHEFN      -----------------------------MSDV-------TTAEFN--------------
TRMB_SHEDO      -----------------------------MSDV-------TTAEFN--------------
TRMB_SHEHH      -----------------------------MSDV-------TTAEFN--------------
TRMB_SHEPA      -----------------------------MSDV-------TTAEFN--------------
TRMB_SHESH      -----------------------------MSDV-------TTAEFN--------------
TRMB_SHEAM      -----------------------------MSEV-------TTAEFN--------------
TRMB_VIBPA      -----------------------------MSEV-------TTNEYN--------------
TRMB_VIBCB      -----------------------------MSEV-------TTNEYN--------------
TRMB_VIBVY      -----------------------------MSEV-------TTNEYN--------------
TRMB_VIBVU      -----------------------------MSEV-------TTNEYN--------------
TRMB_VIBCH      -----------------------------MSEV-------ITQEYT--------------
TRMB_VIBC3      -----------------------------MSEV-------ITQEYT--------------
TRMB_PHOPR      -----------------------------MSEVSKKSGDVTVTELT--------------
TRMB_AERHH      -------------------------------------MPVTQDVFN--------------
TRMB_PSEA6      -----------------------------MS----QFK--SKEEAA--------------
TRMB_PSEHT      -----------------------------MS----ESSNTNLEQAK--------------
TRMB_COLP3      -----------------------------MTEKN-EKTHKTIEQAE--------------
TRMB_PSYIN      -----------------------------MTDQEHSASE-ENADSV--------------
TRMB_SALCH      ----------------------------MKNDV-------ISPEFD--------------
TRMB_SALPA      ----------------------------MKNDV-------ISPEFD--------------
TRMB_SALTI      ----------------------------MKNDV-------ISPEFD--------------
TRMB_SALAR      ----------------------------MKNDV-------ISPEFD--------------
TRMB_SALTY      ----------------------------MKNDV-------ISPEFD--------------
TRMB_ECOL6      ----------------------------MKNDV-------ISPEFD--------------
TRMB_ECOUT      ----------------------------MKNDV-------ISPEFD--------------
TRMB_ECOK1      ----------------------------MKNDV-------ISPEFD--------------
TRMB_ECOL5      ----------------------------MKNDV-------ISPEFD--------------
TRMB_ECOHS      ----------------------------MKNDV-------ISPEFD--------------
TRMB_ECO57      ----------------------------MKNDV-------ISPEFD--------------
TRMB_ECOLC      ----------------------------MKNDV-------ISPEFD--------------
TRMB_SHISS      ----------------------------MKNDV-------ISPEFD--------------
TRMB_ECO24      ----------------------------MKNDV-------ISPEFD--------------
TRMB_SHIFL      ----------------------------MKNDV-------ISPEFD--------------
TRMB_ECOLI      ----------------------------MKNDV-------ISPEFD--------------
TRMB_SHIF8      ----------------------------MKNDV-------ISPEFD--------------
TRMB_SHIDS      ----------------------------MKNDV-------ISPEFD--------------
TRMB_SHIBS      ----------------------------MKNDV-------ISPEFD--------------
TRMB_KLEP7      ----------------------------MKNDV-------ISPEFD--------------
TRMB_CROS8      ----------------------------MNNDV-------ISPEFD--------------
TRMB_YERPE      ----------------------------MINDV-------ISPEFD--------------
TRMB_YERPP      ----------------------------MINDV-------ISPEFD--------------
TRMB_YERPA      ----------------------------MINDV-------ISPEFD--------------
TRMB_YERPN      ----------------------------MINDV-------ISPEFD--------------
TRMB_YERP3      ----------------------------MINDV-------ISPEFD--------------
TRMB_YERPS      ----------------------------MINDV-------ISPEFD--------------
TRMB_YERE8      ----------------------------MINDV-------ISPEFD--------------
TRMB_SERP5      ----------------------------MINDV-------ISPEFD--------------
TRMB_PECAS      ----------------------------MINNV-------ISPEFD--------------
TRMB_PHOLL      ----------------------------MINNV-------ISPEFD--------------
TRMB_SODGM      ----------------------------MSNNV-------ISPEFD--------------
TRMB_IDILO      -----------------------------MSHFK------SAEEAA--------------
TRMB_ACTP2      ----------------------MSE-KQTFADKK--RKTVEQAEFT--------------
TRMB_HAEDU      ----------------------MSE-KYTFADQK--RKTVEQAEFT--------------
TRMB_HAES1      ----------------------MTEQKITFADQK--RKTVEIAEFT--------------
TRMB_HISS2      ----------------------MTEQKITFADQK--RKTVEIAEFT--------------
TRMB_MANSM      ----------------------MSEQKITFADQK--RKTVETAEFT--------------
TRMB_HAEI8      ----------------------MTQ---TFADQK--RKTVETAEFT--------------
TRMB_HAEIN      ----------------------MTQ---TFADQK--RKTVETAEFT--------------
TRMB_HAEIG      ----------------------MTQ---TFADQK--RKTVETAEFT--------------
TRMB_HAEIE      ----------------------MTQ---TFADQK--RKTVETAEFT--------------
TRMB_PASMU      ----------------MSFNNQESENLPTFADQK--RKTVEVAEFT--------------
TRMB_ACTSZ      ----------------------MTELKKTFADQK--RKTVETAEFT--------------
TRMB_HAHCH      -----------------------------MDNQH--------------------------
TRMB_MARHV      -----------------------------MTDQNET-------QDT--------------
TRMB_SACD2      -----------------------------MQPEFK-------------------------
TRMB_ALCBS      ----------------------------MLDFINHD-------KDP--------------
TRMB_PSEPK      -----------------------------MTESH----DTPITPD---------------
TRMB_PSEPG      -----------------------------MTESH----DTPITPD---------------
TRMB_PSEP1      -----------------------------MTESH----DTPITSD---------------
TRMB_PSEE4      -----------------------------MTESQ----ETPITED---------------
TRMB_PSEPF      -----------------------------MTESN----DTPIQTEE--------------
TRMB_PSEF5      -----------------------------MTESN----DTPIQPEA--------------
TRMB_PSEU2      -----------------------------MTDSHVPHPESPAVEE---------------
TRMB_PSE14      -----------------------------MTDSHVPHPESPAVEE---------------
TRMB_PSESM      -----------------------------MTDTHVPPPELPAAEE---------------
TRMB_PSEAE      -----------------------------MSDTPQSPAQDSLAEH---------------
TRMB_PSEA7      -----------------------------MSDTPQSPAQDSLAEH---------------
TRMB_PSEAB      -----------------------------MSDTPQSPAQGSLAEH---------------
TRMB_PSEMY      -----------------------------MTDTQQP------ELT---------------
TRMB_PSEU5      -----------------------------MTEQNPA------AEE---------------
TRMB_CHRSD      -----------------------------MSDSSSSSENAPATPE---------------
TRMB_HYDCU      -----------------------------MTENTES----PQSVAT--------------
TRMB_LEGPA      ------------------------------------------------------------
TRMB_LEGPH      ------------------------------------------------------------
TRMB_LEGPL      ------------------------------------------------------------
TRMB_LEGPC      ------------------------------------------------------------
TRMB_FRATF      -----------------------------MCDK---------------------------
TRMB_FRATN      -----------------------------MCDK---------------------------
TRMB_FRATO      -----------------------------MCDK---------------------------
TRMB_FRAP2      -----------------------------MSDN---------------------------
TRMB_TREDE      ------------------------------------MNSTEITQNT--------------
TRMB_TREPA      --------------------------------------------MT--------------
TRMB_BUCAI      -----------------------------------MKNNIITPRYN--------------
TRMB_BUCAP      -----------------------------------MKNNIITPQYN--------------
TRMB_BUCBP      --------------------------------------MYFYLKYN--------------
TRMB_NOCFA      ---------------MDGVNDAANHTVESVPGRPSTASAPLEAGRR--------------
TRMB_RHOJR      ---------------MPETPLMRDNGPVNHADQ-DAPAVPEEGQTK--------------
TRMB_MYCSK      ---------------------MRHHGRMHARESDVAGGPARDSAGGPARDSAGGPARDSA
TRMB_MYCSS      ---------------------MRHHGRMHARESDVAGGPARDSAGGPARDSAGGPARDSA
TRMB_MYCGI      ---------------------MSDHGRMHSTGSEVAAPVAPDPDT---------------
TRMB_MYCVP      ---------------------MSDHGRMHIPESGLATPAAAHSD----------------
TRMB_MYCBP      ---------------------MVHHGQMHAQPGVGLRPDTPVASGQ--------------
TRMB_MYCTU      ---------------------MVHHGQMHAQPGVGLRPDTPVASGQ--------------
TRMB_MYCBO      ---------------------MVHHGQMHAQPGVGLRPDTPVASGQ--------------
TRMB_MYCUA      ---------------------MRHDGPMHVQPGVGLQSDTSSSTGTGSGPA-------DE
TRMB_MYCA1      ---------------------MGHHGQMHAQHGVTMPADSPTGQPD--------------
TRMB_MYCPA      ---------------------MGHHGQMHAQHGVTMPADSPIGQPD--------------
TRMB_MYCLE      ------------------------------------------------------------
TRMB_CORGB      ------------------MSISDNS---RDQLGELPAGRPLQSDFD--------------
TRMB_CORGL      ------------------MSISDNS---RDQLGELPAGRPLQSDFD--------------
TRMB_COREF      ------------------MSISDNS---REELGELPAGRPLQSEFN--------------
TRMB_CORDI      ------------------MSNTDNSDKNTKPTGYRPPQTDFNTEFG--------------
TRMB_CORJK      ------------------MVWMNNS---ENTPGSLPPGRPLQTEFN--------------
TRMB_CUTAK      ------------MRPDPAPLDPTDASPAQARRHQPGLGVEVSAGAHRS------------
TRMB_NOCSJ      -------------MPEHAPDGVRPARPHH----------KLTADGRR-------------
TRMB_PAEAT      ------------MSETPDSP------------------RPVTPGSQAS------------
TRMB_ARTS2      ------------MSESPETPEPSPAQSPEAAPEQPQAARPVTPGSQAS------------
TRMB_BIFAA      ----------------MQHDENTPTDGRKTEENAQNIQHVQSAAADGR------------
TRMB_BIFLO      ----------------MTNPESTAID----PVAAMGTDHTEAPAHP--------------
TRMB_PSYCK      -----------------------------MSQHPDINTNVDATSLTDDQKSLDTNATSGN
TRMB_PSYA2      -----------------------------MSQHPDINSSIDANHLTDDQTSLDANAVIDK
TRMB_ACIAD      -----------------------------MSHTKIMSTDQLETQITE-------------
TRMB_RHIME      ------------------------------MTETRGA-----------------------
TRMB_SINMW      ------------------------------MTETRGA-----------------------
TRMB_RHIEC      --------------------------------MERRG-----------------------
TRMB_RHIL3      -----------------------------MTDMERRG-----------------------
TRMB_AGRFC      ------------------------------MTEERRS-----------------------
TRMB_RHILO      -----------------------------MSPQDRPS-----------------------
TRMB_BRUAB      -----------------------------MIDENHPM-----------------------
TRMB_BRUA2      -----------------------------MIDENHPM-----------------------
TRMB_BRUME      -----------------------------MIDENHPM-----------------------
TRMB_BRUSU      -----------------------------MIDENHPM-----------------------
TRMB_OCHA4      -----------------------------MTEESHPL-----------------------
TRMB_CHESB      ------------------------------MAERHPE-----------------------
TRMB_BARQU      -------------------------------MIDHKV-----------------------
TRMB_BARHE      -------------------------------MIDHNI-----------------------
TRMB_BARBK      -------------------------------MIAHKP-----------------------
TRMB_AZOC5      ------------------------------MTALSET-----------------------
TRMB_RHOPS      ---------------MITIDRRVQTK--CSVLGRHKQ-----------------------
TRMB_RHOP2      ---------------MVTIDRRVQPI--AHLACNHQR-----------------------
TRMB_RHOPA      -------------MAVLYAGRPVQKCERSRLMFNIDQPDSAPDN----------------
TRMB_NITHX      ------------------MTAAASDPHNPRSSADDTA-----------------------
TRMB_NITWN      ------------------MTVVVSDHQNPRPPGDDAA-----------------------
TRMB_RHOP5      -----------------------MTPDDPRDASDASL-----------------------
TRMB_RHOPB      -----------------------MP--DPRDDDEAAT-----------------------
TRMB_BRADU      -----------------------MS----ERKSDPDR-----------------------
TRMB_RUEST      -----------------------------MSDSDASRPSAIASDGP--------------
TRMB_RUEPO      -----------------------------MSKTTPDRP----------------------
TRMB_ROSDO      -----------------------------MSKQT--RP----------------------
TRMB_JANSC      -----------------------------MTDPHPNRP----------------------
TRMB_PARDP      -----------------------------MSEFDP-------------------------
TRMB_RHOS4      -----------------------------MSDDDAPESLRGAAD----------------
TRMB_RHORT      -----------------------------MPEKP--------------------------
TRMB_MAGSA      -----------------------------MGKHAENGN----------------------
TRMB_GRABC      -----------------------------MPDMTMK------------------------
TRMB_NOVAD      -----------------------------MTAYKSGDP----------------------
TRMB_SPHAL      -----------------------------MTAHKPGDP----------------------
TRMB_ERYLH      -----------------------------MTAFKQGDP----------------------
TRMB_ZYMMO      -----------------------------MTESSIHDP----------------------
TRMB_CAUVC      -----------------------------MTTPQQP------------------------
TRMB_CAUSK      -----------------------------MTHPQQP------------------------
TRMB_MARMM      -----------------------------MTTEPTQ------------------------
TRMB_HYPNA      ------------------------------------------------------------
TRMB_MAGMM      ------------------------MSQTPMPQPDQAPPVDVGQPVD--------------
TRMB_HELPY      ---------------MPHFLAKLDFKPLEYPLIEGDFCFHREFLSLKNPTKSCVYASFKD
TRMB_HELPH      ---------------MPHFLAKLDFKPLKYPLIEGDFCFHKEFLSLKNPTKSCVYASFKD
TRMB_HELPJ      ---------------MPHFLAKLDSKPLEYPLIRGDFCFHREFLSLKHPTKSCVHASFKN
TRMB_HELAH      ---------------MPHFLAKLDCKPLEYPIISGDFCFHKEFSSLKHPTKSCVYASFKD
TRMB_WOLSU      ---------------MPHFIASS-FTHPDYPFEEEGYCFSDSLSNLLHPHEELVRVEVEG
TRMB_HELHP      ---------------MPHFLASH-ITLPPMPFTQEGYTFVYEAKQCNDSSQSLILVRYED
TRMB_CAMJE      ---------------MPNFKSKK-IKEINLPYSKDDVEFLWLAKND---NVSLIYTKVQE
TRMB_CAMJR      ---------------MPNFKSKK-IKEINLPYSKDDVEFLWLAKND---NVSLIYTKVQE
TRMB_CAMJ8      ---------------MPNFKSKK-IKEINLPYSKDDVEFLWLAKND---NVSLIYTKVQE
TRMB_CAMJJ      ---------------MPNFKSKK-IKEINLPYSKDDVEFLWLAKND---NVSLIYTKVQE
TRMB_CAMJD      ---------------MPNFKSKK-IKEINLPYSKDDVEFLWFAKND---NVSLIYTKVQE
TRMB_CAMFF      ---------------MPNFVATS-LKNLKFPFGADGVEFLWSAKAG---DESLIYTKTGK
TRMB_SULDN      ---------------MPHLHIAE-FKEVEIPSSKDGVSFNFIAKNSSHQEEKLISITVDE
TRMB_GEOTN      ------------------------------------------------------------
TRMB_GEOKA      ------------------------------------------------------------
TRMB_BACHK      ------------------------------------------------------------
TRMB_BACC1      ------------------------------------------------------------
TRMB_BACAN      ------------------------------------------------------------
TRMB_BACCZ      ------------------------------------------------------------
TRMB_BACCR      ------------------------------------------------------------
TRMB_BACAH      ------------------------------------------------------------
TRMB_BACCN      ------------------------------------------------------------
TRMB_BACSU      ------------------------------------------------------------
TRMB_BACVZ      ------------------------------------------------------------
TRMB_BACLD      ------------------------------------------------------------
TRMB_LISIN      ------------------------------------------------------------
TRMB_LISW6      ------------------------------------------------------------
TRMB_LISMO      ------------------------------------------------------------
TRMB_LISMF      ------------------------------------------------------------
TRMB_STRT2      ------------------------------------------------------------
TRMB_STRTD      ------------------------------------------------------------
TRMB_STRT1      ------------------------------------------------------------
TRMB_STRA1      ------------------------------------------------------------
TRMB_STRA5      ------------------------------------------------------------
TRMB_STRA3      ------------------------------------------------------------
TRMB_STRP3      ------------------------------------------------------------
TRMB_STRPB      ------------------------------------------------------------
TRMB_STRPF      ------------------------------------------------------------
TRMB_STRPM      ------------------------------------------------------------
TRMB_STRPC      ------------------------------------------------------------
TRMB_STRP1      ------------------------------------------------------------
TRMB_STRPD      ------------------------------------------------------------
TRMB_STRPG      ------------------------------------------------------------
TRMB_STRP8      ------------------------------------------------------------
TRMB_STRP6      ------------------------------------------------------------
TRMB_STRSY      ------------------------------------------------------------
TRMB_STRS2      ------------------------------------------------------------
TRMB_STRMU      ------------------------------------------------------------
TRMB_STRSV      ------------------------------------------------------------
TRMB_STRGC      ------------------------------------------------------------
TRMB_STRR6      ------------------------------------------------------------
TRMB_STRPN      ------------------------------------------------------------
TRMB_STRP2      ------------------------------------------------------------
TRMB_LACLM      ------------------------------------------------------------
TRMB_LACLA      ------------------------------------------------------------
TRMB_LACLS      ------------------------------------------------------------
TRMB_ENTFA      ------------------------------------------------------------
TRMB_BACHD      ------------------------------------------------------------
TRMB_BACSK      ------------------------------------------------------------
TRMB_OCEIH      ------------------------------------------------------------
TRMB_STAES      ------------------------------------------------------------
TRMB_STAEQ      ------------------------------------------------------------
TRMB_STAHJ      ------------------------------------------------------------
TRMB_STAA3      ------------------------------------------------------------
TRMB_STAA8      ------------------------------------------------------------
TRMB_STAAB      ------------------------------------------------------------
TRMB_STAAC      ------------------------------------------------------------
TRMB_STAAS      ------------------------------------------------------------
TRMB_STAAW      ------------------------------------------------------------
TRMB_STAAM      ------------------------------------------------------------
TRMB_STAAN      ------------------------------------------------------------
TRMB_STAAR      ------------------------------------------------------------
TRMB_STAS1      ------------------------------------------------------------
TRMB_LACRD      ------------------------------------------------------------
TRMB_PEDPA      ------------------------------------------------------------
TRMB_LACPL      ------------------------------------------------------------
TRMB_LACS1      ------------------------------------------------------------
TRMB_LACSS      ------------------------------------------------------------
TRMB_LACP3      ------------------------------------------------------------
TRMB_LACBA      ------------------------------------------------------------
TRMB_LACJO      ------------------------------------------------------------
TRMB_LACGA      ------------------------------------------------------------
TRMB_LACDA      ------------------------------------------------------------
TRMB_LACDB      ------------------------------------------------------------
TRMB_LACAC      ------------------------------------------------------------
TRMB_LACH4      ------------------------------------------------------------
TRMB_LEUMM      ------------------------------------------------------------
TRMB_OENOB      ------------------------------------------------------------
TRMB_LACP7      ------------------------------------------------------------
TRMB_CLOD6      ------------------------------------------------------------
TRMB_ALKOO      ------------------------------------------------------------
TRMB_ALKMQ      ------------------------------------------------------------
TRMB_CLOPS      ------------------------------------------------------------
TRMB_CLOP1      ------------------------------------------------------------
TRMB_CLOPE      ------------------------------------------------------------
TRMB_CLOB8      ------------------------------------------------------------
TRMB_HUNT2      ------------------------------------------------------------
TRMB_CLOTE      ------------------------------------------------------------
TRMB_CLOK5      ------------------------------------------------------------
TRMB_CLOAB      ------------------------------------------------------------
TRMB_CLONN      ------------------------------------------------------------
TRMB_DESHY      ------------------------------------------------------------
TRMB_MYCGE      ------------------------------------------------------------
TRMB_MYCPN      ------------------------------------------------------------
TRMB_UREPA      ------------------------------------------------------------
TRMB_UREP2      ------------------------------------------------------------
TRMB_MYCCT      ------------------------------------------------------------
TRMB_MYCMS      ------------------------------------------------------------
TRMB_MESFL      ------------------------------------------------------------
TRMB_MYCGA      ------------------------------------------------------------
TRMB_MYCPE      ------------------------------------------------------------
TRMB_MYCPU      ------------------------------------------------------------
TRMB_MYCHP      ------------------------------------------------------------
TRMB_MYCH2      ------------------------------------------------------------
TRMB_MYCH7      ------------------------------------------------------------
TRMB_MYCHJ      ------------------------------------------------------------
TRMB_MYCMO      ------------------------------------------------------------
TRMB_MYCS5      ------------------------------------------------------------
TRMB_BACFR      ------------------------------------------------------------
TRMB_BACFN      ------------------------------------------------------------
TRMB_BACTN      ------------------------------------------------------------
TRMB_PORGI      ------------------------------------------------------------
TRMB_GRAFK      ------------------------------------------------------------
TRMB_CYTH3      ------------------------------------------------------------
TRMB_CHLSY      ------------------------------------------------------------
TRMB_CHLAA      ------------------------------------------------------------
TRMB_CHLAD      ------------------------------------------------------------
TRMB_CHLT3      ------------------------------------------------------------
TRMB_RUBXD      ------------------------------------------------------------
TRMB_THEMA      ------------------------------------------------------------
TRMB_COPPD      ------------------------------------------------------------
TRMB_CHLPD      ------------------------------------------------------------
TRMB_AQUAE      ------------------------------------------------------------
TRMB_NEOSM      ------------------------------------------------------------
TRMB_WOLPM      ------------------------------------------------------------
TRMB_RHOBA      ---------------------------MLVVAAMRVWNPEEGWANRVGRKREGKIVEILR
TRMB_BDEBA      ------------------------------------------------------------
                                                                            

TRMB_TRIV2      --------MSALPFVRVRQHVNPLAQKYLTPAN--------------------------P
TRMB_NOSS1      ----MISGVSALPFVRVRQHVNPLAQKYLTPAN--------------------------P
TRMB_MICAN      -----------MAKVRVRQHVNPLSHKYRHPIA--------------------------P
TRMB_SYNP6      -----------MARVRVRQHVNPLSQKFQVVTT--------------------------W
TRMB_SYNE7      -----------MARVRVRQHVNPLSQKFQVVTT--------------------------W
TRMB_TRIEI      -----------MVRVRIRQHVNPLASKYQQSVT--------------------------I
TRMB_SYNY3      -----------MARVRIRQHVNPLSEKYRQVLA--------------------------C
TRMB_THEEB      -------MSDRAMVVRVRQHVNPLSQKFQQDIP--------------------------V
TRMB_SYNJA      VPPWTGIPLQKGLGQRLRQHVNPLQAQYQQPTP--------------------------P
TRMB_SYNJB      SPPWAGIPLQRGLGHRVRQHVNPLQAQYQQPAP--------------------------P
TRMB_PROMM      ----------------MRQHVNPLSRFFQLPRP--------------------------L
TRMB_PROM3      ----------------MRQHVNPLSRFFQLPRP--------------------------L
TRMB_SYNSC      ----------------MRQHVNPLSSFFQLPLE--------------------------L
TRMB_SYNPX      ----------------MRQHVNPLSRFFQLPLQ--------------------------L
TRMB_SYNS9      ----------------MRQHVNPLSRSFQLPLR--------------------------L
TRMB_SYNS3      ----------------MRQHVNPLSRFFQLPLE--------------------------L
TRMB_SYNPW      ----------------MRQHVNPLSRFFQLPLE--------------------------L
TRMB_PROMA      ----------------MRQHVNPLSHFFQLHNE--------------------------L
TRMB_PROMT      ----------------MRQHVNPLSQFFQLPLS--------------------------L
TRMB_PROM1      ----------------MRQHVNPLSQFFQLPLS--------------------------L
TRMB_PROMS      ----------------MRQHVNPLSINFNQIER--------------------------I
TRMB_PROM2      ----------------MRQHVNPLSSNFNKIER--------------------------I
TRMB_PROM9      ----------------MRQHVNPLSRNFNEIER--------------------------I
TRMB_PROMP      ----------------MRQHVNPLSKNFFEIDP--------------------------I
TRMB_PROM5      ----------------MRQHVNPLSKNFFEIDP--------------------------I
TRMB_GEOSL      -------------MQRIIPIDSPFFLNPDELGT--------------------------P
TRMB_GEOMG      -------------MQRMIEISSPFFLNPDELST--------------------------P
TRMB_PELCD      ------------MTQHMIEIKSPYFLREESLAS--------------------------P
TRMB_MYXXD      -------------MSRPRLLPEPVGLKFVTQET--------------------------P
TRMB_ANADE      ------------------MIFSIEDDAPIVRDL--------------------------L
TRMB_THET8      ------------------MLVVPARLHRWPPEV--------------------------Q
TRMB_THET2      ------------------MLVVPARLHRWPPEV--------------------------Q
TRMB_DEIGD      -------------------MIFRLADFHFPDSA--------------------------A
TRMB_DEIRA      -------------------MIFRLGDFRFPDDP--------------------------A
TRMB_CHLAB      -----MKPQDLKAPFFGEERKTQIKDDVLYIPEHYFKHGQFEMPSW--------------
TRMB_CHLCV      -----MKPQNLKVPFFWEERSTEIKDNVLYIPNHYFKHDQFIMPSW--------------
TRMB_CHLFF      -----MKPQDLKVPFFWEERSTKIKDNVLYVPEHYFKHHQFIMPSW--------------
TRMB_CHLTR      -----MKPQDLKLPYFWEERSPQIANHVFYVPNYYSRYEEFVMPTW--------------
TRMB_CHLTA      ----------MKLPYFWEERSPQIANHVFYVPNYYSRYEEFVMPTW--------------
TRMB_CHLMU      -----MKPQDLKLPYFWEDRCPKIENHVFYVPSYYPKYEEFVMPSW--------------
TRMB_CHLPN      -----MKPQDLSPPFLWKERRPCIQDGVLYVPRHYFEHQNFSTSYH--------------
TRMB_PARUW      -----MKPKDLKSPFKWEHRQIVIQDRVWYVPDQHLSDIPFIFPGWT-------------
TRMB_LEPIN      ------------MVQDLEQKLWSIASGIPFSSDYFLQASPIRKLKK--------------
TRMB_LEPIC      ------------MVQDLEQKLWSIASGIPFSSDYFLQASPIRKLKK--------------
TRMB_LEPBJ      ------------MSQDLEQKLWSIASGIPFVSDYFLQASPARKLKK--------------
TRMB_LEPBL      ------------MSQDLEQKLWSIASGIPFVSDYFLQASPARKLKK--------------
TRMB_NITEU      ------MSSHPPIRSYVLRQGYFSNAQRHAYES-LLPRYGIPLTE-------------EP
TRMB_NITEC      ------MSSHPPIRSYVLRQGYFSHAQRHAYES-LLPRYGIPFSE-------------NP
TRMB_NITMU      ----VEHSPHRPIRSFVLRQGRLSNAQRRAHET-LMPKYGIPYSG-------------KL
TRMB_BURVG      -----NPLHHRRIRSFVTRAGRVSTGQRRAIDE-LGPRFVVPYAP-------------TL
TRMB_BURCM      -----NPLHHRRIRSFVTRAGRVSTGQRRALDE-FGPRFVVPYAA-------------EI
TRMB_BURL3      -----NPLHHRRIRSFVTRAGRVSTGQRRAMDE-LGPRFVVPYAP-------------EL
TRMB_BURCH      -----NPLHHRRIRSFVTRAGRVSTGQRRALDE-FGPRFVVPYAP-------------EM
TRMB_BURCA      -----NPLHHRRIRSFVTRAGRVSTGQRRALDE-FGPRFVVPYAP-------------EM
TRMB_BURPS      ----ANPLHLRRIRSFVTRAGRVSTGQRRAIDE-LGPRFVIPYGS-------------AQ
TRMB_BURP1      ----ANPLHLRRIRSFVTRAGRVSTGQRRAIDE-LGPRFVIPYGS-------------AQ
TRMB_BURMA      ----ANPLHLRRIRSFVTRAGRVSTGQRRAIDE-LGPRFVIPYGS-------------AQ
TRMB_BURTA      ----SSPLHLRRIRSFVTRAGRVSTGQRRAIDE-LGPRFVVPYDN-------------AQ
TRMB_PARXL      -----EALHRRRIRSFVTRAGRVSTGQRRAMDE-LGPRFVVPFAP-------------QQ
TRMB_THIDA      -----------RIRSYVLRAGRVGSGQARALVE-LGPRFVLPYQP-------------EL
TRMB_METFK      -----EELARRPIRSFVLRQGRLTHAQQRALDE-LMPVFGVPYAP-------------VI
TRMB_CUPNH      ----EGVAHPRRIRSFVRRAGRTSTGQQRAIDE-VGPRMMVPYAP-------------QP
TRMB_CUPPJ      ----EDVAHPRRIRSFVRRAGRTSSGQQRAIDE-VGPRLIVPYAP-------------HP
TRMB_CUPMC      ----DEVAHPRRIRSFVRRAGRTSTGQQRAMDE-LGPTYIVPYQP-------------EP
TRMB_RALSO      ----AEVGHPRRIRSFVRRAGRTSTGQQRAIDE-LGPRFLLPYAA-------------AP
TRMB_ACISJ      ----ADVAHPKGIKSYVRRAGRTTTGQAKALEE-LGPRYVLDYAP-------------AL
TRMB_ACIAC      ----ADVAFPKAIKSYVRRAGRTTTGQAKALET-FGSQFVLDYTP-------------GP
TRMB_VEREI      ----ADVAHPQTIKSFVRRAGRTTAAQARAFED-LGPRFVVPYAPIAPIAPI----APAA
TRMB_POLSJ      ----TDASHPRNIRSFVRRTGRTTVGQAKAFAD-VGPRFLLAYKA-------------EP
TRMB_POLNA      ----ADVSHPRNIRSFVRRTGRTTVGQAKAFAD-VGPRFLLAYSG-------------LP
TRMB_RHOFT      ----EGVAFPKEIKSFVRRAGRTTTGQAKALED-MGPQFLLPYQT-------------SA
TRMB_NEIMB      ----WQAGHPRSIRSFVLRQSHMTAAQQRAIDT-LWDSFGIDYQA-------------TP
TRMB_NEIMA      ----WQAEHPRSIRSFVLRQSHMTAAQQRAIDT-LWGSFGIDYQA-------------TP
TRMB_NEIMF      ----WQAEHPRSIRSFVLRQSHMTAAQQRAIDT-LWDSFGIDYQA-------------TP
TRMB_NEIM0      ----RQAGHPRSIRSFVLRQSHMTAAQQRAIDT-LWDSFGIDYQA-------------TP
TRMB_NEIG1      ----LPAGHSRSIRSFVLRQSHMTAAQQRAIDT-LWDSFGIDYQA-------------TP
TRMB_CHRVO      --------FKRAIRSFVLRQGHLSAGQQRAMDE-GMPKWGIEYRP-------------ET
TRMB_AZOSB      ----EHRFSSRSIRSFVLRQGRMSGAQQRYLED-MLPKIGIEYRP-------------AP
TRMB_AROAE      ----EARFSSRSIRSFVLRQGRMSVAQQRHLDE-TLPKVGIPYRV-------------AP
TRMB_DECAR      ----EGREGYGHIKSYVRRAGRMSSAQENYYAE-MMPKIGLVYAS-------------QP
TRMB_BORBR      ----PDSPGATHIRSFVHRRGHITQRQRDALEQ-LMGKWSVPYAP-------------RP
TRMB_BORPA      ----PDSPGATHIRSFVHRRGHITQRQRDALEQ-LMGKWSVPYAP-------------RP
TRMB_BORPE      ----PDSPGATHIRSFVHRRGHITQRQRDALEQ-LMGKWSVPYAP-------------RP
TRMB_BORA1      ----PASPGATHIRSFVHRRGHITQRQRDALEQ-LMGKWAIPYAP-------------RP
TRMB_NITOC      ----GESFQPRPITSFVRREGRMTPAQKKALEH-LWPRYGIDLGT-------------GP
TRMB_ALKEH      ----DAATGKRPIRSFVRREGRLTAGQQRALEL-LWPAFGLERPP-----------AGQP
TRMB_HALHL      ------MSQPRQTRTFVRREGRLTQGQQRALEG-LWPQFGVDVPE-----------RG-V
TRMB_LEIXX      ----EPAPLVRP-RSYVVR-GRKTDAQQRAIAE-FWPAFGVDF-------------AGGL
TRMB_XYLFA      ----TLNERRREVRSFVLRQGHFTPAQKRAFDH-YWPRFGVDF-------------IGQL
TRMB_XYLFT      ----TLNERRREVRSFVLRQGHFTPAQKRAFDH-YWPRFGVDF-------------IGQL
TRMB_XANC5      ----TVEEGRRQVRSFVLRQGRFTPAQQRAFDD-LWPRFGLDY-------------TGAP
TRMB_XANAC      ----TIEEGRRQVRSFVLRQGRFTPAQQRTFDA-LWPRFGLDY-------------LGAP
TRMB_XANOM      ----TIEAGRRQVRSFVLRQGRFTSAQQRAFDE-LWPRFGLEY-------------LGTP
TRMB_XANOR      ----TIEAGRRQVRSFVLRQGRFTSAQQRAFDE-LWPRFGLEY-------------LGTP
TRMB_XANCP      ----TIEEGRRQVRSFVLRQGRFTPAQQRAFDE-LWPRFGLDY-------------TGAP
TRMB_XANC8      ----TIEEGRRQVRSFVLRQGRFTPAQQRAFDE-LWPRFGLDY-------------TGAP
TRMB_METCA      ----------RRIRSFVLRQGRITASQKNALEN-LWPRYGLD--------------PAAA
TRMB_STRAW      ----AGSHFERRIRSFQPRRSRVTAGQADALQR-LWPKWGLDIDGH-------------A
TRMB_STRCO      ----AGSHFERRIRSFQPRRSRVTAGQADALQR-LWPLWGLDIDGRR------------V
TRMB_SHESM      ----EEGKYLRKIRSFVLREGRLTKGQAQAIET-QWPTMGLDY-------------SPTP
TRMB_SHESA      ----EEGKYLRKIRSFVLREGRLTKGQAQAIET-QWPTMGLDY-------------SPTP
TRMB_SHESR      ----EEGKYLRKIRSFVLREGRLTKGQAQAIET-QWPTMGLDY-------------SPTP
TRMB_SHEON      ----EEGKYLRKIRSFVLREGRLTKGQAQAIET-QWPTMGLDY-------------SPAP
TRMB_SHEPC      ----EEGKYLRKIRSFVLREGRLTKGQAQAIES-QWPTMGLDY-------------SPVP
TRMB_SHESW      ----EEGKYLRKIRSFVLREGRLTKGQAQAIES-QWPTMGLDY-------------SPVP
TRMB_SHEB8      ----EEGKYLRKIRSFVLREGRLTKGQAQAIES-QWPTMGLDY-------------SPTP
TRMB_SHEB5      ----EEGKYLRKIRSFVLREGRLTKGQAQAIES-QWPTMGLDY-------------SPTP
TRMB_SHEB9      ----EEGKYLRKIRSFVLREGRLTKGQAQAIES-QWPTMGLDY-------------SPTP
TRMB_SHEFN      ----EDGKYIRKIRSFVLREGRLTKGQSQAIEA-HWPAMGLDY-------------TPQA
TRMB_SHEDO      ----EEGKYLRKIRSFVLREGRLTKGQAQAIEA-HWPTMGLDY-------------TPEA
TRMB_SHEHH      ----EEGKYLRKVRSFVLREGRLTKGQAQAMEQ-QWPIMGLDY-------------TPES
TRMB_SHEPA      ----EEGKYLRKVRSFVLREGRLTKGQAQAMEQ-QWPKIGLDY-------------TPEP
TRMB_SHESH      ----EEGKYLRKVRSFVLREGRLTKGQAAAMEQ-HWPAMGLDY-------------SPEP
TRMB_SHEAM      ----EDGVYLRKVRSFVLREGRLTTGQAKALES-FWPTMGLDY-------------SPQA
TRMB_VIBPA      ----EDGKLIRKIRSFVRREGRLTKGQENAMNE-CWPTMGIDY-------------KAEL
TRMB_VIBCB      ----EDGKMIRKIRSFVRREGRLTKGQENAMNE-CWPTMGIDY-------------KAEL
TRMB_VIBVY      ----EDGKLIRKIRSFVRREGRLTKGQENAMKE-CWPTMGIDY-------------QKQL
TRMB_VIBVU      ----EDGKLIRKIRSFVRREGRLTKGQENAMKE-CWPTMGIDY-------------QKQL
TRMB_VIBCH      ----EDGKVLRRIRSFVRREGRLTKGQEAAMKE-CWPTMGIDY-------------QPEL
TRMB_VIBC3      ----EDGKVLRRIRSFVRREGRLTKGQEAAMKE-CWPTMGIDY-------------QPEL
TRMB_PHOPR      ----EDGKLVRKIRSFVRREGRLTKGQESAMDN-NWSTMGIDF-------------AQQM
TRMB_AERHH      ----EDGKFMRKIRSFVRREGRLTKGQEKALEE-LWPVMGIDF-------------APEP
TRMB_PSEA6      ----ESGVYIRKIQSFVKREGRLTKGQEKAIES-NWETMGLEH-------------KSGL
TRMB_PSEHT      ----QEGKYIRTIRSFVKREGRLTKGQAAAIEK-CWPIMGLEH-------------KNGM
TRMB_COLP3      ----QEGKYIRKVRSFVKREGRLTNNQERAIND-HWQTMGLNH-------------SDGV
TRMB_PSYIN      ----EKHKYMRKIRSFVKREGRMTNRQQTAIDT-LWDTMGIDF-------------EEKL
TRMB_SALCH      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEAP
TRMB_SALPA      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEAP
TRMB_SALTI      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEAP
TRMB_SALAR      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEAP
TRMB_SALTY      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEAP
TRMB_ECOL6      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_ECOUT      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_ECOK1      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_ECOL5      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_ECOHS      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_ECO57      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_ECOLC      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_SHISS      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_ECO24      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_SHIFL      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_ECOLI      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_SHIF8      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_SHIDS      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_SHIBS      ----ENGRPLRRIRSFVRRQGRLTKGQEHALEN-YWPVMGVEF-------------SEDM
TRMB_KLEP7      ----ENGRPLRRIRSFVRRQGRLTKGQQHALDN-IWPVMGVEF-------------NDAP
TRMB_CROS8      ----ENGRPLRRIRSFVRRQGRLTKGQQHALDH-YWPVMGVEY-------------RAEP
TRMB_YERPE      ----ENGRALRRIRSFVRRQGRLTKGQQLALDS-YWPVMGVEY-------------QAAP
TRMB_YERPP      ----ENGRALRRIRSFVRRQGRLTKGQQLALDS-YWPVMGVEY-------------QAAP
TRMB_YERPA      ----ENGRALRRIRSFVRRQGRLTKGQQLALDS-YWPVMGVEY-------------QAAP
TRMB_YERPN      ----ENGRALRRIRSFVRRQGRLTKGQQLALDS-YWPVMGVEY-------------QAAP
TRMB_YERP3      ----ENGRALRRIRSFVRRQGRLTKGQQLALDS-YWPVMGVEY-------------QAAP
TRMB_YERPS      ----ENGRALRRIRSFVRRQGRLTKGQQLALDS-YWPVMGVEY-------------QAAP
TRMB_YERE8      ----ENGRAMRRIRSFVRRQGRLTKGQQLALDN-YWPVMGVEY-------------QPTP
TRMB_SERP5      ----ENGRAMRRIRSFVRRQGRLTKGQQHALDN-YWPVMGVEY-------------QAEP
TRMB_PECAS      ----ENGRPMRRIRSFVRRQGRLTNGQQLALDN-YWPVMGVEY-------------QTEP
TRMB_PHOLL      ----ENGRALRRVRSFVRRQGRLTNRQQQALDN-LWPKIGVEY-------------QAEK
TRMB_SODGM      ----EQGRALRRIRSFVRRQGRLTKGQQYALDT-LWPAMGTDY-------------QAQP
TRMB_IDILO      ----AAGKYVRTVRSFVKREGRLTKGQAAAIER-LWPTVGLTL-------------ENGR
TRMB_ACTP2      ----EDGRYLRKVRSFVLRTGRLSDYQRDMMNN-NWANLGLDY-------------QNTP
TRMB_HAEDU      ----EDGRYLRKVRSFVLRTGRLSDFQRDMMND-HWAKFGLDY-------------QKSP
TRMB_HAES1      ----EDGRYKRKVRSFVLRTGRLSEFQRNMMNN-NWATLGLEY-------------QTTA
TRMB_HISS2      ----EDGRYKRKVRSFVLRTGRLSEFQRNMMNN-NWATLGLEY-------------QTTA
TRMB_MANSM      ----EDGRYKRKVRSFVLRTGRLSEFQRNMMND-NWADFGLEH-------------QNNY
TRMB_HAEI8      ----EDGRYKRKVRSFVLRTGRLSEFQRNMMND-NWGTLGLDY-------------QTEP
TRMB_HAEIN      ----EDGRYKRKVRSFVLRTGRLSEFQRNMMND-NWGTLGLDY-------------QTEP
TRMB_HAEIG      ----EDGRYKRKVRSFVLRTGRLSEFQRNMMND-NWGTLGLDY-------------QTEP
TRMB_HAEIE      ----EDGRYKRKVRSFVLRTGRLSEFQKNMMND-NWGTLGLDY-------------QTEP
TRMB_PASMU      ----AEGRYKRKVRSFVLRTGRLSEFQKNAMNQ-HWGFYGLEH-------------QNQP
TRMB_ACTSZ      ----EDGRYKRKIRSFVLRTGRLSEYQRQMMND-NWSNYGLDY-------------QTEP
TRMB_HAHCH      ---------LRPIRSFVIRGGRMTASQQKAFDR-LWPEKGLAV-------------ENGL
TRMB_MARHV      ----NPVTTRRGVRSFVLRQGRMTEGQKKAFDR-NWAKYGLSR-------------DNGM
TRMB_SACD2      ---------KKSIRSFVIRGGRMTEGQKNAFDK-WWPHYGVSL-------------FDGP
TRMB_ALCBS      ----ETGKVMRKVRSFVLREGRLTAGQRNALDT-LWPRFGLER-------------DQGM
TRMB_PSEPK      ----GEARPHRRIKSFVMRAGRMTEGQQRGLDQ-GGPLYILPL-------------ADSP
TRMB_PSEPG      ----GEARPHRRIKSFVMRAGRMTEGQQRGLDQ-GGPLYILPL-------------ADSP
TRMB_PSEP1      ----GEARPHRRIKSFVMRAGRMTEGQQRGLDQ-GGPLYILPL-------------ADSP
TRMB_PSEE4      ----GEARPHRRIKSFVMRAGRMTEGQQRGLEQ-GGPLFILPL-------------ADSP
TRMB_PSEPF      ----GDERQHRRIKSFVMRAGRMTEGQQRGLDQ-GAPKFVLPL-------------ADAP
TRMB_PSEF5      ----GDERQHRRIKSFVMRAGRMTEGQQRGLDQ-GAPLYVLPL-------------ADAP
TRMB_PSEU2      ----GEERPHRRIKSFVMRAGRMTEGQQRGLDQ-GLPLYGLSL-------------TDTP
TRMB_PSE14      ----GEERPHRRIKSFVMRAGRMTEGQQRGLDQ-GLPLYGLSL-------------TDAP
TRMB_PSESM      ----GEERPHRRIKSFVMRAGRMTEGQQRGLDQ-GRPLFGLSL-------------TDTP
TRMB_PSEAE      ----DEARPMRTVKSFVMRAGRMTEGQQRGLDL-GWPKFGLEL-------------SDEV
TRMB_PSEA7      ----DEARPMRTVKSFVMRAGRMTEGQQRGLDL-GWPKFGLEL-------------SDEV
TRMB_PSEAB      ----DEARPMRTVKSFVMRAGRMTEGQQRGLDL-GWPKFGLEL-------------SDEV
TRMB_PSEMY      ----EDGRQRRTIKSFVMRAGRMTEGQQRGLDK-GWPLFGLEL-------------EDGL
TRMB_PSEU5      ----QQSAPRRTIKSFVMRAGRMTEGQQRGLEQ-GWPKYGLEL-------------ADGL
TRMB_CHRSD      ----SPGRPPRGIKSYVLRAGRMTAAQSRGLEE-VWPRLGLSV-------------AEGR
TRMB_HYDCU      ----DIPEHKRRIKSFVLRQGRLSQAQQNAIDT-MWPQYGLTL-------------EDKL
TRMB_LEGPA      --------MQRKIKSYVLRAGRISNRQQQGLDL-WLEDYELKFD------------SPTP
TRMB_LEGPH      -------MMQRKIKSYVLRAGRISNRQQQGLDL-WLEDYELKFD------------SPTP
TRMB_LEGPL      --------MQRKIKSYVLRAGRISNRQQQGLDL-WLEDYELKFD------------SPSP
TRMB_LEGPC      --------MQRKIKSYVLRAGRISNRQQQGLDL-WLEDYELKFD------------SPSP
TRMB_FRATF      -----SKENLRQIKSYVQRAGRVTKKQQQALDN-YAAKYLIEYA------------KDRK
TRMB_FRATN      -----SKENLRQIKSYVQRAGRVTKKQQQALDN-YAAKYLIEYA------------KDRK
TRMB_FRATO      -----SKENLRQIKSYVQRAGRVTKKQQQALDN-YAAKYLIEYA------------KDRK
TRMB_FRAP2      -----SKENLRQIKSYVQRAGRVTKKQQQALDD-YASKYMIEYD------------QNKS
TRMB_TREDE      ----DVPSHFRSIKTFVLRTGRMTEGQKRNYEA-FYQKWCIPY-------------TESP
TRMB_TREPA      ----NDSARMRKVLTFTRRSNRMTACQKRDYQH-LASRWIIPY-------------QNTV
TRMB_BUCAI      ----LEGVFLRQIHSFVCRKGRTTTSQLSAIKK-YWSLIGVDFQL-------------NA
TRMB_BUCAP      ----CNGTFLRKNRSFVCRKGRITKSQLQAIEK-YWLSIGIDFKL-------------EP
TRMB_BUCBP      ----INNMIMRRVRSFVSRNRKLTQNKRQFLKN-YLLKYGIDFSC-------------SY
TRMB_NOCFA      --SPTGSRLYPRVTSFRSRRGALTPNQQGAWDR-MWPRIGREVGDEP-------------
TRMB_RHOJR      --DSKGSRLHPRVTSFRSRRGALTVAQQESWDR-QWPRIGADVSDHR-------------
TRMB_MYCSK      GDDSPSAHRHRRVTSFRSRRSALSGGQQDTWER-LWPELGTEARDDDGRPAAL-------
TRMB_MYCSS      GDDSPSAHRHRRVTSFRSRRSALSGGQQDTWER-LWPELGTEARDDDGRPAAL-------
TRMB_MYCGI      --EGVHPHFNRRVTSFRARRSTISDGQQATWDR-LWPQLGRQARDGDEPPGP--------
TRMB_MYCVP      --DPPHPHFNRRVTSFRARRSTISDAQQATWDR-LWPELGRQVRDGDAPAGRLDTTPAGR
TRMB_MYCBP      ----------LPSTSIRSRRSGISKAQRETWER-LWPELGLLALPQS---PRG-----TP
TRMB_MYCTU      ----------LPSTSIRSRRSGISKAQRETWER-LWPELGLLALPQS---PRG-----TP
TRMB_MYCBO      ----------LPSTSIRSRRSGISKAQRETWER-LWPELGLLALPQS---PRG-----TP
TRMB_MYCUA      PEAEKSAWGYLPPTAFRSRHSALSSIQQQTWER-RWPQLGRQATAHSQPSARGHE-PIDP
TRMB_MYCA1      ----RSEQRYFPATAFRTRRSTLSDAQRQTWDR-RWPELGLSVGPAEDPDRPG-----PP
TRMB_MYCPA      ----RSEQRYFPATAFRTRRSTLSDAQRQTWDR-RWPELGLSVGPAEDPDRPG-----PP
TRMB_MYCLE      ------MARHLPATAFRKRRSALSHAQRQTWER-LWPEIGIS---AVSQTRSA-----ER
TRMB_CORGB      -----NDLDYPRLGSVTFRRGTLTENQQTMWDE-KWPELGRVL---EDEL----------
TRMB_CORGL      -----NDLDYPRLGSVTFRRGTLTENQQTMWDE-KWPELGRVL---EDEL----------
TRMB_COREF      -----DDLDYPRLGSVTFRRGTLTENQQTMWNE-KWPELGRVL---EDEL----------
TRMB_CORDI      -----NNLDYPRLGSVSFRRGTLTDNQESLWDA-NWPILGKDLTDAEDQR----------
TRMB_CORJK      -----DGRDYPRLGNFSFRRGTLTDNQEALWNE-HWPKLGKVL---ADEV----------
TRMB_CUTAK      -----GDRVRRGVVSFVRRSPRMNVSQQRAMNT-LASTYLIDVPRDATSTSVAPGSRLDL
TRMB_NOCSJ      ---------MREVLTYSRRGSRFSPRQQQAWAA-YAERWW--VPDEAVDD---PG--FTL
TRMB_PAEAT      -----FGTYGGRPVSFVRRGTRLQGRRQAAWEE-HAERWAIQVPRHVANTSVHPDYTFDA
TRMB_ARTS2      -----FGTYGGRPVSFVRRGTRLQGRRQQAWEE-HSDRWAVDVPRHIANTSVHPDYVFDA
TRMB_BIFAA      -----PALYGRKVLSFVRRSARLDARLQRAWDT-YADTYLLNINAGEGSLGVREGFVFDQ
TRMB_BIFLO      ---------LHKVLSFVRRSGRLDDRLQRAWDN-YAGTYLLDIAAGN-LLDVREGVTLDR
TRMB_PSYCK      EVAPDGNKHIRIVNTFMKRRTHMNKNAELALTAPEFAHYLVNNSFGDGN-------LEGI
TRMB_PSYA2      EAMPDDSKHIRIVNTFMKRRTHMNKNAELALTAPEFAHYLVNNSFGDGN-------LDGI
TRMB_ACIAD      ---LDNLPEHREIVTFMRRSAPLNTSQRSALE--QYQDLILEYPVG--------------
TRMB_RHIME      ---------RATEAFFGRRKGKPLRERQAAHLEHLLPLLKL------------DLEEPAP
TRMB_SINMW      ---------RATEAFFGRRKGKPLRERQAAHLENLLPELKI------------DLEHAAP
TRMB_RHIEC      ---------RATEAFFGRRKGKALREQQAETLNSLLPAFLI------------DLSAAPP
TRMB_RHIL3      ---------RATEAFFGRRKGKALREQQAETLNSLLPAFLI------------DLSAAPP
TRMB_AGRFC      ---------RATEAFFGRRKGKPLRNQQVDTIENLLPLLKI------------DLESVPP
TRMB_RHILO      ---------RTTEAFFGRRRGKPVRPQQAAALESGLDAYRL------------DLTADAP
TRMB_BRUAB      ---------RAAGNFFGRRHGKPLRPHQSNLFEDLLPRLKL------------DLATPAP
TRMB_BRUA2      ---------RAAGNFFGRRHGKPLRPHQSNLFEDLLPRLKL------------DLATPAP
TRMB_BRUME      ---------RAAGNFFGRRHGKPLRPHQSNLFEDLLPRLKL------------DLATPAP
TRMB_BRUSU      ---------RAAGNFFGRRHGKPLRPHQSNLFEDLLPRLKL------------DLATPAS
TRMB_OCHA4      ---------RGAGNFFGRRHGKPLRSHQKNLFEDLLPRLKI------------NVENPAP
TRMB_CHESB      ---------RSTEAFFGRRRGKRLRSQQTAAVEKLLPRLKL------------DLSSPAP
TRMB_BARQU      ---------HLSEAFFGRRKGKRLRNSQLARIKMLLPTLKI------------DLNNSAP
TRMB_BARHE      ---------RTGKAFFGRRKGKRLRNSQLVLIKKLFPTLDI------------NLNNSVP
TRMB_BARBK      ---------CIDKAFFGRRQGKQLRSNQLTSIKTLLPILNI------------DLNKPAP
TRMB_AZOC5      ---------EHKGAFYGRRVGKTLRQGQQQALARTLPRYLI------------DLPTVA-
TRMB_RHOPS      VFIDMNETVHHQGSFFGRRKGHKLRAHQADLVDNLLPHLAL------------DIELPAP
TRMB_RHOP2      AFIDMNESVHHQGSFFGRRKGHKLRAHQADLVDKLLPHLAL------------AIDGPAP
TRMB_RHOPA      EDHDGDVVMHGQGSFFGRRKGHKLRAHQADLIENLLPHLSL------------QIDSPAP
TRMB_NITHX      SPRCESGQ----GSFFGRRKGHKLRPHQNGLIEHLLPRLSL------------DPGASGP
TRMB_NITWN      PLGRTGNRDRPPGSFFGRRKGHRLRPHQNDLVAQLLPRLGF------------DPARIGP
TRMB_RHOP5      ADATADSASRGHGSFFGRRKGHKLRAHQAELIADLLPQLSF------------DLAAPPP
TRMB_RHOPB      AMP--------ERAFFGRRKGHKLRSHQADLIAELLPRLSF------------DLGAPAP
TRMB_BRADU      DDS--------ERAFFGRRKGHKLRQHQAELIDHLLPHLAL------------DIAGEAP
TRMB_RUEST      DAAGKHASGAPWRNFYGRFKGKTLKPNQVRDLDEMLPELSPGAVGWD------ENPEREP
TRMB_RUEPO      -----------RRNFYGRIKGKTLKPNQRTYLDEDLTPLAPGPVSWQ------DNPTRQP
TRMB_ROSDO      -----------HRNFYGRLKGKSLKAAQKRYLDEDLAALSPGAVGWE------ENPDRRP
TRMB_JANSC      -----------HRNFYGRRKGHDLRDSQERYLAEDLAKLSPGAVDWD------VNPDRTP
TRMB_PARDP      --------NPPRRNFYGRRHGKTLRQSQKGYLSEDLGSLRPRGITVQ------ENPERKP
TRMB_RHOS4      --------GPAWRNFYGRRSGKTLRPSQKVYLSEDLGRLRPEGITRE------ENPERRP
TRMB_RHORT      ---------TEDARFYGRRKGKPLRATRQRLLDTMLPALTLPLA---------GLGEGER
TRMB_MAGSA      -------AAAERPRFFGRRQGKALRRNALGLIEDLLPRLTVAVP---------EPD--ER
TRMB_GRABC      ---------SQPDRLYGRQRGHALRPRQQRLLDLTLPRLRYAG-----------------
TRMB_NOVAD      ---------TTINRLYGRAKGKPLRQGQQALVDELLPQISM--------------PAEGP
TRMB_SPHAL      ---------TTLNRLYGRSKGKPLRAGQQDLVDTLLPQIAV--------------PLDGE
TRMB_ERYLH      ---------TTLNRLYGRSIGKPLRTHQQHLVDNLLPQISP--------------PAEGP
TRMB_ZYMMO      ---------LTIRRLYGRQQGHSLRPKQAELVETLLPQLEI--------------TTEQA
TRMB_CAUVC      ---------HGPLRSFGRLKSRPVKPRQQALLDTLLPEIAVPT---------------GP
TRMB_CAUSK      ---------HGPLRSFGRLKSRPVKPRQQALLDTLLPQIAVPT---------------AP
TRMB_MARMM      ---------NPAFRLFGRSQGKPLSARQQRLVDEFLPRIGLPD--------------DGP
TRMB_HYPNA      ------------MRSFGRTGGRPLSPRQKTLMAEKLDTYRIAEG-------------DGP
TRMB_MAGMM      EAEAK----RRRFKTHGRKKGK-VNDTRLARIEAGLLALSLPP----------GSADRGA
TRMB_HELPY      RIFLLQKIRR--ANDFLIKSEKATPLKRE-VLKQALRIYSQ--SFEVISHNLQENSKHAS
TRMB_HELPH      RIFLLQKIRR--ANDFLIKSEKTTPLKRE-ILKQALRIYSQ--SFEVISHNLQENSKHAS
TRMB_HELPJ      DVFLLQKIRR--AGDFLIKSEKATPLKRE-ILKQALRIYSQ--SFEVISHNLQENSKHAS
TRMB_HELAH      HIFLLQKIRR--ANDFLIKSEKATPLKRE-ILKQALRIYAQ--SFEVILHNLQENSKHAS
TRMB_WOLSU      KEFFLRIKHRLKENDFIIRFDKSTRVSPVGIIKKALRIFAQKSQAQILSDNLSEEDSIRQ
TRMB_HELHP      NEFFLRKAWRGNKNNAILKCEKSTKTQPTGIIKNALKILCA-YQKNVISHNLNK-NTPRQ
TRMB_CAMJE      ESFFLQIKKA--QNGFVIKGDKHTKPSKIGYLQKALKIFKEGFCEDIINEAFGLKNNALI
TRMB_CAMJR      ESFFLQIKKA--QNGFVIKGDKHTKPSKIGYLQKALKIFKEGFCEDIINEAFGLKNNALI
TRMB_CAMJ8      ESFFLQIKKA--QNGFVIKGDKHTKPSKIGYLQKALKIFKEGFCEDIINEAFGLKNNALI
TRMB_CAMJJ      ESFFLQIKKA--QNGFVIKGDKHTKPSKIGYLQKALKIFKEGFCEDIINEAFGLKNNALI
TRMB_CAMJD      ESFFLQIKKA--QNGFVIKGDKHTKPSKIGYLQKALKIFKEGFCEDIINEAFGLKNNALI
TRMB_CAMFF      KEFFLLVKDK--KTEFVVKSDKLTRPASLGTIQKALSVYKDLNVLDLKSSTIAIKNEKQL
TRMB_SULDN      DEFFLLAIDE--NSKKLLKSDKLTRPPSIFNVHKALLSYASATCMNIISSNVPQNQKNIH
TRMB_GEOTN      ----------------MRLRNKPWAKDKIAAYPQYVIPDPEA----------------RR
TRMB_GEOKA      ----------------MRLRNKPWAKDKIAAYPQYVIPDPET----------------KR
TRMB_BACHK      ----------------MRLRHKPYAMDRINEYSHIVIGNPEE----------------RA
TRMB_BACC1      ----------------MRLRHKPYAMDRINEYSHIVIGNPEE----------------RA
TRMB_BACAN      ----------------MRLRHKPYAMDRINEYSHIVIGNPEE----------------RA
TRMB_BACCZ      ----------------MRLRHKPYAMDRINEYSHIVIGNPEE----------------RA
TRMB_BACCR      ----------------MRLRHKPYAMDRINEYSHIVIGNPEE----------------RA
TRMB_BACAH      ----------------MRLRHKPYAMDRINEYSHFVIGNPEE----------------RA
TRMB_BACCN      ----------------MRLRHKPYAMDRIKEYSQFVIGNPEE----------------HR
TRMB_BACSU      ----------------MRMRHKPWADDFLAENADIAISNPAD----------------YK
TRMB_BACVZ      ----------------MRMRHKPWANDFLAENADIAISDPAQ----------------YK
TRMB_BACLD      ----------------MRMRHKPWADDYLAENSHIVISEPSQ----------------YK
TRMB_LISIN      ----------------MRVKHKPWAKDRLEEFPAIYIKNPED----------------FK
TRMB_LISW6      ----------------MRVKHKPWAKDRLEEFPAIYIKNPED----------------FK
TRMB_LISMO      ----------------MRVKHKPWAKDRLEEFPAIYIKNPED----------------FK
TRMB_LISMF      ----------------MRVKHKPWAKDRLEEFPAIYIKNPED----------------FK
TRMB_STRT2      ----------------MRVRKRKGAEEHLANHPQYVILEPEA----------------AK
TRMB_STRTD      ----------------MRVRKRKGAEEHLANHPQYVILEPEA----------------AK
TRMB_STRT1      ----------------MRVRKRKGAEEHLANHPQYVILEPEA----------------AK
TRMB_STRA1      ----------------MRVRKRKGAEEHLENNPHYVISNPEE----------------AK
TRMB_STRA5      ----------------MRVRKRKGAEEHLENNPHYVISNPEE----------------AK
TRMB_STRA3      ----------------MRVRKRKGAEEHLENNPHYVISNPEE----------------AK
TRMB_STRP3      ----------------MRVRKRKGAEEHLANNPHYVILNPED----------------AK
TRMB_STRPB      ----------------MRVRKRKGAEEHLANNPHYVILNPED----------------AK
TRMB_STRPF      ----------------MRVRKRKGAEEHLANNPHYVILNPED----------------AK
TRMB_STRPM      ----------------MRVRKRKGAEEHLANNPHYVILNPED----------------AK
TRMB_STRPC      ----------------MRVRKRKGAEEHLANNPHYVILNPED----------------AK
TRMB_STRP1      ----------------MRVRKRKGAEEHLANNPHYVILNPED----------------AK
TRMB_STRPD      ----------------MRVRKRKGAEEHLANNPHYVILNPED----------------AK
TRMB_STRPG      ----------------MRVRKRKGAEEHLANNPHYVILNPED----------------AK
TRMB_STRP8      ----------------MRVRKRKGAEKHLANNPHYVILNPED----------------AK
TRMB_STRP6      ----------------MRVRKRKGAEEHLANNPHYVILNPED----------------AK
TRMB_STRSY      ----------------MRVRNRKGASELLANNPQYVISNPEE----------------CK
TRMB_STRS2      ----------------MRVRNRKGASELLANNPQYVISNPEE----------------CK
TRMB_STRMU      ----------------MRVRRRKGAKEHLENNPRYVILKPEE----------------VK
TRMB_STRSV      ----------------MRVRNRKGATELLEAHPQYVILNPAD----------------AK
TRMB_STRGC      ----------------MRVRNRKGATELLEANPQYVVLNPAD----------------AK
TRMB_STRR6      ----------------MRVRNRKGATELLEANPQYVVLNPLE----------------AK
TRMB_STRPN      ----------------MRVRNRKGATELLEANPQYVVLNPLE----------------AK
TRMB_STRP2      ----------------MRVRNRKGATELLEANPQYVVLNPLE----------------AK
TRMB_LACLM      ----------------MRVRNRKGAGEMLAENAHIVVENPAD----------------FK
TRMB_LACLA      ----------------MRVRNRKGAGEMLAENAHIVVENPAD----------------FK
TRMB_LACLS      ----------------MRVRNRKGAGEMLAENAHIVVENPAD----------------FK
TRMB_ENTFA      ----------------MRVRNRPGAAEYMAKYPQYVVEGPEK----------------WQ
TRMB_BACHD      ----------------MRLRNKPWARDAIAQNPDLVIQQPAT----------------WK
TRMB_BACSK      ----------------MRLRHKPWASEELAKRPNLVIQQPEQ----------------HK
TRMB_OCEIH      ----------------MRQRNKPWADEYLQENNHIVISDPKS----------------KK
TRMB_STAES      ----------------MRVRYKPWAEDYLKNHPDLVDMD-GA----------------HA
TRMB_STAEQ      ----------------MRVRYKPWAEDYLKNHPDLVDMD-GA----------------HA
TRMB_STAHJ      ----------------MRVRYKPWAEDYLKEHPNLVDMD-GA----------------HA
TRMB_STAA3      ----------------MRVRYKPWAEDYLKDHPELVDMD-GQ----------------HA
TRMB_STAA8      ----------------MRVRYKPWAEDYLKDHPELVDMD-GQ----------------HA
TRMB_STAAB      ----------------MRVRYKPWAEDYLKDHPELVDMD-GQ----------------HA
TRMB_STAAC      ----------------MRVRYKPWAKDYLKDHPELVDMD-GQ----------------HA
TRMB_STAAS      ----------------MRVRYKPWAEDYLKDHPELVDMD-GQ----------------HA
TRMB_STAAW      ----------------MRVRYKPWAEDYLKDHPELVDMD-GQ----------------HA
TRMB_STAAM      ----------------MRVRYKPWAEDYLKDHPELVDME-GQ----------------HA
TRMB_STAAN      ----------------MRVRYKPWAEDYLKDHPELVDME-GQ----------------HA
TRMB_STAAR      ----------------MRVRYKPWAEDYLKDHPELVDMD-GQ----------------HA
TRMB_STAS1      ----------------MRMRYKPWAEDYLKKEPNIVDID-GS----------------HA
TRMB_LACRD      ----------------MRVKHKKWADPLIAAHPELMIDDATQ----------------FK
TRMB_PEDPA      ----------------MRVRNKPWAPELIEAHPEKIVEKGQA----------------FK
TRMB_LACPL      ----------------MRVRNKPWAPKLIAAHPELITEDPTQ----------------LK
TRMB_LACS1      ----------------MRLRNKPWAKPLIEENPDFVVTEPTK----------------LK
TRMB_LACSS      ----------------MRLRNKPWAADLIAENPDMILVSPEN----------------IA
TRMB_LACP3      ----------------MRLRNKQWAKPLILAHPEMILVRPEK----------------MQ
TRMB_LACBA      ----------------MRVRNKPWAKGYMADHLDRLVVEPEP----------------LK
TRMB_LACJO      ----------------MRLRNKPWAQKLVAEHPEVILNEPDPD---------------KK
TRMB_LACGA      ----------------MRLRNKPWAQKLVVEHPEAILNEPDPE---------------KK
TRMB_LACDA      ----------------MRLKNKPWANELVEEHPESALDRPDPA---------------EK
TRMB_LACDB      ----------------MRLKNKPWANELVEEHPESALDRPNPA---------------EK
TRMB_LACAC      ----------------MRLRNKPWAVKLVNDHPESVLQNPNPD---------------EK
TRMB_LACH4      ----------------MRLRNKPWAVKLVNEHPESVLQNPDPE---------------KK
TRMB_LEUMM      ----------------MHLRSKPWASDWLAEHSDIVIDQDRAT--------------AQI
TRMB_OENOB      ----------------MRLRSKKWAVPFIDEHPDLIIKDQRAK--------------QLK
TRMB_LACP7      ----------------MRLRNIPGSRE-YIAQNDYVVHDPEQ---------------K-K
TRMB_CLOD6      ----------------MRRRRKKGADEKLLSYTKYVLRDDID---------------KLK
TRMB_ALKOO      ----------------MRVRNISNAKELLKEYKEYVAAP--Q---------------LFK
TRMB_ALKMQ      ----------------MRVRHIPGAKEQLKEYEFYIQDP--S---------------QYQ
TRMB_CLOPS      ----------------MRMRRKPWARPELEACDF--FVANPK---------------ENK
TRMB_CLOP1      ----------------MRMRRKPWARPELEACDF--FVANPK---------------ENK
TRMB_CLOPE      ----------------MRMRRKPWARPELEACDF--FVANPK---------------ENK
TRMB_CLOB8      ----------------MRMRKKPWARPELEGCDF--FVINPK---------------EYK
TRMB_HUNT2      ----------------MRLRKKPWARPALEACSF--FVINPT---------------EYK
TRMB_CLOTE      ----------------MRLRKKWWARPEMEASSL--VITNPK---------------EYK
TRMB_CLOK5      ----------------MRLRKKWWARPEMEASNL--TIINPS---------------LFK
TRMB_CLOAB      ----------------MRLRKKWWARPEMEASPL--CIVNPK---------------DYK
TRMB_CLONN      ----------------MRLRKKWWARPELEASPIFKSLDEAR---------------ELK
TRMB_DESHY      ----------------MRLRRKAWARPELESDPK--VIYNPM---------------HYK
TRMB_MYCGE      ----------------MRLRKVKNALLKINQSPYFYSKDKFA----------------KF
TRMB_MYCPN      ----------------MRLRKVKDALVRVQDSPYFSNPEQLS----------------TI
TRMB_UREPA      ----------------MRLRNNANAPLYLKSQHEYIINDPHL----------------LK
TRMB_UREP2      ----------------MRLRNNANAPLYLKSQHEYIINDPHL----------------LK
TRMB_MYCCT      ----------------MRLRKKAWTNEFLNQHTYYLIKYD------------------KK
TRMB_MYCMS      ----------------MRLRKKNWTDDFLNQHSFYLINYNN-----------------KK
TRMB_MESFL      ----------------MRLRNKPWVKEYLEKNDKYLISWDKE----------------TK
TRMB_MYCGA      ----------------MRIRNIRDAHLKINKAKNIIGVDNLK----------------TK
TRMB_MYCPE      ---------------MGRLRKDYQDELRLFNSQEFYVLNPNQ----------------YK
TRMB_MYCPU      ----------------MRLRNNKNAKLELESCENVIKNFPFK----------------VE
TRMB_MYCHP      ----------------MRLRFNKNAETSLMASPMTFKDFPID----------------NK
TRMB_MYCH2      ----------------MRLRNIPDALERIQNQNLLVKT-PWN----------------ID
TRMB_MYCH7      ----------------MRLRNIPDALERIQNQNLLVKT-PWN----------------ID
TRMB_MYCHJ      ----------------MRLRNIPDALERIQNQNLLVKT-PWN----------------ID
TRMB_MYCMO      ----------------MRVRRDKNLEKILDVDPLVISKFPFK----------------LK
TRMB_MYCS5      ----------------MRLRNDKFALSELNEFKFFIKNYPFN----------------IK
TRMB_BACFR      ---------MG-KNKLEKFADMASYPHVFEYPYSAVDNVP--F--------------DMK
TRMB_BACFN      ---------MG-KNKLEKFADMASYPHVFEYPYSAVDNVP--F--------------DMK
TRMB_BACTN      ---------MG-KNKLEKFADMASYPHVFEYPYSAVDNVP--F--------------DMK
TRMB_PORGI      ---------------------METFPHVFQYPFAVLQQQESGF--------------PLR
TRMB_GRAFK      ---------MGSKNKLRRFKENEKFENVIQPSREELTDNV--F--------------ELK
TRMB_CYTH3      ----------MARKKLMRFKWNEEVHNLFQPEKENYKAYK--------------------
TRMB_CHLSY      -----MGRGRYPARLYVTAPPPEIAARYYRSWPAKELYHTPEH--------------FPP
TRMB_CHLAA      -----MGRGRYPARLYVTAPPPEIAARYYRSWPAKELYHTPEH--------------FPP
TRMB_CHLAD      -----MGRGRYPARLKVTVPPPEIAARYYRSWPAHELYHHPDR--------------FPL
TRMB_CHLT3      ---MGKGRGRHPSRLKVKPPEPEILAKYLHHWNTKELYHHPDT--------------FLQ
TRMB_RUBXD      -----MTR-RKLGRMKVRPPDPETAQRYLLRFTGRQLYHEAER--------------LPG
TRMB_THEMA      ----------------MVVTEYELKPQNFPRFP---------------------------
TRMB_COPPD      ----------------MLIKPQSTSSFPLNWDAIFPEK----------------------
TRMB_CHLPD      --------------MFMDSRETLCENPVIITDRDAWKEINLKD-----------------
TRMB_AQUAE      ---------------MLCYVNYKRVKRPVEIPN---------------------------
TRMB_NEOSM      -------MFVHNEVNLRLEKKQFLRSYGRRRGRNFRENKLVGL--------------ERF
TRMB_WOLPM      ----------MLFKNSKWIGSFSRRSRLKPDVDEILEKYSIQN---------------SK
TRMB_RHOBA      RVTMTAHGLSHFPRQLLRMPRAALRKPNPALDLDSWLKTPEDL--------------PAT
TRMB_BDEBA      ----------------MALNGEYAHVAFDELRAPLN----------------------KG
                                                                            

TRMB_TRIV2      LEWEKVYSSPH-------------------------QPLHLDIGCARGRFVLQMAQVEPR
TRMB_NOSS1      LEWEKAYSTPH-------------------------QPLHLDIGCARGRFVLQMAQVEPN
TRMB_MICAN      PDWNQVYQDMT-------------------------QPLHLDIGCARGKFLLQMAQVEPE
TRMB_SYNP6      PDWQQVYADCD-------------------------RPLHLDIGCARGRFLLAMATAQPE
TRMB_SYNE7      PDWQQVYADCD-------------------------RPLHLDIGCARGRFLLAMATAQPE
TRMB_TRIEI      PNFSDIYADIK-------------------------KPLYLDIGCARGRFLWQMAQVEPE
TRMB_SYNY3      PDWATVYDDVQ-------------------------RPLHLDIGCARGRFPLKMAQQHPD
TRMB_THEEB      PDWSRIYEQPS-------------------------QPLHLDIGCARGTFLLEMAALYPE
TRMB_SYNJA      PHWERVYRRLG-------------------------QPLHLDIGSGSGRFLLRMAQEQPD
TRMB_SYNJB      PHWERVYRRLG-------------------------QPFHLDIGTGSGRFLLRIAQEQPD
TRMB_PROMM      PSPEEMFAQSS-------------------------RPLHLDIGCARGGFLLSLAPLQPE
TRMB_PROM3      PSPEEMFAQSS-------------------------RPLHLDIGCARGGFLLGLAPLQPE
TRMB_SYNSC      PPPEQLFRVPD-------------------------QPIHLDIGCARGRCLLGLAERDPH
TRMB_SYNPX      PSPGELFDHPE-------------------------QPIHLDIGCARGRCILGLAELNPG
TRMB_SYNS9      PPPSELFTHPE-------------------------HPIHLDIGCARGRCILDLADRHPN
TRMB_SYNS3      PAPHELFEHPN-------------------------LPIHLDIGCARGFFLLELAAMQPE
TRMB_SYNPW      PAPEQLFDDPG-------------------------RPIHLDIGCARGICLQELAALRPD
TRMB_PROMA      PRPEDLFESID-------------------------LPIHLDIGCARGKFLIDMAADNAQ
TRMB_PROMT      PSKNILFEKSH-------------------------YPIHLDIGSAKGEFLIELATKCPD
TRMB_PROM1      PSKNILFEKSH-------------------------YPIHLDIGSAKGEFLIELATKYPD
TRMB_PROMS      PSLGEMFGDSK-------------------------LNLHLDIGCAAGEFLFDLALVNTS
TRMB_PROM2      PSLSEMFGDSK-------------------------LNLHLDIGCAAGEFLFNLASVNTS
TRMB_PROM9      PALIEMFGDSK-------------------------SNLHLDIGCAAGEFLFDLALINTN
TRMB_PROMP      PPLNQVFENPK-------------------------LPLHLDIGCASGEFLFELSLKNKN
TRMB_PROM5      PPLNEVFENPQ-------------------------LPLHLDIGCASGDFLMELSLKNKN
TRMB_GEOSL      ADWTAVFG-ND-------------------------NPLALEIGCGIGDFIARTALDHPT
TRMB_GEOMG      ADWAAVFG-NA-------------------------NPLALEIGCGIGDFIARTAADNPG
TRMB_PELCD      ADFAAVFG-NR-------------------------NPLVLEIGCGIGDFVTQLASSAPE
TRMB_MYXXD      PDWDAEFG-FS-------------------------GPLELEIGSGAGGHALEYCRRHPE
TRMB_ANADE      PDWRARFGEAG-------------------------GRLELEIGCGHGGFALGFARAFPE
TRMB_THET8      DLFGRE------------------------------GPLVLEIGFGDGRFTAELARSRPD
TRMB_THET2      DLFGRE------------------------------GPLVLEIGFGDGRFTAELARSRPD
TRMB_DEIGD      RLYPDTPQ----------------------------RPWILEVGFGDGRFWPHYAATFPE
TRMB_DEIRA      RLYPDTPD----------------------------RPWVLEIGFGDGRFWPHYARTFPE
TRMB_CHLAB      ---EEFFGNN--------------------------HPIFCELCSGNGDWVVAQANKNPN
TRMB_CHLCV      ---EEFFGNN--------------------------NPISCELCSGNGDWVVSQAQNMPQ
TRMB_CHLFF      ---EEFFGND--------------------------NPISCELCSGNGDWVVAQAKETPE
TRMB_CHLTR      ---QELFANN--------------------------GPICCELCSGNGDWVVEQALKDAS
TRMB_CHLTA      ---QELFANN--------------------------GPICCELCSGNGDWVVEQALKDAS
TRMB_CHLMU      ---QNLFANE--------------------------GPVCCELCSGNGDWVVEQALKDTS
TRMB_CHLPN      ---QEFFQNH--------------------------TSIACELCSGNGDWVVAQAQKDPQ
TRMB_PARUW      --HDQTFAQD--------------------------KPIYLEYCSGNGAWIASKAIEQSQ
TRMB_LEPIN      ---ENLFSKVF-------------------------ETYFLELGSGWGEVAISMALQRPN
TRMB_LEPIC      ---ENLFSKVF-------------------------ETYFLELGSGWGEVAISMALQRPN
TRMB_LEPBJ      ---ENLFSKVF-------------------------ETYFLELGSGWGEVAIAMALQRRN
TRMB_LEPBL      ---ENLFSKVF-------------------------ETYFLELGSGWGEVAIAMALQRRN
TRMB_NITEU      VDLDSIFGRTA--------------------------PGILEIGSGMGETTAEIARQHPE
TRMB_NITEC      IDLDSIFGRTA--------------------------PKILEIGSGMGETTVEIAAQHPE
TRMB_NITMU      LDLAIIFSRSA--------------------------PKFLEIGFGMGETTALIAQAHPQ
TRMB_BURVG      PDWDAVFGRS--------------------------APRILEIGFGMGASTAEIAAHRPG
TRMB_BURCM      PDWDAVFGRS--------------------------APRILEIGFGMGASTAEIAAHRPG
TRMB_BURL3      PDWNAVFGRS--------------------------APRILEIGFGMGASTAEIAANRPG
TRMB_BURCH      PDWDAIFGRS--------------------------APRILEIGFGMGASTAEIAAHRPS
TRMB_BURCA      PDWDAIFGRS--------------------------APRILEIGFGMGASTAEIAAHRPS
TRMB_BURPS      PDWDAIFGRR--------------------------APRVLEIGFGMGASTAEIAALRPG
TRMB_BURP1      PDWDAIFGRR--------------------------APRVLEIGFGMGASTAEIAALRPG
TRMB_BURMA      PDWDAIFGRR--------------------------APRVLEIGFGMGASTAEIAALRPG
TRMB_BURTA      PDWDTVFGRR--------------------------APRVLEIGFGMGASTAEIAAHRPG
TRMB_PARXL      PDWNSVFGRE--------------------------APRVLEIGFGMGATTAEIASHRPD
TRMB_THIDA      LDLDAVFARV--------------------------APRVLEIGFGMGEGLAETAASHPE
TRMB_METFK      LDLDSLFGREG-------------------------SPKVLEIGFGMGDSTAKIAQSQPE
TRMB_CUPNH      LDWEATFGRK--------------------------APSILEIGFGMGETTAHIAGLRPQ
TRMB_CUPPJ      LDWEAAFGRK--------------------------APAILEIGFGMGETTAHIAQLRPQ
TRMB_CUPMC      LDWTATFGRE--------------------------APSILEIGFGMGETTAHIAGLRSQ
TRMB_RALSO      LDWEAAFGRTG-------------------------ARRIFEIGFGMGETSAHIAQLRPD
TRMB_ACISJ      LDATAAFGRSA--------------------------PLVLEIGFGMGEATAHIARVRPQ
TRMB_ACIAC      LDAQAAFGRAA--------------------------PLILEIGFGMGEATAHIAGVRPQ
TRMB_VEREI      PAAGAWFGRDA--------------------------PLVLEIGFGMGEATAHIARVRPQ
TRMB_POLSJ      LDFAAAFGRVA--------------------------PTILEIGFGMGEATAHIAALSPD
TRMB_POLNA      MDFSAVYGRDA--------------------------PTILEIGFGMGEATAHIAGLMPE
TRMB_RHOFT      IDFIATYADSTGARGNNDIN---------------PGPVILEIGFGMGEATAHIAALMPE
TRMB_NEIMB      ADLDARFGSSR--------------------------PKILEIGFGMGTATAEIARRLPE
TRMB_NEIMA      ADLDARFGSSR--------------------------PKILEIGFGMGTATAEIARRLPE
TRMB_NEIMF      ADLDANFGSNR--------------------------PKILEIGFGMGTATAEIARRLPE
TRMB_NEIM0      VDLDANFGSNR--------------------------PKILEIGFGMGTATAEIALRLPE
TRMB_NEIG1      ADLDARFGSSR--------------------------PKILEIGFGMGMASAEIARRLPE
TRMB_CHRVO      MDLEQVFGRAA--------------------------PKILEIGFGMGGATAEIAAANPD
TRMB_AZOSB      LDLDDAFGRSA--------------------------PKILEIGFGMGETTAKIAAAHPE
TRMB_AROAE      LDLDAAFGRAA--------------------------PKIVEIGFGMGETTAKIAAALPD
TRMB_DECAR      IDLAAFFGRNN--------------------------PKVLEIGTGMGETTAKIADANRD
TRMB_BORBR      LDMAATFGRQA--------------------------PTILEIGFGMGETTEKIALARPG
TRMB_BORPA      LDMAATFGRQA--------------------------PTILEIGFGMGETTEKIALARPG
TRMB_BORPE      LDMAAAFGRQA--------------------------PTILEIGFGMGETTEKIALARPG
TRMB_BORA1      LNPATAFGREA--------------------------PTILEIGFGMGETTEKIALARPE
TRMB_NITOC      LNLAAIFNRQA--------------------------ERILEIGFGNGESLLQQARAAPE
TRMB_ALKEH      LDLDRAFGRRA--------------------------PRILEIGFGNGESLAEQAATHPE
TRMB_HALHL      IDLDGLFGRAA--------------------------PRVLDIGFGDGEALVEMAAADPE
TRMB_LEIXX      LDLDALFGRTA--------------------------PRTVEIGFGNGENLLALAERHPE
TRMB_XYLFA      RDLDVLFGRSA--------------------------PKVLEVGFGNGAALRFAAQHEPR
TRMB_XYLFT      RDLDVLFGRSA--------------------------PKVLEVGFGNGAALRFAAQHEPR
TRMB_XANC5      RDLAATFGRDA--------------------------HKVLEIGFGNGAALRFAAQQDPS
TRMB_XANAC      RDLAATFGRDA--------------------------HKVLEIGFGNGAALRFAAQQDPS
TRMB_XANOM      RDLAATFGRDT--------------------------HKVLEIGFGNGAALRFAAQQDPS
TRMB_XANOR      RDLAATFGRDT--------------------------HKVLEIGFGNGAALRFAAQQDPS
TRMB_XANCP      RDLDAVFGRPA--------------------------PKVLEIGFGNGAALRFAAQHDPA
TRMB_XANC8      RDLDAVFGRPA--------------------------PKVLEIGFGNGAALRFAAQHDPA
TRMB_METCA      FDPAAVFGRRA--------------------------PLTLEIGFGNGESLAAMAQSLPA
TRMB_STRAW      LDLTELFGNTH--------------------------PVVLEIGFGMGEATARMAAEDPD
TRMB_STRCO      VDLAELFGNAR--------------------------PVVLEIGFGMGETTARMAAADPD
TRMB_SHESM      LNLTEVFGR--------------------------EADTVLEIGFGMGASLVQMAQEAPE
TRMB_SHESA      LNLTEVFGR--------------------------EADTVLEIGFGMGASLVQMAQEAPE
TRMB_SHESR      LNLTEVFGR--------------------------EADTVLEIGFGMGASLVQMAQEAPE
TRMB_SHEON      LDLADVFGR--------------------------KADTVLEIGFGMGASLVQMAQEAPE
TRMB_SHEPC      LNLSEVFGR--------------------------EADTVLEIGFGMGASLVQMAKDAPE
TRMB_SHESW      LNLSEVFGR--------------------------EADTVLEIGFGMGASLVQMAKDAPE
TRMB_SHEB8      LVLSDVFGR--------------------------EADTVLEIGFGMGASLVQMAKDAPE
TRMB_SHEB5      LVLSDVFGR--------------------------EADTVLEIGFGMGASLVQMAKDAPE
TRMB_SHEB9      LVLSDVFGR--------------------------EADTVLEIGFGMGASLVQMAKDAPA
TRMB_SHEFN      LELTQVFGR--------------------------DADTVLEIGFGMGASLVQMAKAAPE
TRMB_SHEDO      IDLVKIFGR--------------------------EADTVLEIGFGMGGSLVEMAAAAPE
TRMB_SHEHH      IDLVEVFGR--------------------------EADTVLEIGFGMGASLVAMAKASPE
TRMB_SHEPA      IDLVEVFGR--------------------------EADTVLEIGFGMGASLVAMAKAAPE
TRMB_SHESH      LDLKEVFGR--------------------------DADTVLEIGFGMGASLVEMAKASPE
TRMB_SHEAM      INFTEVFGR--------------------------EADTVLEIGFGMGASLVEMAANAPE
TRMB_VIBPA      LDWKEVFGN--------------------------DNPVVLEIGFGMGASLVEMAKNAPE
TRMB_VIBCB      LDWKEVFGN--------------------------DNPVVLEIGFGMGASLVEMAKNAPE
TRMB_VIBVY      LDWKEVFGN--------------------------DNPVVLEIGFGMGASLVEMAKNAPE
TRMB_VIBVU      LDWKEVFGN--------------------------DNPVVLEIGFGMGASLVEMAKNAPE
TRMB_VIBCH      LDWQQVFGN--------------------------DNPVVLEIGFGMGASLVEMAKNAPE
TRMB_VIBC3      LDWQQVFGN--------------------------DNPVVLEIGFGMGASLVEMAKNAPE
TRMB_PHOPR      LDWKEVYNR--------------------------EAPIVLEIGFGMGASLVEMAKHAPE
TRMB_AERHH      LDLVALFGR--------------------------EAPVVLEIGFGMGASLVEMAKNAPE
TRMB_PSEA6      LDMNEVFGR--------------------------TAPVVLEIGFGMGKSLVTMAKNEPD
TRMB_PSEHT      LDLSEVFGN--------------------------NNDVVLEIGFGMGKSLVEMAKNAPH
TRMB_COLP3      IDAPTLFAN--------------------------ENPVVLEIGFGMGKSLVEMAKAAPE
TRMB_PSYIN      IDFNALFGR--------------------------QAPIVLEIGFGMGKSLIEMAKNAPE
TRMB_SALCH      VDFATLFGR--------------------------EAPVTLEIGFGMGASLVAMAKARPE
TRMB_SALPA      VDFATLFGR--------------------------EAPVTLEIGFGMGASLVAMVKARPE
TRMB_SALTI      VDFATLFGR--------------------------EAPVTLEIGFGMGASLVAMAKARPE
TRMB_SALAR      VDFATLFGR--------------------------EAPVTLEIGFGMGASLVAMAKARPE
TRMB_SALTY      VDFATLFGR--------------------------EAPVTLEIGFGMGASLVAMAKARPE
TRMB_ECOL6      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_ECOUT      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_ECOK1      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_ECOL5      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_ECOHS      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_ECO57      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_ECOLC      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_SHISS      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_ECO24      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_SHIFL      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_ECOLI      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_SHIF8      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_SHIDS      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_SHIBS      LDFPALFGR--------------------------EAPVTLEIGFGMGASLVAMAKDRPE
TRMB_KLEP7      LDFAALFGR--------------------------DAPVTLEIGFGMGASLVAMAKAKPE
TRMB_CROS8      LDLVALFGR--------------------------DAPVTLEIGFGMGSSLVEMAKTNPQ
TRMB_YERPE      VDLNTLFGR--------------------------EAPIVLEIGFGMGTSLVTMATNNPQ
TRMB_YERPP      VDLNTLFGR--------------------------EAPIVLEIGFGMGTSLVTMATNNPQ
TRMB_YERPA      VDLNTLFGR--------------------------EAPIVLEIGFGMGTSLVTMATNNPQ
TRMB_YERPN      VDLNTLFGR--------------------------EAPIVLEIGFGMGTSLVTMATNNPQ
TRMB_YERP3      VDLNTLFGR--------------------------EAPIVLEIGFGMGTSLVTMAANNPQ
TRMB_YERPS      VDLNTLFGR--------------------------EAPVVLEIGFGMGTSLVTMAANNPQ
TRMB_YERE8      VDFTALFGR--------------------------EAPVVLEIGFGMGTSLVTMAASNPQ
TRMB_SERP5      VDITALFGR--------------------------DAPTVLEIGFGMGASLVTMAGHNPQ
TRMB_PECAS      VDFNALFGR--------------------------DAPVVLEIGFGMGASLVTMAAQHPE
TRMB_PHOLL      LELGALFGR--------------------------EAPVVLEIGFGMGASLVTMASQNPE
TRMB_SODGM      LDLTALFGR--------------------------AAPVTLEIGFGMGASLVTMAAAHPE
TRMB_IDILO      LDLAMVFGR--------------------------EAPVTLEIGFGMGHSLVEMAANAPE
TRMB_ACTP2      FNFEQIFGN--------------------------NNPVVLEIGFGMGRSLVEMAKQNPD
TRMB_HAEDU      FDFVEIFGN--------------------------ANPVVLEIGFGMGRSLVEMAAQNPD
TRMB_HAES1      FDFTQIYGN--------------------------TNPVILEIGFGMGKSLVEMALQNPD
TRMB_HISS2      FDFTQIYGN--------------------------TNPVILEIGFGMGKSLVEMALQNPD
TRMB_MANSM      FDFAEIYGN--------------------------TNPVILEIGFGMGKSLVEMAEQNPE
TRMB_HAEI8      FDFAKIYGN--------------------------DNPIVLEIGFGMGKSLVDMAFANPD
TRMB_HAEIN      FDFAKIYGN--------------------------DNPVVLEIGFGMGKSLVDMAFANPD
TRMB_HAEIG      FDFAKIYGN--------------------------DNPVVLEIGFGMGKSLVDMAFANPD
TRMB_HAEIE      FDFAKIYGN--------------------------DNPVVLEIGFGMGKSLVDMAFANPD
TRMB_PASMU      FDFPAIYGN--------------------------NNPVVLEIGFGMGHSLVDMALQNPE
TRMB_ACTSZ      FDFPAIYGN--------------------------HNPVILEIGFGMGKSLVEMAQQNPD
TRMB_HAHCH      LDLESVFGR--------------------------RSTVVLEIGFGMGQSLAEMAASEPD
TRMB_MARHV      IDPREVFGR--------------------------DNMLNLEIGFGMGKSLADMAEAAPE
TRMB_SACD2      INPAELFGR--------------------------SAPLVLEIGFGMGDSLVDMAIADPD
TRMB_ALCBS      LNPESVFGR--------------------------DAPRVLEIGYGMGQSLAQMAAADPD
TRMB_PSEPK      VDYDQVFGR--------------------------SAPRTLEIGFGMGHSLLEMAAAAPE
TRMB_PSEPG      VDYDQVFGR--------------------------SAPRTLEIGFGMGHSLLEMAAAAPE
TRMB_PSEP1      VDYDQVFGR--------------------------SAPRTLEIGFGMGHSLLEMAAAAPE
TRMB_PSEE4      VDYDQVFGR--------------------------SAPRTLEIGFGMGHSLLEMAAAAPE
TRMB_PSEPF      VDFDQVFGR--------------------------SAPRSLEIGFGMGHSLLEMAAAAPE
TRMB_PSEF5      VDYDQVFGR--------------------------SAPRSLEIGFGMGHSLLEMAAAAPE
TRMB_PSEU2      VDFDQVFGR--------------------------SAPRTLEIGFGMGHSLLEMAAAAPE
TRMB_PSE14      VDFDQVFGR--------------------------AAPRTLEIGFGMGHSLLEMAAAAPE
TRMB_PSESM      VDFDQVFGR--------------------------SAPRTLEIGFGMGHSLLEMAAASPE
TRMB_PSEAE      QDFDAIFGR--------------------------QAPRTFEIGFGMGHSTLEMAAAAPD
TRMB_PSEA7      QDFDAIFGR--------------------------QAPRTFEIGFGMGHSTLEMAAAAPD
TRMB_PSEAB      QDFDAIFGR--------------------------QAPRTFEIGFGMGHSTLEMAAAAPD
TRMB_PSEMY      RDFDQVFGR--------------------------SAPRTFEIGFGMGHSTLEMAAAAPE
TRMB_PSEU5      RDFDEVFGR--------------------------SAPRTFEIGFGMGHSTLEMAAAAPE
TRMB_CHRSD      QSLEALFGR--------------------------RAPCVVEVGFGMGQSLVEQAAANPE
TRMB_HYDCU      LDFNTLFGR--------------------------EAPTIIEIGFGMGNSLAAMAEAHPE
TRMB_LEGPA      WNFAKEFGRH-------------------------DADTIVEIGFGMGTSLFAMAMNNPQ
TRMB_LEGPH      WNFAKEFGRH-------------------------DADTIVEIGFGMGTSLFAMAMNNPQ
TRMB_LEGPL      WNFAKEFGRH-------------------------DADTIVEIGFGMGTSLFAMAMNNPQ
TRMB_LEGPC      WNFAKEFGRH-------------------------DADTIVEIGFGMGTSLFTMAMNNPQ
TRMB_FRATF      LDFTEIFAN--------------------------TNDVVLEIGFGMGGSLVEMALANPA
TRMB_FRATN      LDFTEIFAN--------------------------TNDVVLEIGFGMGGSLVEMALANPA
TRMB_FRATO      LDFTEIFAN--------------------------TNDVVLEIGFGMGGSLVEMALANPA
TRMB_FRAP2      LDFSEIFKN--------------------------SNDVVLEIGFGMGGSLVQMALENPT
TRMB_TREDE      IDFQTLFQNDN--------------------------PVIIEIGFGMGTATAQIAEDNPD
TRMB_TREPA      FDYAAVFCSPAAPSAPAGAFPAPQGKTDAVAPACAPAPLVVEIGFGMGSATAAIAARNPH
TRMB_BUCAI      LNFSSIFKHRA--------------------------PIILEIGFGSGESLVKTAMNFPE
TRMB_BUCAP      LDFTSVFKNSA--------------------------PVILEIGFGSGESLVKTAANFPN
TRMB_BUCBP      VNFNFIFNNEY--------------------------PVILEIGFGTGEFLINMARKNLF
TRMB_NOCFA      LDADAWFGR--------------------------QAPLVIEIGCGTGTATAAMAAAEPH
TRMB_RHOJR      LDAPSWFGR--------------------------DAPLILEIGSGTGTATAAMAKAEPH
TRMB_MYCSK      IDTAAWFGR--------------------------TAPLVLEIGSGTGTSTLAMAQDEPD
TRMB_MYCSS      IDTAAWFGR--------------------------TAPLVLEIGSGTGTSTLAMAQDEPD
TRMB_MYCGI      LDTDAWFGR--------------------------HAPVVLEIGCGTGTSTLAMAQAEPG
TRMB_MYCVP      LDTEAWFGR--------------------------HAPVVLEIGCGTGTSTLAMAQAEPD
TRMB_MYCBP      VDTRAWFGR--------------------------DAPVVLEIGSGSGTSTLAMAKAEPH
TRMB_MYCTU      VDTRAWFGR--------------------------DAPVVLEIGSGSGTSTLAMAKAEPH
TRMB_MYCBO      VDTRAWFGR--------------------------DAPVVLEIGSGSGTSTLAMAKAEPH
TRMB_MYCUA      IDARAWFGR--------------------------EAPVVLEIGCGSGTSTLAMAQAEPN
TRMB_MYCA1      LDTDAWFGR--------------------------KAPVVLEIGCGNGTSTLAMAKQEPG
TRMB_MYCPA      LDTDAWFGR--------------------------KAPVVLEIGCGNGTSTLAMAKEEPG
TRMB_MYCLE      LDTGAWFGR--------------------------STLVVLEVGCGSGTATLAMAQHEPD
TRMB_CORGB      IDVDAWFGRE-------------------------GAKTIVEIGSGTGTSTAAMAPLEAD
TRMB_CORGL      IDVDAWFGRE-------------------------GAKTIVEIGSGTGTSTAAMAPLEAD
TRMB_COREF      IDIDAWFGRT-------------------------GAKTIVEIGSGTGTSTAAMAPLEAD
TRMB_CORDI      IDVAEWFGRC-------------------------GHKTILEIGSGTGTSTAAMAPLEAD
TRMB_CORJK      IDLPEWFDR--------------------------DAETIAEIGSGTGTSTAAMAPLEAE
TRMB_CUTAK      PAI---FGRTA--------------------------PLTVEIGVGSGDVLAALAAAHPE
TRMB_NOCSJ      AGC---FERSA--------------------------PLIVEIGSGIGESTVALAAARPD
TRMB_PAEAT      EAV---FGRKA--------------------------PLIVEIGSGLGDAVVHAAEQNPD
TRMB_ARTS2      EAE---FGRSA--------------------------PLIVEIGSGLGDAVCHAAEENPD
TRMB_BIFAA      AYIRETWGNTN--------------------------PLIVEIGSGQGENVVAAAAARPD
TRMB_BIFLO      AFVESAWGNDN--------------------------PLIVEIGTGQGENVVAAAAAHPE
TRMB_PSYCK      DDLRALFAELPNGS---------------------EAPLTLEIGFGLGDSFIEMAAAEPS
TRMB_PSYA2      DDLRALFADLPNGS---------------------DAPLTLEIGFGLGDSFIEMAAAEPS
TRMB_ACIAD      -DLRQHFEHP-------------------------EHPLTVEIGFGMGRSLVLMAKAHPE
TRMB_RHIME      ADLTALFPEPV-------------------------ERIRLEIGFGGGEHLIHRAAEDPA
TRMB_SINMW      ADLKELFPVSV-------------------------ERVRLEIGFGGGEHLIHRAAEDPA
TRMB_RHIEC      EPLTSLFPVPV-------------------------TTLRLEIGFGGGEHLIHRALERPS
TRMB_RHIL3      EPLTSLFPVPV-------------------------ERLRLEIGFGGGEHLIHRALETPS
TRMB_AGRFC      QNLVALFPADV-------------------------RSIRLEIGFGGGEHLAHRAVENPE
TRMB_RHILO      SDLRTLFETEV-------------------------SAVRLEIGFGGGEHLLHRAIEAPT
TRMB_BRUAB      QDLRSLFEAPV-------------------------ETVRMEIGFGGGEHLHHESGRYPQ
TRMB_BRUA2      QDLRSLFEAPV-------------------------ETVRMEIGFGGGEHLHHESGRYPQ
TRMB_BRUME      QDLRSLFEAPV-------------------------ETVRMEIGFGGGEHLHHESGRYPQ
TRMB_BRUSU      QDLRSLFEAPV-------------------------ETVRMEIGFGGGEHLHHESGRYPQ
TRMB_OCHA4      QDLRTLFEAKV-------------------------DAVRLEIGFGGGEHLHHETGRYPQ
TRMB_CHESB      AALDSLFGKPL-------------------------REIRLEIGFGGGEHLLNEIRRHPD
TRMB_BARQU      PDLTSLFPSKV-------------------------REVRLEIGFGGGEHLLHEMEHFPQ
TRMB_BARHE      LNLTSLFSRKV-------------------------KEVRLEIGFGGGEHLLHEMKHFPQ
TRMB_BARBK      SDLTSLFTDLV-------------------------KEIRLEIGFGGGEHLCHEMARFPQ
TRMB_AZOC5      -EPAALFPCPV-------------------------DEIRLEIGFGGGEHLLSEAKRFPR
TRMB_RHOPS      DALAELFDAPV-------------------------EAVRLEIGFGGGEHLIAEALAHPE
TRMB_RHOP2      ASLVELFDPPV-------------------------EAVRLEIGFGGGEHLIAEALAHPS
TRMB_RHOPA      EPLTTLFDPPV-------------------------EHMRLEIGFGGGEHLIAEALAHPD
TRMB_NITHX      SDPATLFGRPV-------------------------KEMRIEIGFGGGEHLVAEALAFPR
TRMB_NITWN      SGPAALFDPPV-------------------------DETRIEIGFGGGEHLVAEALAFPR
TRMB_RHOP5      ADLRALFEPGV-------------------------DQVKLEIGFGGGEHLVAEAEAHPA
TRMB_RHOPB      ARLETLFASGI-------------------------AEVRLEIGFGGGEHLIAEALAHPT
TRMB_BRADU      GNACEIFDPAA-------------------------SDVRLEIGFGGGEHLAAEAQNFAT
TRMB_RUEST      LDLEAQFQG---------------------------RDVWLEVGFGGGEHLVHQAESNPD
TRMB_RUEPO      LDLNALFGG---------------------------RETWLEIGFGGGEHLVHQAASNPG
TRMB_ROSDO      LDLPGLFEG---------------------------KPVWLEIGFGGGEHLVHQAAQNPD
TRMB_JANSC      LDLKERFGG---------------------------KDIWLEVGFGGGEHLVHQAASNPD
TRMB_PARDP      VAPSTIFGDD--------------------------RPVWLEVGFGGGEHMVHMAARYPE
TRMB_RHOS4      LDLGALFGG---------------------------RPVWLEIGFGGGEHMVHMAARNPG
TRMB_RHORT      LDPRGLFPRPV-------------------------DQLWLEIGFGGGEHLVAQAAAHPE
TRMB_MAGSA      VEPALLFPGAV-------------------------RSVWLEVGFGGGEHLAQLAEDNPD
TRMB_GRABC      --PSSL--RGV-------------------------SPLWLEIGFGGGEHAVAQIEAHPD
TRMB_NOVAD      ITAEALFGEP--------------------------RPLHFEIGFGGGEHMAFRADMLPD
TRMB_SPHAL      VTARRLFGFD--------------------------RPLHFEIGFGGGEHMAARADMLPD
TRMB_ERYLH      VTAERLFGED--------------------------CPLHFEIGFGGGEHLVYRADLLPN
TRMB_ZYMMO      VSATDLFGDD--------------------------RPLEFEIGFGKGEHLAGQAMMRPD
TRMB_CAUVC      FQPLDLMPEA--------------------------KAVWLEIGFGGGEHMASQAGRNPE
TRMB_CAUSK      FQPRDLMPEA--------------------------QEVWLEIGFGGGEHMAAQAGKRPD
TRMB_MARMM      IDPAALMPDR--------------------------RRQALEIGFGGGEHLVAQAEANPQ
TRMB_HYPNA      LDLCAMFPGK--------------------------EAFWLEIGFGGAEHMIAQAAQNPD
TRMB_MAGMM      LIDQLGGNGQS-------------------------QRVILEIGFGNGETLAALAARHPE
TRMB_HELPY      GKKTLDLGTFEDFIQKNQ------------------APILIEIGFGSGRHLIELAKNNPT
TRMB_HELPH      GKKALDLGTFEDFIQKNQ------------------APILAEIGFGSGRHLIELAKNNPT
TRMB_HELPJ      QKKALDLETFEDFIQKNQ------------------APILIEIGFGSGRHLIELAKNNPT
TRMB_HELAH      GKKALDLEDFEDFIKENQ------------------APILMEIGFGSGRHLMELAKNNPT
TRMB_WOLSU      KRLTPFLKTPEFFMHEAHQ-----------------GQYWVEIGFGSGRHLLHQAKAHPE
TRMB_HELHP      NLQSPYFQSMDFFLDFAK-------------------PCLIEIGFGSGRHLLHLAQSNPH
TRMB_CAMJE      EKTPFIVDNFDELLSRLQG------------------KIYIEIGFGSGRHLLYQAKENPN
TRMB_CAMJR      EKTPFIVDNFDELLSRLQG------------------KIYIEIGFGSGRHLLYQAKENPN
TRMB_CAMJ8      EKTPFIVDNFDELLSKLQG------------------KIYIEIGFGSGRHLLYQAKENPN
TRMB_CAMJJ      EKTPFIVDNFDELLSKLQG------------------KIYIEIGFGSGRHLLYQAKENPN
TRMB_CAMJD      EKTPFIVDNFDELLSKLQG------------------KIYIEIGFGSGRHLLYQAKENPN
TRMB_CAMFF      AKKEFILNDIQFLEKLKSGEF---------------KKIFVEIGFGSGRHLLYQAKTDEN
TRMB_SULDN      LREVKALKDINYFATTFPKK----------------EKICIEVGFGSGRHLLHQAQNNPN
TRMB_GEOTN      GRWHELFGN--------------------------DRPIHIEIGTGKGKFITEMAKLHPD
TRMB_GEOKA      GRWRELFGH--------------------------DQPLHVEIGTGKGKFITEMAKLHPD
TRMB_BACHK      GNWKEVFGN--------------------------EQPIHIEVGTGRGRFMYDMAKANPH
TRMB_BACC1      GNWKEVFGN--------------------------EQPIHIEVGTGRGRFMYDMAKANPH
TRMB_BACAN      GNWKEVFGN--------------------------EQPIHIEVGTGRGRFMYDMAKANPH
TRMB_BACCZ      GNWKEVFGN--------------------------EQPIHIEVGTGRGRFMYDMAKANPH
TRMB_BACCR      GSWKEVFGN--------------------------EQPIHIEVGTGRGRFMYDMAKANPH
TRMB_BACAH      GNWKEVFGN--------------------------EQPIHIEVGTGRGRFMYDMAKANPH
TRMB_BACCN      GNWKELFGN--------------------------DHPIHIEVGTGRGRFVYEMAKANPD
TRMB_BACSU      GKWNTVFGN--------------------------DNPIHIEVGTGKGQFISGMAKQNPD
TRMB_BACVZ      GRWNTVFGN--------------------------DNPIHIEVGTGKGQFISGMAKQNPD
TRMB_BACLD      GKWHSVFGN--------------------------DNPIHIEVGTGKGQFISGMALQNPD
TRMB_LISIN      GRWQEVFGN--------------------------NNPIHIEIGSGKGQFISGMAKANPE
TRMB_LISW6      GRWQEVFGN--------------------------NNPIHIEIGSGKGQFISGMAKANPE
TRMB_LISMO      GQWHEVFGN--------------------------DNPIHIEIGSGKGQFISGMAKANPE
TRMB_LISMF      GQWREVFGN--------------------------DNPVHIEIGSGKGQFISGMAKANPE
TRMB_STRT2      GKWHQIFGN--------------------------DNPIHIEVGSGKGAFITGMAQQNPD
TRMB_STRTD      GKWHQIFGN--------------------------DNPIHIEVGSGKGAFITGMAQQNPD
TRMB_STRT1      GKWHQIFGN--------------------------DNPIHIEVGSGKGAFITGMAQQNPD
TRMB_STRA1      GRWHEIFGN--------------------------NNPIHIEVGSGKGAFITGMAEQNPD
TRMB_STRA5      GRWHEIFGN--------------------------NNPIHIEVGSGKGAFITGMAEQNPD
TRMB_STRA3      GRWHEIFGN--------------------------NNPIHIEVGSGKGAFITGMAEQNPD
TRMB_STRP3      GRWHDVFGN--------------------------DRPIHIEVGSGKGGFITGMALKNPD
TRMB_STRPB      GRWHDVFGN--------------------------DRPIHIEVGSGKGGFITGMALKNPD
TRMB_STRPF      GRWHDVFGN--------------------------DRPIHIEVGSGKGGFITGMALKNPD
TRMB_STRPM      GRWHDVFGN--------------------------DRPIHIEVGSGKGGFITGMALKNPD
TRMB_STRPC      GRWHDVFGN--------------------------DRPIHIEVGSGKGGFITGMALKNPD
TRMB_STRP1      GRWHDVFGN--------------------------DRPIHIEVGSGKGGFITGMALKNPD
TRMB_STRPD      GRWHDVFGN--------------------------DRPIHIEVGSGKGGFITGMALKNPD
TRMB_STRPG      GRWHDVFGN--------------------------DRPIHIEVGSGKGGFITGMALKNPD
TRMB_STRP8      GRWHDVFGN--------------------------DRPIHIEVGSGKGGFITGMALKNPD
TRMB_STRP6      GRWHDVFGN--------------------------DRPIHIEVGSGKGGFITGMALKNPD
TRMB_STRSY      GKWAEIFGN--------------------------NNPIHIEVGSGKGRFVTGMAAQNPD
TRMB_STRS2      GKWAEIFGN--------------------------NNPIHIEVGSGKGRFVTGMAAQNPD
TRMB_STRMU      GHWQEVFGN--------------------------DHPIHIEVGSGKGRFITGMAAKNPQ
TRMB_STRSV      GRWQEIFGN--------------------------DHPIHVEVGSGKGAFVSGMAKANPE
TRMB_STRGC      GKWQELFGN--------------------------DHPIHIEVGSGKGAFITGMAKANPN
TRMB_STRR6      AKWRDLFGN--------------------------DNPIHVEVGSGKGAFVSGMAKQNPD
TRMB_STRPN      AKWRDLFGN--------------------------DNPIHVEVGSGKGAFVSGMAKQNPD
TRMB_STRP2      AKWRDLFGN--------------------------DNPIHVEVGSGKGAFVSGMAKQNPD
TRMB_LACLM      GRWSERFGN--------------------------DHPIHIEVGCGKGAFITGMAALHPE
TRMB_LACLA      GRWSERFGN--------------------------DHPIHIEVGCGKGAFITGMAALHPE
TRMB_LACLS      GSWSERFGN--------------------------DHPIHIEVGCGKGAFITGMAALHPE
TRMB_ENTFA      GKWQERFGN--------------------------NHPIHIEIGSGKGRFIYEMAKAHPE
TRMB_BACHD      GNWHRCFGR--------------------------QAPLYIEVGTGKGQFLTGMAKHHPE
TRMB_BACSK      GNWNNCFCT--------------------------AQPLYVEVGTGKGKFLTGMAKQFPS
TRMB_OCEIH      GNWSQLFNN--------------------------NNPIHVEIGSGKGQFILGMAKQYPE
TRMB_STAES      GKMSEWFEK--------------------------EQPIYIEIGSGMGQFITTLAAQYPE
TRMB_STAEQ      GKMSEWFEK--------------------------EQPIYIEIGSGMGQFITTLAAQYPE
TRMB_STAHJ      GKMSEWFDK--------------------------EQPIYIEIGSGMGQFITTLASKFPE
TRMB_STAA3      GKMTEWFDK--------------------------TQPIHIEIGSGMGQFITTLAAQNPH
TRMB_STAA8      GKMTEWFDK--------------------------TQPIHIEIGSGMGQFITTLAAQNPH
TRMB_STAAB      GKMTEWFDK--------------------------TQPIHIEIGSGMGQFITTLAAQNPH
TRMB_STAAC      GKMTEWFDK--------------------------TQPIHIEIGSGMGQFITTLAAQNPH
TRMB_STAAS      GKMTEWFDK--------------------------TQPIHIEIGSGMGQFITTLAAQNPH
TRMB_STAAW      GKMTEWFDK--------------------------TQPIHIEIGSGMGQFITTLAAQNPH
TRMB_STAAM      GEMTEWFDK--------------------------TQPIHIEIGSGMGQFITTLAAQNPH
TRMB_STAAN      GEMTEWFDK--------------------------TQPIHIEIGSGMGQFITTLAAQNPH
TRMB_STAAR      GEMTEWFDK--------------------------TQPIHIEIGSGMGQFITTLAAQNPH
TRMB_STAS1      GRISEWFDN--------------------------DQPIYIEVGSGRGQFITTLAAKHPE
TRMB_LACRD      GKWQSRFAK--------------------------EQPLHLEVGMGKGQFIIGMAKDHPE
TRMB_PEDPA      GQWNQRFEK--------------------------EQPIFIEVGTGKGQFIINMAKKYPQ
TRMB_LACPL      GRWQSRFAK--------------------------PQPLQIEVGSGKGQFIIEMAKRHPE
TRMB_LACS1      GKWHTRFQN--------------------------NNPIFVEIGMGKGRFIVEMAKKNPE
TRMB_LACSS      SNWQSRFAK--------------------------EQPIYIEVGSGKGQFITQMAQKYPD
TRMB_LACP3      GHWQSRFDQ--------------------------ARPLYLEVGSGKGQFIVEMAKTHPD
TRMB_LACBA      GNWQSRFPS--------------------------NQPLFVEIGTGKGQFIIEMARQHPD
TRMB_LACJO      INWEERFEDF-------------------------SKPLAIEIGSGKGQFITTLAKEHPE
TRMB_LACGA      INWEERFDDF-------------------------SKPLAIEIGSGKGQFITTLAKKHPE
TRMB_LACDA      IDWEARFGN--------------------------DKPIEIEVGSGKGQFITTLAKQHPD
TRMB_LACDB      IDWAARFGN--------------------------DKPIEIEVGSGKGQFITTLAKQHPD
TRMB_LACAC      IYWEKRFGN--------------------------DHPIEIEVGSGKGHFITTLAEQHPE
TRMB_LACH4      IDWAARFGN--------------------------DNTIEIEVGSGKGHFITTLAENNPD
TRMB_LEUMM      GQWQSLFDQ--------------------------EQPIHLEIGSGKGQFILGMALAHPE
TRMB_OENOB      GSWSSVFGN--------------------------NHPLYLEIGSGKGQFILDNAIKYPE
TRMB_LACP7      GKWHEVFGN--------------------------NNPIHIEIGMGKGQFITSLAMQNPN
TRMB_CLOD6      GKWNLKFRN--------------------------DNPIHVEFGTGKGKFITTLAKQNPD
TRMB_ALKOO      EQWHTYFEN--------------------------QNPIHIEIGMGKGQFIRTLAKLNPN
TRMB_ALKMQ      NQWHLYFQN--------------------------QHPIHLEVGLGKGQFLTTLAKVHKN
TRMB_CLOPS      GNWKNTFKNT-------------------------ENPIYLELGCGKGTFMAVHGSDHPN
TRMB_CLOP1      GNWKNTFKNT-------------------------ENPIYLELGCGKGTFMAVHGSDHPN
TRMB_CLOPE      GNWKNTFKNT-------------------------ENPIYLELGCGKGTFMAVHGSDNPN
TRMB_CLOB8      GKWKEFFGN--------------------------DKPIYLELGCGKGTFMAVHASENPD
TRMB_HUNT2      GKWREVFGN--------------------------SNEIWLELGCGKGGFISKLASTNPD
TRMB_CLOTE      GKWMEEFKN--------------------------NNSIHLELGCGRGGFMQEKALKNPN
TRMB_CLOK5      GKWKDEFKN--------------------------DGEIYLELGCGRGKFLCTQALNNKH
TRMB_CLOAB      GKWREEFKN--------------------------DNEIYLELGCGRGDFVTNIANKHPE
TRMB_CLONN      GNWKDEFKN--------------------------NNDIYLELGCGRGGFAVQAASKFND
TRMB_DESHY      ENWQEAFGN--------------------------NHPVHLELGCGRGQFINQCAELNPH
TRMB_MYCGE      TKK----------------------------------QLVLELGCGKGTFLIKEAQKNNN
TRMB_MYCPN      ESE----------------------------------SLFVEIGCGKSWFLSQQAQQNPK
TRMB_UREPA      DNLGKIFKNP-------------------------ELPLYIEIGMGKGDFIIENALRNQQ
TRMB_UREP2      DNLGKIFKNP-------------------------ELPLYIEIGMGKGDFIIENALRNQQ
TRMB_MYCCT      INLNEIFLNN-------------------------N-PTCLEIGCGKGQFLTTLALKNPN
TRMB_MYCMS      IDLKQIFLNN-------------------------N-PTCLEIGSGKGQFITTLALKNLN
TRMB_MESFL      INLSDLFNNK-------------------------KQPVHLEIGCGKGNFITNHALKESD
TRMB_MYCGA      LDPKKFN--------------------------------ALEIGSGKGGFIYQKAITNPG
TRMB_MYCPE      GLWNQQIFKN-------------------------NNNIEIEVGTGKGTFIFNKALKNKN
TRMB_MYCPU      KNS------------------------------------TLEIGMGKGQMLIELAQKNPQ
TRMB_MYCHP      KNT------------------------------------ILEIGMGRGTMLTKLALMHPD
TRMB_MYCH2      DSW------------------------------------IIEIGMGKGKMISQLAFDNPN
TRMB_MYCH7      DSW------------------------------------IIEIGMGKGKMISQLAFDNPN
TRMB_MYCHJ      DSW------------------------------------IIEIGMGKGKMISQLAFDNPN
TRMB_MYCMO      QDT------------------------------------IIELGSGKGTMISALALKNPS
TRMB_MYCS5      EDD------------------------------------ILEIGSGKGEMISQMALLNPN
TRMB_BACFR      GKWHKEFFKN-------------------------DNPIVLELGCGRGEYTVGLGRMFPD
TRMB_BACFN      GKWHKEFFKN-------------------------DNPIVLELGCGRGEYTVGLGRMFPD
TRMB_BACTN      GKWHQEFFGN-------------------------DHPIVLELGCGRGEYTVGLGRMFPD
TRMB_PORGI      GRWHTDFFHN-------------------------DHPIVLELGCGRGEYTVGLGKRFPE
TRMB_GRAFK      GKWSENFFKN-------------------------DHPIVLELGCGKGEYTVELARKNPD
TRMB_CYTH3      GKWH-EYFKN-------------------------DNPVILEVGCGRAEYTTGLAALFPE
TRMB_CHLSY      VSAEGLFGY--------------------------NAPLTLEFGCATGEYLCALAAAQPS
TRMB_CHLAA      VSAEGLFGY--------------------------NAPLTLEFGCATGEYLCALAAAQPS
TRMB_CHLAD      LNAESLFGR--------------------------NAPLTLELGCATGEYICTLATAQPD
TRMB_CHLT3      VSSPSFFQN--------------------------ENPLEIDIGCATGDLVCSLAQKNPQ
TRMB_RUBXD      LSSPELFGD--------------------------QRPLELDVGCGTGEYICHLARSDPE
TRMB_THEMA      LDWSEIFGRK--------------------------AKIVVEIGFGNGEFLAELARRHPE
TRMB_COPPD      ------------------------------------NPLAVEIGFGNGKFLKTLETTGTN
TRMB_CHLPD      -----------------------------------AGTIEVEIGFGSGEYLLRRASEYPE
TRMB_AQUAE      --------------------------------------LEVEIGFGRGDFIVKLAKENPD
TRMB_NEOSM      LASHEKLENLK-------------------------SEIVLEVGFGFGEHILKKAIDYPD
TRMB_WOLPM      ESIEKIVNSQ--------------------------KRIWVEIGFGNGENMLYQVLNEPD
TRMB_RHOBA      INSQTLFGND--------------------------QPLEIEVGSGKGLFIQTESDRRPE
TRMB_BDEBA      KWRSDVFKADA------------------------AMPLDVEVGTGNGTYFAHHAKTHSD
                                                         :   . .            

TRMB_TRIV2      -WNFLGLEIREPLVIEANQFRSQLG--------LSNLHYLYCNANNSLQPLLSSL--PTG
TRMB_NOSS1      -WNFLGLEIRESLVIEANQFRSQLG--------LTNLHYLYCNANNSLQPLLSSL--PTG
TRMB_MICAN      -INFLGIEIRQPLVIEANQERERLG--------LSNLAFVFGNMNVAPEILLQSL--PAD
TRMB_SYNP6      -WNYLGLEIREPLVDEANAIARERE--------LTNLYYHFSNANLDLEPLLRSL--PTG
TRMB_SYNE7      -WNYLGLEIREPLVDEANAIARERE--------LTNLYYHFSNANLDLEPLLRSL--PTG
TRMB_TRIEI      -WNFLGLEIREPLVIEANNWRDEKG--------LNNLHYLFCNANISLGKIFESF--PKG
TRMB_SYNY3      -WNFLGVEIRQPLVLEANETGDRLG--------LKNLHYLFGNINVEPEKFFSAF--PP-
TRMB_THEEB      -QNFLGLEIRYPLVVAANERRDRQQ--------LRNLHYLWGNANVHLSKILGGL--PL-
TRMB_SYNJA      -WNFLGVEIRQPLVERANAWRDELG--------LDNVHFLFANINVSLRHLFA-----PG
TRMB_SYNJB      -WNFLGVEIRQALVERANAWRDELG--------LDNVHFLFANINVSLRHLFA-----PG
TRMB_PROMM      -WNHVGVEIRHPLVLSAERDRQELE--------LDNLRFLFCNVNVSLEEWLDAL--PRD
TRMB_PROM3      -WNHVGVEIRHPLVLSAERDRQELK--------LDNLRFLFCNVNVSLEEWLDAL--PRD
TRMB_SYNSC      -WNHLGVEIRRPLVTSADRDALASE--------HGNVRILFCNANISLEGWMKAL--KQD
TRMB_SYNPX      -WNHLGVEIRRPLVTAADRDALNSG--------SGNVRVLFCNANISLESWLAAL--PND
TRMB_SYNS9      -WNHIGVEIRRPLVIPADREALESP--------HGNVRVLFCNANISLEGWMETL--PKD
TRMB_SYNS3      -RNHLGVEIRRPLVQAAQHDRDRQE--------QHNLHFLFCNANISLEAWMAAL--PPD
TRMB_SYNPW      -RNHLGVEIRRPLVRSAQRDRDQLE--------RLNLHYLFCNANVSLEGWMAAL--PQD
TRMB_PROMA      -WNFLGVEIREPLVFAAEKERIELG--------LTNLRFFFCNANISLEKWFLSL--ENG
TRMB_PROMT      -WNFVGLEIREPLVSLCEKKRRKLE--------LTNLKFLFCNVNVSLDEWLSDL--DFG
TRMB_PROM1      -WNFVGLEIREPLVSLCEKKRRKLE--------LTNLKFLFCNVNVSLDEWLSDL--DFG
TRMB_PROMS      -WNYLGIEIREKLVKNAKLKVLESE--------IKNLYFLFGNANNILNDVQSEL--IIK
TRMB_PROM2      -WNYLGIEIREKLVKNAKLKVFERE--------IKNLYFVFGNANNILNDVQSKY--IIR
TRMB_PROM9      -WNYIGIEIRERLVKTAKLKVRERD--------IKNLYFIFGNANNILHDVQSKF--IFK
TRMB_PROMP      -WNYIGIEIREKLVLNANLKMKSRE--------NKNLYFSFGNANNIFNQTNNKS--IIN
TRMB_PROM5      -WNYIGIEIREKLVLNANLKIKNRE--------YKNVYFSFGNAINILNNTNNKT--LID
TRMB_GEOSL      -TNFIAIDYYNKGCLKTCSRLERHG--------ITNVRVVRAEARQFIVERIQ-----KG
TRMB_GEOMG      -TNYIAIDFYNKGCDKTCRRLERLA--------IPNVRVVRDEARKFIVERIP-----KG
TRMB_PELCD      -RNYLAIDIYNKGCNKTCNRLEQAR--------LTNVRVMRIEARYLLEQFLA-----TE
TRMB_MYXXD      -VRFVAFEWRKKYARDTQDRADKAG--------LRNLRVIESDARFIVPRIFA-----PD
TRMB_ANADE      -RALVGIEQRRKFAAELAAKGARHG--------LSNLLVLNGDARLLAPRLFA-----AG
TRMB_THET8      -WLVLGAEVSAASVLRALRRMRREG--------LANVRLYHGQGPFALRNLVL-----PG
TRMB_THET2      -WLVLGAEVSAASVLRALRRMRREG--------LANVRLYHGQGPFALRNLVL-----PG
TRMB_DEIGD      APNYLGVEISGVSLLKAERRLREAG--------LSNAVLTKLPATPLIREVVP-----AG
TRMB_DEIRA      PPNYLGVEISGVSLLKAHRRLKDAG--------LTNAVLTKLPAEVLVAQVIP-----HG
TRMB_CHLAB      -MNWIAVEKRFDRVRKIWSKMHNSQ--------VRNLRIVCGEAQTFFRHYIQ-----NE
TRMB_CHLCV      -MNWIAVEKRFDRVRKIWSKMHNFQ--------VSNLRIVCGEAQTFFRHYLK-----NE
TRMB_CHLFF      -VNWIAVEKRFDRVRKIWSKMHNCR--------VTNLRIVCGDAQTFFLHYLG-----EA
TRMB_CHLTR      -VNWIAVEKRFDRVRKIWSKMGNYR--------VNNLLIVCGEAQTFFSHYVS-----DA
TRMB_CHLTA      -VNWIAVEKRFDRVRKIWSKMGNYR--------VNNLLIVCGEAQTFFSHYVS-----DA
TRMB_CHLMU      -INWIAVEKRFDRVRKIWSKMSNHK--------VNNLLIVCGEAQTFFTHYVT-----DA
TRMB_CHLPN      -VLWIAVEQRFDRVRKIWSKMINHQ--------IQNLRIVCGTAETFFQYYVP-----DQ
TRMB_PARUW      -YNWVGIEKKFDRTRKIWSKIKKFE--------LDNLLTICGEGFHVTRDFFA-----NE
TRMB_LEPIN      -TGFILMEKKFDRIRHTIREIEKHS--------LDNVKILCVNFNWFLEEVFE-----EN
TRMB_LEPIC      -TGFILMEKKFDRIRHTIREIEKHS--------LDNVKILCVNFNWFLEEVFE-----EN
TRMB_LEPBJ      -TGFVLMEKKFDRIRHTIREIEKHS--------LDNVKILCVNFNWFLADVFE-----EN
TRMB_LEPBL      -TGFVLMEKKFDRIRHTIREIEKHS--------LDNVKILCVNFNWFLADVFE-----EN
TRMB_NITEU      -KDFIAIEVHAPGIGSLLGQIEKHR--------LTNLRIIPHDAKLVLQQMFT-----SE
TRMB_NITEC      -KDFVAIEVHAPGIGSLLDRIEKHG--------LTNLRIIPHDAKLVLQHMLT-----GE
TRMB_NITMU      -NDYLAAEVHTPGMGSLLKQVEELE--------LTNIRVIQHDAVDVLQHALP-----PE
TRMB_BURVG      -DDFLGVEVHEPGVGALLKLIGEQG--------LTNIRIIQHDAVEVLEHMLA-----PE
TRMB_BURCM      -DDFLGVEVHEPGVGALLKLIGEQD--------LPNIRIIQHDAVEVLEHMLA-----PE
TRMB_BURL3      -DDFLGVEVHEPGVGALLKLIGEQD--------LSNIRIIQHDAVEVLEHMLA-----PE
TRMB_BURCH      -DDFLGVEVHEPGVGALLKLIGEQG--------LSNIRIIQHDAVEVLEHMIA-----PA
TRMB_BURCA      -DDFLGVEVHEPGVGALLKLIGEQG--------LSNIRIIQHDAVEVLEHMIA-----PA
TRMB_BURPS      -DDFIGVEVHEPGVGALLKLIGEQQ--------LSNIRIIQHDAVEVLAQMIA-----PD
TRMB_BURP1      -DDFIGVEVHEPGVGALLKLIGEQQ--------LSNIRIIQHDAVEVLAQMIA-----PD
TRMB_BURMA      -DDFIGVEVHEPGVGALLKLIGEQQ--------LSNIRIIQHDAVEVLAQMIA-----PD
TRMB_BURTA      -DDFIGVEVHEPGVGALLKLIGEQQ--------LSNIRIIQHDAVEVLEHMIA-----PD
TRMB_PARXL      -EDFLGVEVHEPGVGALLKLMGEQN--------LSNIRIIQHDAVEVLEQMIA-----PD
TRMB_THIDA      -IDYIGVEVHTPGVGALLKQLGERE--------LGNVRVIQHDAVEVLTAMLA-----PA
TRMB_METFK      -CDFIGVEVHTPGVGSLLKQIGELQ--------LNNLRIIQHDAVEVLQHMIA-----DA
TRMB_CUPNH      -DNFLGCEVHEPGVGALLKLIDERG--------LANVRILQHDAVEVIAHMLT-----DD
TRMB_CUPPJ      -DNFLGCEVHEPGVGALLKLADERE--------IGNIRIIQHDAVEVVAHMLT-----ED
TRMB_CUPMC      -DNFLGCEVHEPGVGALLKLIGERG--------LQNVRIMQHDAVEVAAHMLT-----EN
TRMB_RALSO      -DDFLGVEVHEPGVGALLKLIGERG--------IGNVRIVSHDAVEVLAQMIP-----EG
TRMB_ACISJ      -DNFLCCEVHEPGVGALLKRIGEQD--------IHNIRILQHDAVEVLEHMLA-----PG
TRMB_ACIAC      -DDFLCCEVHEPGVGALLKRIGERG--------LTNIRILQHDAVEVIDHMLP-----EG
TRMB_VEREI      -DDFLCCEVHRPGVGALLKRIAEHG--------LTNIRILEHDAVEVIDHMLP-----ES
TRMB_POLSJ      -KNFLCCEVHTPGVGALLKRIQEQT--------LGNIRILQHDAVEVIDNMLP-----AG
TRMB_POLNA      -KNFLCCEVHTPGVGALLKRIDEQA--------LTNIRILQHDAVEVIDHMLP-----LG
TRMB_RHOFT      -KNFLCCEVHEPGVGALLKRIGEQG--------LRNIRIVAHDAVEVIDHMLP-----LQ
TRMB_NEIMB      -TDFLAIDVHGPGVGNLLKLIDENH--------LENIRVMRHDAVEVVENMLQ-----DG
TRMB_NEIMA      -TDFLAIDVHGPGVGNLLKLIEENH--------LENIRVMRHDAVEVVENMLQ-----DG
TRMB_NEIMF      -TDFLAIDVHGPGVGNLLKLINENH--------LENIRVMRHDAVEVIENMLQ-----DG
TRMB_NEIM0      -TDFLAIDVHGPGVGNLLKLINENH--------LENIRVMRHDAVEVVENMLQ-----DG
TRMB_NEIG1      -TDFLAIDVHGPGVGNLLKLINENH--------LENIRVMRHDAVEVVENMLQ-----DG
TRMB_CHRVO      -NDYLGIEVHGPGVGNLCKLIAEKE--------LTNLRLMRHDAVEVLDNMLA-----DG
TRMB_AZOSB      -QDYLGIEVHGPGVGAMCKLVAENG--------LANVRIMQHDAVEVMRDMIA-----DG
TRMB_AROAE      -KDFLTIEVHGPGVGSLCKLIAEGV--------LDNVRIVQHDAVEVLRDMIP-----ER
TRMB_DECAR      -IDYLGVEVHVPGVGALCKQIAERE--------LTNLRICQHDAVEVVRDMLP-----ED
TRMB_BORBR      -DNFLGVEVFNAGVGSLLHRIEESA--------IANLRIVQHDAVEVVRDMIA-----PD
TRMB_BORPA      -DNFLGVEVFNAGVGSLLHRIEESA--------IANLRIVQHDAVEVVRDMIA-----PD
TRMB_BORPE      -DNFLGVEVFNAGVGSLLHRIEESA--------ISNLRIVQHDAVEVVRDMIA-----PD
TRMB_BORA1      -DNFLGVEVFNAGVGSMLHRIETSQ--------IPNVRIIQHDAVEVVRDMIA-----PD
TRMB_NITOC      -RDFLGIEVYRPGIGHLLLRLKAEG--------LENIRVIHGDAWEVLQRALP-----NP
TRMB_ALKEH      -RDYLGIEVHRPGVGHLLMEVEKRH--------LGNVRVMMADAAEVLAHHIP-----DG
TRMB_HALHL      -RDYLGVEVHRPGVGHCLLCAEQAG--------LDNLRVATVDAVELVRHHLP-----GP
TRMB_LEIXX      -RDFLGVEVHGAGVGRVFAAMRERG--------LSNIRVIRHDAVEVFETGLS-----AG
TRMB_XYLFA      -YDYIGIEVYAPGVGRLLNGLAEDG--------SRHVRLYHYDAVEVLNKEIV-----DG
TRMB_XYLFT      -YDYIGIEVYAPGVGRLLNGLAEDG--------SRHVRLYHYDAVEVLNKEIV-----DG
TRMB_XANC5      -RDYIGIEVHAPGVGRLLNALDEDG--------STHVRLYHHDAVEVLEHEIA-----DG
TRMB_XANAC      -RDYIGIEVHAPGVGRLLNALEEDG--------STHVRLYHHDAVEVLEHEIA-----DG
TRMB_XANOM      -RDYIGIEVHAPGVGRLLNALEEDG--------STHVRLYHHDAVEVLEHEIA-----DG
TRMB_XANOR      -RDYIGIEVHAPGVGRLLNALEEDG--------STHVRLYHHDAVEVLEHEIA-----DG
TRMB_XANCP      -RDYIGIEVHAPGVGRLLNALDDDG--------ATHVRLYHHDAVEVLEREIA-----DG
TRMB_XANC8      -RDYIGIEVHAPGVGRLLNALDDDG--------ATHVRLYHHDAVEVLEREIA-----DG
TRMB_METCA      -EDFIGAEVHPPGIGHLLIELERRG--------LDNVRVFRVDAVELLENCIP-----EG
TRMB_STRAW      -TGILAVDVHTPGQGNLLNLADQHG--------LTNIRVANGDAIILLREMLP-----PD
TRMB_STRCO      -TNILAADVHTPGQGNLLGLAERQE--------LPNIRVANGDAIILLREMLA-----PG
TRMB_SHESM      -QNFIGIEVHKPGVGSCLSDAAAAG--------VTNLRVYHHDAMEVLEHAIA-----DG
TRMB_SHESA      -QNFIGIEVHKPGVGSCLSDAAAAG--------VTNLRVYHHDAMEVLEHAIA-----DG
TRMB_SHESR      -QNFIGIEVHKPGVGSCLSDAAAAG--------VTNLRVYHHDAMEVLEHAIA-----DG
TRMB_SHEON      -LNFIGIEVHKPGVGSCLSDAAAAG--------VTNLRVYHHDAMEVLEHAIA-----DG
TRMB_SHEPC      -QNFIGIEVHKPGVGSCLSDAAIAG--------VTNLRVYHHDAMEVLEHAIA-----DG
TRMB_SHESW      -QNFIGIEVHKPGVGSCLSDAAIAG--------VTNLRVYHHDAMEVLEHAIA-----DG
TRMB_SHEB8      -QNFIGIEVHKPGVGSCLSDAAIAG--------VTNLRVYHHDAMEVLEHAIA-----DG
TRMB_SHEB5      -QNFIGIEVHKPGVGSCLSDAAIAG--------VTNLRVYHHDAMEVLEHAIA-----DG
TRMB_SHEB9      -QNFIGIEVHKPGVGSCLSDAAIAG--------VTNLRVYHHDAMEVLEHAIA-----DG
TRMB_SHEFN      -QNFIGIEVHKPGIGTCLSEAGAAE--------VTNLRVYHHDAMEVLEHSIV-----DG
TRMB_SHEDO      -LNYIGIEVHKPGVGACLGVAGEAK--------VTNLRVYHHDAMEVLEHSIA-----DG
TRMB_SHEHH      -LNFIGIEVHKPGVGACLAEAAEAG--------VTNLRVYHHDAIEVLENSIA-----EG
TRMB_SHEPA      -LNFIGIEVHKPGVGACLAEAAEAG--------VTNLRVYHHDAIEVLENSIA-----EG
TRMB_SHESH      -LNFIGIEVHKPGVGACLSVAGEAG--------VTNLRVFHHDAIEVLENSIV-----KG
TRMB_SHEAM      -LNFIGVEVHKPGVGACLGEAGNAG--------ISNLRVYHHDAVEVLENAIP-----DS
TRMB_VIBPA      -KNFFGIEVHSPGVGACLSDAREAG--------ITNLRVMCHDAVEVFEHMIP-----ND
TRMB_VIBCB      -KNFIGIEVHSPGVGACLADAREAG--------ITNLRVMCHDAVEVFEHMIP-----NG
TRMB_VIBVY      -KNFFGIEVHSPGVGACLSDAREAG--------ISNLRVMCHDAVEVFEHMIP-----ND
TRMB_VIBVU      -KNFFGIEVHSPGVGACLSDAREAG--------ISNLRVMCHDAVEVFEHMIP-----ND
TRMB_VIBCH      -KNFLGIEVHSPGVGACLASAREAG--------VTNLRVMCHDAVEVFAHMIP-----DN
TRMB_VIBC3      -KNFLGIEVHSPGVGACLASAREAG--------VTNLRVMCHDAVEVFAHMIP-----DN
TRMB_PHOPR      -KDFIGIEVHSPGVGACLMGAEETG--------LTNLRVMCHDAVEVFDYMIP-----DG
TRMB_AERHH      -KNFIGIEVHSPGVGACLGTAQEAG--------VTNLRVICHDAVEVLEHMIP-----NG
TRMB_PSEA6      -KDFIGIEVHRPGIGACLADAQEQG--------VTNLRVYEHDAVEVLADCIA-----DG
TRMB_PSEHT      -LNFIGIEVHRPGVGACLMDADEAG--------ITNLRIFEHDAVEVLADCIA-----DE
TRMB_COLP3      -LNFIGIEVHKPGVGACISSAVEES--------VSNLKVCEHDAIEILADCIP-----DD
TRMB_PSYIN      -KNFIGIEVHGPGVGACLADAGEAG--------VTNLRVINHDAVEVLDKMIP-----DN
TRMB_SALCH      -QNFLGIEVHSPGVGACLASAHEEG--------VENLRVMCHDAVEVLHKMIP-----DN
TRMB_SALPA      -QNFLGIEVHSPGVGACLASAHEEG--------VENLRVMCHDAVEVLHKMIP-----DN
TRMB_SALTI      -QNFLGIEVHSPGVGACLASAHEEG--------VENLHVMCHDAVEVLHKMIP-----DN
TRMB_SALAR      -QNFLGIEVHSPGVGACLASAHEEG--------VENLRVMCHDAVEVLHKMIP-----DN
TRMB_SALTY      -QNFLGIEVHSPGVGACLASANEEG--------VENLRVMCHDAVEVLHKMIP-----DN
TRMB_ECOL6      -QDFLGIEVHSPGVGACLSSAHEEG--------LSNLRVMCHDAVEVLHKMIP-----DN
TRMB_ECOUT      -QDFLGIEVHSPGVGACLSSAHEEG--------LSNLRVMCHDAVEVLHKMIP-----DN
TRMB_ECOK1      -QDFLGIEVHSPGVGACLSSAHEEG--------LSNLRVMCHDAVEVLHKMIP-----DN
TRMB_ECOL5      -QDFLGIEVHSPGVGACLASAHEEG--------LSNLRVMCHDAVEVLHKMIP-----DN
TRMB_ECOHS      -QDFLGIEVHSPGVGACLASAHEEG--------LSNLRVMCHDAVEVLHKMIP-----DN
TRMB_ECO57      -QDFLGIEVHSPGVGACLASAHEEG--------LSNLRVMCHDAVEVLHKMIP-----DN
TRMB_ECOLC      -QDFLGIEVHSPGVGACLASAHEEG--------LSNLRVMCHDAVEVLHKMIP-----DN
TRMB_SHISS      -QDFLGIEVHSPGVGACLASAHEEG--------LSNLRVMCHDAVEVLHKMIP-----DN
TRMB_ECO24      -QDFLGIEVHSPGVGACLASAHEEG--------LSNLRVMCHDAVEVLHKMIP-----DN
TRMB_SHIFL      -QDFLGIEVHSPGVGACLASAHEEG--------LSNLRVMCHDAVEVLHKMIP-----DN
TRMB_ECOLI      -QDFLGIEVHSPGVGACLASAHEEG--------LSNLRVMCHDAVEVLHKMIP-----DN
TRMB_SHIF8      -QDFLGIEVHSPGVGACLASAHEEG--------LSNLRVMCHDAVEVLHKMIP-----DN
TRMB_SHIDS      -QDFLGIEVHSPGVGACLASAHEEG--------LSNLHVMCHDAVEVLHKMIP-----DN
TRMB_SHIBS      -QDFLGIEVHSPGVGACLASAHEEG--------LNNLRVMCHDAVEVLHKMIP-----DN
TRMB_KLEP7      -QNFLGIEVHSPGVGACLASAEEEG--------VQNLRVMCHDAVEVLHTMIP-----DN
TRMB_CROS8      -QNFLGIEVHSPGVGACLSAAHEEG--------VENLRVMCHDAVEVLEKMIP-----DG
TRMB_YERPE      -QNFLGIEVHSPGVGACLSSAHDAG--------LSNLRIMCHDAVEVLENMIP-----EA
TRMB_YERPP      -QNFLGIEVHSPGVGACLSSAHDAG--------LSNLRIMCHDAVEVLENMIP-----EA
TRMB_YERPA      -QNFLGIEVHSPGVGACLSSAHDAG--------LSNLRIMCHDAVEVLENMIP-----EA
TRMB_YERPN      -QNFLGIEVHSPGVGACLSSAHDAG--------LSNLRIMCHDAVEVLENMIP-----EA
TRMB_YERP3      -QNFLGIEVHSPGVGACLSSAHDAG--------LSNLRIMCHDAVEVLENMIP-----EA
TRMB_YERPS      -QNFLGIEVHSPGVGACLSSAHDAG--------LSNLRIMCHDAVEVLENMIP-----EA
TRMB_YERE8      -QNFLGIEVHSPGVGACLASAHEAG--------LNNLRVMCHDAVEVLENMIP-----DS
TRMB_SERP5      -QNFLGIEVHSPGVGACLADATEAE--------LSNLRVMCHDAVEVLENMIP-----DG
TRMB_PECAS      -QNFLGIEVHLPGVGACLASAQDVE--------ISNLRVMCHDALEVLMKMIP-----DS
TRMB_PHOLL      -KDFLGIEVHVPGVGACLASAEDEN--------IGNLRVMCHDAIEVLENMIP-----DN
TRMB_SODGM      -QNFIGIEVHLPGVGACLASAQEAG--------VSNLRVMCHDAVEVLEQMIP-----DA
TRMB_IDILO      -RDFIGIEVHEPGVGACLMAAEEAG--------VENFRVFHEDAVEVLKQCIP-----DN
TRMB_ACTP2      -RNYIGIEVHTPGVGACIAYALEKG--------VKNLRVICHDATEILRDAIA-----DG
TRMB_HAEDU      -RNYIGIEVHTPGVGACIAYAVEKQ--------VDNLRVICHDATEILRDAVA-----DG
TRMB_HAES1      -KNYLGIEVHTPGVGACIAYAVEKQ--------VKNLRVICHDATEILQDCIA-----DN
TRMB_HISS2      -KNYLGIEVHTPGVGACIAYAVEKQ--------VKNLRVICHDATEILQDCIA-----DN
TRMB_MANSM      -RNYLGIEVHTPGVGACIAYAVEKQ--------VKNLRVICHDATEILQDCIA-----DD
TRMB_HAEI8      -KNYLGIEVHTPGVGACIAYAVEKG--------VTNLRVICHDATEILRDSIA-----DG
TRMB_HAEIN      -KNYLGIEVHTPGVGACIAYAVEKG--------VTNLRVICHDATEILRDSIA-----DG
TRMB_HAEIG      -KNYLGIEVHTPGVGACIAYAVEKG--------VTNLRVICHDATEILRDSIA-----DG
TRMB_HAEIE      -KNYLGIEVHTPGVGACIAYAVEKG--------GTNLRVICHDATEILRDSIA-----DG
TRMB_PASMU      -RNYLGIEVHTPGVGACIAYAVEKG--------VKNLRIICHDATEILRDCIA-----DH
TRMB_ACTSZ      -KNYLGIEVHTPGVGACLAYALEKG--------IKNLRVICHDATEILRDCIA-----DR
TRMB_HAHCH      -ADFIGVEVHKPGVGALLRNMEEQS--------LENIRIFWDDANEVIDKCLP-----DA
TRMB_MARHV      -QDFIGVEVHLPGVGALLKEVESRG--------LENVRVYSIDANDVIDLCLP-----DA
TRMB_SACD2      -SDFIGIEVHPPGVGRLINRAGTEG--------VPNLRCYMADANDVLSDCIP-----DG
TRMB_ALCBS      -KDFIGIEVHRPGVGALLMEIEQQG--------LSNLRSYCDDAVEILELCIP-----DN
TRMB_PSEPK      -QDFIGVEVHRPGVGALLNGVLTQG--------LKNLRVYDCDAIEVLNRCVA-----DN
TRMB_PSEPG      -QDFIGVEVHRPGVGALLNGVLTQG--------LKNLRVYDCDAIEVLNRCVA-----DN
TRMB_PSEP1      -QDFIGVEVHRPGVGALLNGVLTQG--------LKNLRVYDCDAIEVLNRCVA-----DN
TRMB_PSEE4      -LDFIGVEVHRPGVGALLNGVLTQG--------LKNLRVYDCDAIEVLNRCVA-----DN
TRMB_PSEPF      -QDFIGVEVHRPGVGALLNGVLTQG--------LTNLRVYDCDAIEVLNRCIA-----DN
TRMB_PSEF5      -QDFIGVEVHRPGVGALLNGVLTQG--------LTNLRVYDCDAIEVLNRCIA-----DN
TRMB_PSEU2      -HDFIGVEVHSPGVGALLNGVLTQG--------LTNVRVYDCDAIEVLNRCVA-----DN
TRMB_PSE14      -HDFIGVEVHSPGVGALLNGVLTQG--------LTNVRVYDCDAIEVLNRCVA-----DN
TRMB_PSESM      -QDFIGVEVHYPGVGAMLNGVLTQG--------LTNVRVYDCDAIEVLNRCIA-----DN
TRMB_PSEAE      -IDFIGVEVHKPGVGALLNGLLTQG--------LGNVRVYSCDALEVLRHCVA-----DA
TRMB_PSEA7      -LDFIGVEVHKPGVGALLNGLLTQG--------LGNVRVYSCDALEVLRHCVA-----DA
TRMB_PSEAB      -IDFIGVEVHKPGVGALLNGLLTQG--------LGNVRVYSCDALEVLRHCVA-----DA
TRMB_PSEMY      -QDFIGVEVHKPGVGALLNGVMAHN--------LSNVRVYSCDALEVLQGCVA-----DA
TRMB_PSEU5      -QDFIGVEVHKPGVGALLSGLVSQK--------LTNVRVYSCDALEVLRDCVA-----DA
TRMB_CHRSD      -TDFIGIEVHAPGVGKLLDEADKRG--------LTNLRVYRDDALEVLDKCLP-----ES
TRMB_HYDCU      -NNYIGIEVHRPGVGALLKLVAEKG--------LTNVRVFNEDAIEVLNRQIP-----KN
TRMB_LEGPA      -CNYLGIEVHKAGVGSLVADLHEHQ--------ISNVRVVVHDAVEVLQTKIP-----EN
TRMB_LEGPH      -CNYLGIEVHKAGVGSLVADLHEYQ--------ISNVRVVVHDAVEVLQTKIP-----EN
TRMB_LEGPL      -CNYLGIEVHKAGVGSLVADLHEYQ--------ISNVRVVAHDAVEVLQTKIP-----EN
TRMB_LEGPC      -CNYLGIEVHKAGVGSLVADLHEHQ--------ITNVRVVVHDAVDVLQTKIP-----EN
TRMB_FRATF      -KNYLGIEVHKAGVGNILYEIEHQN--------IANLLVMSHDAVEILENMIA-----DQ
TRMB_FRATN      -KNYLGIEVHKAGVGNILYEIEHQN--------IANLLVMSHDAVEILENMIA-----DQ
TRMB_FRATO      -KNYLGIEVHKAGVGNILYEIEHQN--------IANLLVMSHDAVEILENMIA-----DQ
TRMB_FRAP2      -KNYLGIEVHKAGVGNILYEIEHQN--------ISNLLVMSHDAVEILENMIS-----DN
TRMB_TREDE      -KNYLGIEVFKAGVGKLLGEIEEKK--------LNNLRIIEHDAIEVLENMIN-----NE
TRMB_TREPA      -LSYLGIEVYRAGIGRLLRKIEAER--------LHNLRIIEHDALDVLRTMIA-----PQ
TRMB_BUCAI      -KNFLGIEVYKSGIGSCLHYASSYQ--------IQNLRIIYYDATEVMYNMIP-----DD
TRMB_BUCAP      -KNFLGIEVYKSGIGSCLRLAHYSG--------INNLKIIYHDAIEVIDQMIL-----DH
TRMB_BUCBP      -SNFLGIEVYIPSILSCLRYIHKYN--------LPNVKVIFYDAVEVISYMIS-----NN
TRMB_NOCFA      -VNLIGIEVYQPGLAQLVQRIERDG--------IDNIRLLRGDAVDVLEHMIA-----AE
TRMB_RHOJR      -VNLMAVEVYRPGLAQLLQQIERDE--------IPNIRVLRGDAMDVLENMIE-----PE
TRMB_MYCSK      -IDVIAVEVYRRGLAQLLTGIDRAG--------VRNIRMIRGDGVDVLEYMVA-----SG
TRMB_MYCSS      -IDVIAVEVYRRGLAQLLTGIDRAG--------VRNIRMIRGDGVDVLEYMVA-----SG
TRMB_MYCGI      -IDVVAVEVYRRGLAQLLSAIDRTAAT---EHPVSNIRLIRGDGVDVLTHMFG-----SA
TRMB_MYCVP      -IDVVAVEVYRRGLAQLLSAMDREG--------VTNIRLIRGDGVDVLTHMFG-----PD
TRMB_MYCBP      -VDVIAVDVYRRGLAQLLCAIDKVGS------DGINIRLILGNAVDVLQHLIA-----PD
TRMB_MYCTU      -VDVIAVDVYRRGLAQLLCAIDKVGS------DGINIRLILGNAVDVLQHLIA-----PD
TRMB_MYCBO      -VDVIAVDVYRRGLAQLLCAIDKVGS------DGINIRLILGNAVDVLQHLIA-----PD
TRMB_MYCUA      -VDVIAVEVYRRGLAQLLCAIDRADL------QRINIRLIRGNGIDVLRDLIA-----PE
TRMB_MYCA1      -VDVIAVEVYRRGLAQLLCAIDRD--------NVTNIRLIRGNALDVLQRLIA-----PA
TRMB_MYCPA      -VDVIAVEVYRRGLAQLLCAIDRD--------NVTNIRLIRGNALDVLQRLIA-----PA
TRMB_MYCLE      -IDVIAVEVYRRGLAQLLCAIDRD--------QVHNIRMIHGNALYVLQYLIA-----PR
TRMB_CORGB      -TNIVAVELYKPGLAKLMGSVVRGE--------IDNVRMVRGDGIEVLNRMFA-----DG
TRMB_CORGL      -TNIVAVELYKPGLAKLMGSVVRGE--------IDNVRMVRGDGIEVLNRMFA-----DG
TRMB_COREF      -TNIIAVELYKPGLAKLMGAVVRGG--------IDNIRMVRGDGIEVLNRMFA-----DG
TRMB_CORDI      -TNIIAVELYKPGLAKLLGAVVRGD--------ISNVRMIRGDGVEVLTRMLP-----EE
TRMB_CORJK      -KNIVAVELYRPGLAKLLGSVVRGD--------IHNVRMIRGDGVEVLQRMFA-----PE
TRMB_CUTAK      -RDFIGFEVYLPSIATTLNKLENAG--------ASNARVIMADATAGLDHLFG-----PA
TRMB_NOCSJ      -HDVVAIEVWRPGVADTLGRIGAAG--------LSNVRLLSVDAVWSMAHLVE-----PD
TRMB_PAEAT      -KDFLAVEVYTPGLANTIIKINSRG--------LTNVRVVEANAPEVLESMLP-----EG
TRMB_ARTS2      -WDFLAVEVYTPGLANTVIKINSRK--------LSNVRVVEANAPEVLATMLP-----AG
TRMB_BIFAA      -VNFLALEVYDPGVAHTLLLAGKQN--------LKNLRIAQINAPELFKAAV------DG
TRMB_BIFLO      -TNFLALEVYDPGVAHTLLLAGKQG--------LTNIRVAQVNAPELFKVTA------AG
TRMB_PSYCK      -RNFVGIEVHEPGIGKCAYMAGTQN--------LSNVRIINGDAIQLLKQLP------EN
TRMB_PSYA2      -RNFVGVEVHEPGIGKCAYMAGTQN--------LSNIKIINGDAIQLLKQLP------EN
TRMB_ACIAD      -RNFVGIEVHVPGIAQCVYEAGMAG--------LKNLRVLDADAIQVLREMP------DN
TRMB_RHIME      -TGFIGVEPFVNSMAKLLGQIEA--------KAIRNIRLYDDDATQ-VLDWLP-----AA
TRMB_SINMW      -TGFIGVEPFVNSMAKLLGQIEA--------KAIRNIRLHDDDATQ-VLDWLP-----AA
TRMB_RHIEC      -TGFIGVEPFVNSMQKLLARAGQ--------TGARNIRVYNDDATQ-LLDWLP-----DA
TRMB_RHIL3      -TGFIGVEPFVNSMQKLLSRIGE--------TGASNIRVYNDDATQ-LLDWLP-----DG
TRMB_AGRFC      -TGFIGVEPFVNSMAKLLATVRE--------RELMNIRLYDDDATQ-LLDWLP-----EG
TRMB_RHILO      -TGFIGVEPFVNGMAKMMMAVRA--------RPLANLRVHDDDATR-LLDWLP-----PA
TRMB_BRUAB      -SGFIGVEPFINGMAKMLAALDQ--------APRPNLRLYDEDATA-VLDWLP-----DA
TRMB_BRUA2      -SGFIGVEPFINGMAKMLAALDQ--------APRPNLRLYDEDATA-VLDWLP-----DA
TRMB_BRUME      -SGFIGVEPFINGMAKMLAALDQ--------APRPNLRLYDEDATA-VLDWLP-----DA
TRMB_BRUSU      -SGFIGVEPFINGMAKMLAALDQ--------APRPNLRLYDEDATA-VLDWLP-----DA
TRMB_OCHA4      -TGFIGVEPFINGMAKMLAALDG--------EPRSNLRLYDEDATA-VLDWLP-----DA
TRMB_CHESB      -VGFIGVEPFVNGMAKLVAALEG--------EAPPNLRLYDDDATK-LLDWLP-----DS
TRMB_BARQU      -TGFIGVEPFINGMAKMLMSLEQH------KQHQNHLRLYDDDATR-LLDWLP-----NA
TRMB_BARHE      -TGFIGIEPFINGMAKMLMSLEEH------KQYQNQLRLYNDDATG-LLDWLP-----NA
TRMB_BARBK      -TGFIGVEPFINGMAKMLMYLEKY------TQHQNHLRLYDDDATY-LLDWLP-----EE
TRMB_AZOC5      -AGYIGIEPFLNGMAKAVLELDL--------APQENVRLFNLDAAL-LLARLP-----EG
TRMB_RHOPS      -IGFIGAEPYVNGMAKILARIED--------QNIRNVRLFAGDAAE-LMAWLP-----AR
TRMB_RHOP2      -TGFIGAEPYVNGMAKILARIEQ--------ENIRNIRLFAGDAAA-LMAWVP-----AH
TRMB_RHOPA      -TGFIGAEPYVNGMAKILARIEA--------ENIRNIRLFAGDASE-LLAWVP-----AG
TRMB_NITHX      -TGFIGCEPYVNGMAKILSQIEA--------HDIGNIRLLAGDASE-LLAWLP-----RA
TRMB_NITWN      -AGFIGCEPYVNGMAKILVQIEA--------HAIRNIRLFAGDASQ-LLACLP-----PA
TRMB_RHOP5      -TGFIGCEPYVNGMAKILAQIEA--------RGIRNIRLFAGDAAE-LLAWAP-----KA
TRMB_RHOPB      -TGFIGCEPYVNGMAKILAQIEA--------RELGNIRLFAGDAAE-LLAWAP-----PA
TRMB_BRADU      -TGFIGCEPYVNGMAKILAQIEA--------GNIANIRLFAGDAAE-LLAWLP-----KA
TRMB_RUEST      -VGIIGAEPYVNGVAMLLGKLRK--------SSAENVRVHAGDARD-LMDVLP-----AQ
TRMB_RUEPO      -IGIIGAEPYINGVAMLLGKIRA--------AGGDNVRVHPGDVRD-LFDVLP-----AQ
TRMB_ROSDO      -IGIIGAEPYINGVAMLLGKIRR--------AGVENLAVHAGDARD-LMDVLP-----AA
TRMB_JANSC      -VAIIGCEPYINGVAMLLGKIRA--------AGVGNLAVYPGDARD-LFDVLP-----KG
TRMB_PARDP      -IGIIGCEPFINGVAMLLGKIRA--------AGVENVSVHPGDARD-LMDVLP-----DA
TRMB_RHOS4      -IGLIGCEPFVNGVAMLLGKIRA--------AGVENLLVHPGDVRD-LFDVLP-----EA
TRMB_RHORT      -VGLIGSEVFAYGVGKALSQI-------DETGV-DNIRLWPEDVRQ-VLPALP-----DG
TRMB_MAGSA      -IGLIGCEVFRNGIASLLGHV-------QARQLGNNVRVFPEDVRL-LLPALP-----DG
TRMB_GRABC      -VTLIACEVFENGLCSLLSRLLPEPLDEETAPLPGNLRVWDDDARP-LLRDLP-----DQ
TRMB_NOVAD      -HGFIGAEPFLNGVAQALTHVSGDNG---QHPPIPNVRIHHGDALE-VLRRIP-----DG
TRMB_SPHAL      -HGFIGAEPFINGVAQALVHVAGDHG---QHPPLGNVRIHHGDALE-VLRRIP-----DG
TRMB_ERYLH      -HGFIGAEPFLNGVASCLSQVEEQR--------LANIRIHNGDALE-VLDRVP-----DG
TRMB_ZYMMO      -HGFIGCEPFLDGVVGLLTHIDNNQ--------IKNIRLHRGDALD-ILEQLP-----DG
TRMB_CAUVC      -TLVIGAEPFVNGVASAVRHVEE--------QALKNVRIHEGDARD-VVDWLP-----DA
TRMB_CAUSK      -VLMIGAEPFVNGVASAVRHVEE--------QALKNVRIHEGDARD-VVGWLP-----DA
TRMB_MARMM      -TGFIGIEPFLNGVAKALTAIDA--------AGLGNVRLARADARE-ILPRFE-----TA
TRMB_HYPNA      -VGIIGCEPFLEGIAKALGGIEE--------TDLNNVRVWPDDARP-LIARMP-----DQ
TRMB_MAGMM      -DCFIGIDVFLEGFGTLLNRLTR--------GDISNVRLVCQNALQVLLERIP-----DA
TRMB_HELPY      -KTCLGIEIHTPSIAQALKQIELLD--------LKNLHILQG-DGRLVLESMP-----NH
TRMB_HELPH      -KTCLGIEIHTPSIAQALKQIELLD--------LKNLHILQG-DGRLILESMP-----NY
TRMB_HELPJ      -TTCLGIEIHTPSIAQALKQIELLD--------LKNLHILQG-DGRLVLESMP-----NH
TRMB_HELAH      -KTCLGIEIYTPSIAQVLKQIELLD--------LKNLHVLQG-DGRLVLESIP-----HH
TRMB_WOLSU      -KRFIGLEIHTPSIEQVLRRLELEE--------ISNVSIVSY-DARVFLELLP-----SN
TRMB_HELHP      -FMCIGIEIHTPSIEQILRQVQLLG--------LENLYIING-DARILLEILS-----SH
TRMB_CAMJE      -VLILGVEIYNPALTQVAKLAKAQN--------VNNILLIQS-DARLLLSVLK-----SK
TRMB_CAMJR      -VLILGVEIYNPALTQVAKLAKAQN--------VNNILLIQS-DARLLLSVLK-----SK
TRMB_CAMJ8      -VLILGVEIYNPALTQVAKLAKVQN--------VNNILLIQS-DARLLLSVLK-----SK
TRMB_CAMJJ      -VLILGVEIYNPALTQVAKLAKVQN--------VNNILLIQS-DARLLLSVLK-----SK
TRMB_CAMJD      -VLILGVEIYNPALTQVAKLAKAQN--------VNNILLIQS-DARLLLSVLK-----SK
TRMB_CAMFF      -TLVVGIEVYKRSCEQVNNLALSMG--------LKNVILLNL-DARLVMSLLH-----SN
TRMB_SULDN      -ILYIGIEIHTPSIEQLLKQISIKN--------IENILVLNY-DARLFMELVP-----SN
TRMB_GEOTN      -VNFIGIELYPSVLVSALDKLIES--------ELPNVRLLNANAKDLTSFFAD------G
TRMB_GEOKA      -VNFIGIELYPSVLVSALDKLIES--------GLANVKLLNANAKDLTAFFAD------G
TRMB_BACHK      -INYIGIEKFTSVVVDALDKLIEE--------ELPNLKLINKDAEDLTVFFAK------G
TRMB_BACC1      -INYIGIEKFTSVVVDALDKLIEE--------ELPNLKLINKDAEDLTVFFAK------G
TRMB_BACAN      -INYIGIEKFTSVVVDALDKLIEE--------ELPNLKLINKDAEDLTVFFAK------G
TRMB_BACCZ      -INYIGIEKFTSVVVDALDKLIEE--------ELPNLKLINKDAEDLTVFFAK------G
TRMB_BACCR      -INYIGIEKFTSVVVDALDKLIEE--------ELPNLKLINKDAEDLTVFFAK------G
TRMB_BACAH      -INYIGIEKFTSVVVDALDKLIEE--------ELPNLKLINKDAEDLTVFFAK------G
TRMB_BACCN      -INYIGIEKFTSVIVDALDKLIEK--------ELPNLKLINKDAEDLTVFFTK------G
TRMB_BACSU      -INYIGIELFKSVIVTAVQKVKDS--------EAQNVKLLNIDADTLTDVFEP------G
TRMB_BACVZ      -INYIGIELFKSVIVTAVQKVKDS--------GAHNVRLLNIDAETLNDVFER------G
TRMB_BACLD      -VNYIGIELFKSVIVTAVDKVKQT--------EAPNVKLLNINANMLSDVFAD------G
TRMB_LISIN      -INYIGIEMIESVLVSALDKAIEA--------EVPNLRLVARDAKLLEESFEK------G
TRMB_LISW6      -INYIGIEMIESVLVSALDKAIEA--------DVPNLRLVARDAKLLEECFEK------G
TRMB_LISMO      -INYIGIEMIESVLVSALDKAIEV--------DVPNLRLVARDAKLLEDCFEK------G
TRMB_LISMF      -INYIGIEMIESVLVSALDKAIEA--------DVSNLRLVARDAKLLEECFEK------G
TRMB_STRT2      -INYIGIDIQLSVLSYALDKVLAS--------GVENVKLLRVDGSALTNYFED------G
TRMB_STRTD      -INYIGIDIQLSVLSYALDKVLAS--------GVENVKLLRVDGSALTNYFED------G
TRMB_STRT1      -INYIGIDIQLSVLSYALDKVLAS--------GVENVKLLRVDGSALTNYFED------G
TRMB_STRA1      -INYIGIDIQLSVLSYALDKVLDS--------GAKNIKLLLVDGSSLSNYFDT------G
TRMB_STRA5      -INYIGIDIQLSVLSYALDKVLDS--------GAKNIKLLLVDGSSLSNYFDT------G
TRMB_STRA3      -INYIGIDIQLSVLSYALDKVLDS--------GAKNIKLLLVDGSSLSNYFDT------G
TRMB_STRP3      -INYIGIDIQLSVLSYALDKVLAS--------EVPNVKLLRVDGSSLTNYFED------G
TRMB_STRPB      -INYIGIDIQLSVLSYALDKVLAS--------EVPNVKLLRVDGSSLTNYFED------G
TRMB_STRPF      -INYIGIDIQLSVLSYALDKVLAS--------EVPNVKLLRVDGSSLTNYFED------G
TRMB_STRPM      -INYIGIDIQLSVLSYALDKVLAS--------EVPNVKLLRVDGSSLTNYFED------G
TRMB_STRPC      -INYIGIDIQLSVLSYALDKVLAS--------EVPNVKLLRVDGSSLTNYFED------G
TRMB_STRP1      -INYIGIDIQLSVLSYALDKVLAS--------EVPNVKLLRVDGSSLTNYFED------G
TRMB_STRPD      -INYIGIDIQLSVLSYALDKVLAS--------EVPNVKLLRVDGSSLTNYFED------G
TRMB_STRPG      -INYIGIDIQLSVLSYALDKVLAS--------EVPNVKLLRVDGSSLTNYFED------G
TRMB_STRP8      -INYIGIDIQLSVLSYALDKVLAS--------EVPNVKLLRVDGSSLTNYFED------G
TRMB_STRP6      -INYIGIDIQLSVLSYALDKVLAS--------EVSNVKLLRVDGSSLTNYFED------G
TRMB_STRSY      -INYIGIDIQMTVLSYALDRVLEA--------GLPNIKLLQVDGSSLTNYFAP------A
TRMB_STRS2      -INYIGIDIQMTVLSYALDRVLEA--------GLPNIKLLQVDGSSLTNYFAP------A
TRMB_STRMU      -INYIGIDIQVSVLSHALDKVLDS--------QLPNVKLMLADGSSLMHYFAD------G
TRMB_STRSV      -INYIGIDIQKSVLSYALDKVLAT--------DVPNIKLLWVDGSDLTDYFEE------G
TRMB_STRGC      -INYIGIDIQKSVLSYALDKVLAT--------DVPNIKLLWVDGSDLTNYFAD------G
TRMB_STRR6      -INYIGIDIQKSVLSYALDKVLEV--------GVPNIKLLWVDGSDLTDYFED------G
TRMB_STRPN      -INYIGIDIQKSVLSYALDKVLEV--------GVPNIKLLWVDGSDLTDYFED------G
TRMB_STRP2      -INYIGIDIQKSVLSYALDKVLEV--------GVPNIKLLWVDGSDLTDYFED------G
TRMB_LACLM      -INYIAIDMQLSVLSYALDKAIEA--------DLPNVQMMLVDGAALSEYFAD------G
TRMB_LACLA      -INYIAIDMQLSVLSYALDKAIEA--------DLPNVQMMLVDGAALSEYFAD------G
TRMB_LACLS      -INYIAIDMQLSVLSYALDKAIEA--------DLPNVQMMLVDGAALSEYFAD------G
TRMB_ENTFA      -INYIGIDMQLSILSIALDKLVAD--------PLPNLQLLRVDGEALTEYFAE------N
TRMB_BACHD      -INFIGIERYESVLVTAMERAKEA--------ELTNLKFLSEDVYDLLDFFAD------G
TRMB_BACSK      -INFIGVERYESVLLTAMERVEAE--------KLPNVKLLHKDVAQLLEVFAE------N
TRMB_OCEIH      -INFIGIELAKSIIVSAVQKIEEE--------NLANVFMLNENAIDVREMFAD------D
TRMB_STAES      -INFVSMEREKSVMYKVLDKTKEM--------GLKNLKMICNDAIELNEYFKD------K
TRMB_STAEQ      -INFVSMEREKSVMYKVLDKTKEM--------GLKNLKMICNDAIELNEYFKD------K
TRMB_STAHJ      -INFVSMEREKSVMYKVLDKVKEL--------NLTNLKMICNDAIELNEYFND------G
TRMB_STAA3      -INYISMEREKSIVYKVLDKVKEM--------GLTNLKIICNDAIELNEYFKD------G
TRMB_STAA8      -INYISMEREKSIVYKVLDKVKEM--------GLTNLKIICNDAIELNEYFKD------G
TRMB_STAAB      -INYISMEREKSIVYKVLDKVKEM--------GLTNLKIICNDAIELNEYFKD------G
TRMB_STAAC      -INYISMEREKSIVYKVLDKVKEM--------GLTNLKIICNDAIELNEYFKD------G
TRMB_STAAS      -INYISMEREKSIVYKVLDKVKEM--------SLTNLKIICNDAIELNEYFKD------G
TRMB_STAAW      -INYISMEREKSIVYKVLDKVKEM--------SLTNLKIICNDAIELNEYFKD------G
TRMB_STAAM      -INYISMEREKSIVYKVLDKVKEM--------GLTNLKIICNDAIELNEYFKD------G
TRMB_STAAN      -INYISMEREKSIVYKVLDKVKEM--------GLTNLKIICNDAIELNEYFKD------G
TRMB_STAAR      -INYISMEREKSIVYKVLDKVKEM--------GLTNLKIICNDAIELNEYFKN------G
TRMB_STAS1      -INFISMEREKSVMIKVLDKVIEQ--------GLTNIKLICNDAIELNDYFKD------G
TRMB_LACRD      -INFIGLEIQRTVAAIALKKALEE--------DLPNLQLICGDGEDLQEYFED------G
TRMB_PEDPA      -YNFIGIEIQKTVIAIALKNALEE--------EIPNLQFLYADGAELTDYFED------G
TRMB_LACPL      -INYVAIEIQTSVIAIILKKLVEA--------PLPNLQLAHADGQAVTAFFEP------H
TRMB_LACS1      -KNYIGLELQTVAVGIALKKQLEE--------KLPNLQLICANGSGLGEYFEK------G
TRMB_LACSS      -RNFIAVEIQESAIAVILQKQVEL--------KLPNLQLLLGNGAALTTFFAE------N
TRMB_LACP3      -RNFIALELQEAAVAMILKKQVAL--------KLPNLQLVLGDGADLTDYFSE------G
TRMB_LACBA      -RNFIGIEIQTSVIAVALKGVVNS--------GLTNIQLVHTDGEAINTFFEA------G
TRMB_LACJO      -MNFIGVELQTTAAGMILRTKLEE--------KIDNLQLMCADAANIAMYLPE------N
TRMB_LACGA      -MNFIGVELQTTAAGMILRTKLEE--------KIDNLQLMCADAANIAMYLPE------N
TRMB_LACDA      -RNFVAMEIQKTAAGIILKKKLDE--------GLDNLQILCADAANLVAYFGE------N
TRMB_LACDB      -RNFVAMEIQKTAAGIILKKKLDE--------GLDNLQILCADAANLVAYFGE------N
TRMB_LACAC      -KNFVALELQTTAAGIILRTKLKK--------GLDNLQILRGDAADINCFFDK------N
TRMB_LACH4      -KNYVALELQTTAAGIILRTKLEK--------GLDNLQILRGDAADINCFFPE------N
TRMB_LEUMM      -INYIGMEIQETAIAIAARKSFDQV------GTLPNLRYIYGNGNGVETYFEK------G
TRMB_OENOB      -NNFIGLELQPTAVAIAGKKAFKQE------PQLANLKLILGDGGDVSDYFAD------N
TRMB_LACP7      -INYIGIEKYSSVLLRAIE------KR--EEYEGDNLYFLRFDAESITDIFAP------S
TRMB_CLOD6      -INYIAMELKEEVLLKAVE------KA--DASNLNNILFLWGDVSNILDYFEA------K
TRMB_ALKOO      -INYIGLEKVEELVLKSV----R--SI--EAEEICNISLINWNAVKLEEILGE------G
TRMB_ALKMQ      -INYLGLEKSQEVLLQALKKLDR--QV--SRQELSNMGLFHYNALDLNEVFGE------G
TRMB_CLOPS      -INYIAIDIKDEVLVLAKRNIEKAYEE--KNKALDNVKLMPQEIALIDTILDSN-----D
TRMB_CLOP1      -INYIAIDIKDEVLVLAKRNIEKAYEE--KNKALDNVKLMPQEIALIDTILDSN-----D
TRMB_CLOPE      -INYIAIDIKDEVLVLAKRSIEKAYEE--KNKALDNVKLMPQEIALIDTILDSN-----D
TRMB_CLOB8      -INYIAIDIKDEVLGLAKRNIEKAYEE--KNRKTDNVKLMAQEIGLISEILSEE-----D
TRMB_HUNT2      -KNFIAVDIKDEVLALAMKKIENEYAL--IGAETKNIRLMAHEIMLIHRMLDEN-----D
TRMB_CLOTE      -INYVAVDLKDEILIYVLRKLKE--------KEIENVRIVPLNIAFISEVFEK------D
TRMB_CLOK5      -INYIGIDLKDEVLIYALKKVVE--------AEAENIRIIPMNISKIENVFDR------D
TRMB_CLOAB      -KNYVAIDLKDEVIAIALRKITE--------SEVQNVRIAPLQIAFINEVFDK------D
TRMB_CLONN      -KNLISIDLKDEVLVYALKNIVD--------AELENVRLVAMNIGMIAEIFDE------N
TRMB_DESHY      -INYIAIDLYDEVLVKALRKINE--------KALHNVRVIPMNIAKLESIFKH------D
TRMB_MYCGE      -FLFIGIEREPTIVLKAINKINK------LDFNLENILLLCTDAKQLDDYFQA------E
TRMB_MYCPN      -CFFVGIEREPTIVLKAINKVNR------LEVKPRNLLITCLDANQLTEYLKP------Q
TRMB_UREPA      -INYLGIEKFPTVIVKAHKKALK--------HKLDNLAMICFDANKILELLNS------E
TRMB_UREP2      -INYLGIEKFPTVIVKAHKKALK--------HKLDNLAMICFDANKILELLNS------E
TRMB_MYCCT      -LNYIGMEKSSTITAIGLKKSLKEFQN--NSKKMTNIKYLNKYAENLLEIFYT------D
TRMB_MYCMS      -TNYIGMEKSSTITGVALKKSLKEFEN--QLKDMTNLKYFNNFAEDLSQMFSS------D
TRMB_MESFL      -INFIGMEKEETVVGVALKKTLAEFEQ--RNKEVTNLKYFNDFAEDLSDIFAP------S
TRMB_MYCGA      -INYFGIEKNATVILKMINKSEL-------LEQLTNLFIVHDDFALIDHEFPN------A
TRMB_MYCPE      -INFIAIDKYPTILAKLLNKLES------CSETLTNIKIISIDAKNINDIFDK------S
TRMB_MYCPU      -KIFVGIEKYPTVALIAAKKAKK--------LELNNFFIIVDDVENALDFFEG------T
TRMB_MYCHP      -IEYIGLEKYSTPAYSALKKAID--------LNLENFHIIIGDAINLSTYFKN------K
TRMB_MYCH2      -KNFLGVEKYPSAAVKSIKYVKK--------YNLSNFFILISDAKDLLDQIKG------K
TRMB_MYCH7      -KNFLGVEKYPSAAVKSIKYVKK--------YNLSNFFILISDAKDLLDQIKG------K
TRMB_MYCHJ      -KNFLGVEKYPSAAVKAIKYVKK--------YNLSNFFILISDAKDLLDRIKG------K
TRMB_MYCMO      -QNYLCVERDRTIASKAIEKFND--------LNLKNINLIVSDIQHLTEIIEN------K
TRMB_MYCS5      -QRFIAIEKYPTVAKKIMQKIKE--------LNLENLYISCIDASKLSENFIG------K
TRMB_BACFR      -KNFIAVDIKGARMWTGATESLQA--------GMKNVAFLRTNIEIIDRFFAE------G
TRMB_BACFN      -KNFIAVDIKGARMWTGATESFQT--------GMKNVAFLRTNIEIIDRFFAE------G
TRMB_BACTN      -KNFIAVDIKGSRMWTGATESLQA--------GMKNVAFLRTNIEIIERFFAA------G
TRMB_PORGI      -KNFIGIDIKGARMWAGAKESLQE--------GMSNVAFLRTDIELLDRFFAE------G
TRMB_GRAFK      -KNFIGIDIKGARFWRGAKTALEE--------GLDNVAFIRTQIELIEYVFAT------N
TRMB_CYTH3      -NNYIGLDIKGARLWKGSSLSIET--------GLTNTAFIRTKLQNLEEFFEP------G
TRMB_CHLSY      -SCFVGIDIVAKPLYRAVERAVAG--------NLSNILFIHADARLIYQRIPT------A
TRMB_CHLAA      -SCFVGIDIVAKPLYRAVERAVAG--------NLSNILFIHADARLIYQRIPT------A
TRMB_CHLAD      -ACFVGVDIVAKPLYRAVERAVEL--------GLENIIFLQADARLLYQRIPD------C
TRMB_CHLT3      -VNFIGVEVSMKPLYRAIKYSVRE--------QIENVRFIKTDFRLLYPLLPD------A
TRMB_RUBXD      -ANFVGVDLHLKSLHKAIRRAEEA--------NLQNIKFICADFRQMYPLLRP------S
TRMB_THEMA      -KDFVGFEVSITSFVKAQKKFKRYN--------LKNVRLVKVDARFGLRELFP-----DN
TRMB_COPPD      ---VVGFEVSLLSVEKAMKVIDHTK-----------TALLLMDGIWGLRELFS-----ER
TRMB_CHLPD      -RLFIGIEKKPGMITEVSKRVASHN--------LNNIRLLESCAKDAFADLFP-----AN
TRMB_AQUAE      -KNFFGIEISQISIEKLMKRVGKKG--------LKNVYCTNVDAYWGFYFLFR-----DN
TRMB_NEOSM      -KVFVGAEVYVNGIARLLEQVELHE--------LSNVLIWNDDVRLLLEKLLC------K
TRMB_WOLPM      -LLFIGCEPYLKGVSRLLTNIEIQN--------IKNILMWTEDARELIANFPD------N
TRMB_RHOBA      -HNYFGIEIARKYAAHAAARLAKRE--------RANAKMLAGDATPLFAVTDEGKRIEDG
TRMB_BDEBA      -RLLVGLELKYKPLIQSIRRAVNAG--------CKNAAITRFHAFNIDHLFAE------G
                    .  :                                                    

TRMB_TRIV2      ILQRVTIQFPDPWFKTRHAKRRVVQPELVQDIANYLAVG-GVVFLQSDMEFVAVEMCDRF
TRMB_NOSS1      ILQRVTIQFPDPWFKTRHAKRRVVQPELVQDIANYLAVG-GVVFLQSDMEFVAVEMCDRF
TRMB_MICAN      KLFWVSIQFPDPWFKQRHSKRRVVQPELVIALAKYMVAG-GWVFLQSDVESIALEMTERF
TRMB_SYNP6      ILQRVSIQFPDPWFKKRHQKRRVVQPELVQALATALPAG-AEVFLQSDVLEVQAEMCEHF
TRMB_SYNE7      ILQRVSIQFPDPWFKKRHQKRRVVQPELVQALATALPAG-AEVFLQSDVLEVQAEMCEHF
TRMB_TRIEI      ILKKVSILFPDPWFKRRHQTRRVVQPKLVEDLANYLTVG-GEVFLHSDIEKVAKEMCNRF
TRMB_SYNY3      TLQRVSIQFPDPWFKQRHNKRRVAQPELVTAIANALPPG-GEVLLQSDVEPVAQDMRDRF
TRMB_THEEB      --HTVTIQFPDPWFKRRHHKRRVVTPELVATLAELLPAG-GRVVLQSDVFEVAESMVQQF
TRMB_SYNJA      DLSRVTIQFPDPWFKKRHHKRRIVQPRLVADLALLLQPG-SPVFLQSDVREVAEEMVDRF
TRMB_SYNJB      DLSRVTILFPDPWFKKRHHKRRIVQPQLVADLALLLRPG-SPVFLQSDIQEVAEEMAARF
TRMB_PROMM      QLQWVSIQFPDPWFKRRHQKRRVLQPSLLIALATALQPG-RELFIQSDVLSVIEPMVMLI
TRMB_PROM3      QLQWVSIQFPDPWFKRRHQKRRVLQPSLLIALATALQPG-RELFIQSDVLSVIEPMVMLI
TRMB_SYNSC      QLQRVSIQFPDPWFKRRHRKRRVLQPALLLAIATALQPG-RELFLQSDVLNVIEPMVALT
TRMB_SYNPX      RLQRVSVQFPDPWFKRRHRKRRVLQPALLLAIAAALQPG-RELFLQSDVLAVIEPMVALT
TRMB_SYNS9      RLQRVSIQFPDPWFKRRHRKRRVLQPRLLMAIASALQPG-KDFFIQSDVREVIDPMVALT
TRMB_SYNS3      QLQLVSIQFPDPWFKQRHRKRRVLQPALLLAIAAALHPG-RHLFLQSDVLAVIEPMVALV
TRMB_SYNPW      RLQLVSIQFPDPWFKRRHRKRRVLQPSLLLAIAATLQPG-RELFVQSDVLAVIDPMVALV
TRMB_PROMA      QLKRVSIQFPDPWFKKRHRKRRVLNQSFLFLLAQSLDIG-SELFIQSDVISVMDEMTEII
TRMB_PROMT      QLKRVSIQFPDPWFKRKHFKRRVLKTNILNSIAKAMSKN-GEIFIQSDIFELIEYMTNTI
TRMB_PROM1      QLKRVSIQFPDPWFKRKHFKRRVLNTNILNSIAKSMSKD-GEIFIQSDILKLIEYMTNTI
TRMB_PROMS      NLKSISFYFPDPWFKKRHYKRRVIQPEFINILSNLLQKG-TLIFIKTDVKDLFDYMDYTI
TRMB_PROM2      NIKSISFNFPDPWFKKRHYKRRVIQPEFINVLSNQLQKG-TLIFIKTDVKELFDYMDRTI
TRMB_PROM9      NVKSISFNFPDPWFKKRHYKRRVIQPEFLNLLSNSLQKG-SLIFIKTDVKDLFDYMDCII
TRMB_PROMP      LITSISFNFPDPWFKKKHHKRRVIQPKLLNLLSNSMKKG-SLIFIKTDVRDLFDHMELTI
TRMB_PROM5      AITSISFYFPDPWFKKKHHKRRVIQPEFINLLSNAMRTR-SLIFIKTDVQELFEYMELTI
TRMB_GEOSL      SLAAVYINCPDPWPKKRHRKRRLVNTQFVRFIRDYLAPG-GDFYFATDFDDYGEDVAAFM
TRMB_GEOMG      SLCAVHINCPDPWPKMRHRKRRLVNREFAAFIREYLAPG-GDFYFATDFDDYGIDVAEFM
TRMB_PELCD      SLAAVYINCPDPWPKKRHLKRRLVNERFLQTLLHYLQPG-GELFFSSDVADYAHAVTAHL
TRMB_MYXXD      SLAAIHLQFPDPWWKRSHAKRAVIQPAFAELLYGKLAPG-GLFDMRTDVQDRGVTMLAIL
TRMB_ANADE      SLAAIHVHFPDPWWKRRHHRRRLVDDRMSALLLGLLAPG-GVLDFRTDVERYAREAVVRL
TRMB_THET8      TLDQVIVNFPDPWPKKRHQERRLLREAFFRRLSTRLKPG-GSLLLTTDHEEYFRFALEEA
TRMB_THET2      TLDQVIVNFPDPWPKKRHQERRLLREAFFRRLSTRLKSG-GSLLLTTDHEGYFRFALEEA
TRMB_DEIGD      SLDAIVVNFPDPWPKAGHAEHRLLRAPFFRLAASRLKPG-GAVLLTTDHDEYFEFACREA
TRMB_DEIRA      SLDAIIVNFPDPWPKAGHEDHRLLRVPFFQVAASRLKPG-GAALLTTDHDEYFEFACAQA
TRMB_CHLAB      VIQRIVVNFPDPWPKSRHRKHRLFQYEFMNDIVRVLVDS-GIIILATDDKNYLLQAIKIM
TRMB_CHLCV      ILQRIVVNFPDPWPKSRHRKHRLFQDEFMNDVVRVLVES-GILVLATDDKNYLVEAIKMM
TRMB_CHLFF      VVQRIIVNFPDPWPKSRHRKHRLFQDEFLNNVVRVLTEP-GILILATDDKNYLLQAIQIM
TRMB_CHLTR      SFQKIVVNFPDPWPKFRHRKHRLFQDLFVQDMMRTLVVG-GQLTLATDDYNYLVNAITVM
TRMB_CHLTA      SFQKIVVNFPDPWPKFRHRKHRLFQDLFVQDMMRTLVVG-GQLTLATDDYNYLVNAITVM
TRMB_CHLMU      SFQKIVVNFPDPWPKFRHRKHRLFQDVFVQDMVRVLVEG-GQLTLVTDDHTYLTNSIQVM
TRMB_CHLPN      FLQRLVVNFPDPWPKMRHRKHRLLQPSFVQEISRSLQDS-AVFALATDDKTYLLESIEAL
TRMB_PARUW      SVDAVFINFPDPWPKKRHAKHRIVQPAFVKEIHRILKSD-KLFTLVTDDAAYSKIMIDVI
TRMB_LEPIN      LFSEILLNFPDPWPKKRHHKKRTVNSKFLESLKILLPEK-GKFYFATDYGPYARKVIRLF
TRMB_LEPIC      LFSEILLNFPDPWPKKRHHKKRTVNSKFLESLKILLPEK-GKFYFATDYGPYARKIIRLF
TRMB_LEPBJ      LFSEILLNFPDPWPKKRHHKKRTINSKFIESLRVLLPEK-GKFSFATDYGPYARKTIRLF
TRMB_LEPBL      LFSEILLNFPDPWPKKRHHKKRTINSKFIESLRVLLPEK-GKFSFATDYGPYARKTIRLF
TRMB_NITEU      SLDGIHIFFPDPWPKARHHKRRLIQPDFVSLLCDRLKPG-GYLHIATDWEDYATHILHVL
TRMB_NITEC      SLDGIHIFFPDPWPKARHHKRRLIQSDFVSLLCNRLKPG-GYLHIATDWEDYAIHSLHVL
TRMB_NITMU      CLDGVHVFFPDPWPKARHHKRRLIQAEFVDLLCSRLKPG-GYIHVATDWEDYAEQILEVL
TRMB_BURVG      SLDGVHIFFPDPWHKARHHKRRLIQPPLVAQLAARLKPG-AYLHCATDWQNYAEQMLEVL
TRMB_BURCM      SLDGVHIFFPDPWHKARHHKRRLIQPPLVAHLASRLKPG-AYLHCATDWQNYAEQMLEVL
TRMB_BURL3      SLDGVHIFFPDPWHKARHHKRRLIQPPLVAHLVSRLKPG-AYIHCATDWQNYAEQMLEVL
TRMB_BURCH      SLDGVHIFFPDPWHKARHHKRRLIQPPLVAHLASRLKPG-AYLHCATDWQNYAEQMLEVL
TRMB_BURCA      SLDGVHIFFPDPWHKARHHKRRLIQPPLVAHLASRLKPG-AYLHCATDWQNYAEQMLEVL
TRMB_BURPS      SLDGVHIFFPDPWHKARHHKRRLIQPPFVAQLAAHLKPG-AYLHCATDWQNYAEQMLEVL
TRMB_BURP1      SLDGVHIFFPDPWHKARHHKRRLIQPPFVAQLAAHLKPG-AYLHCATDWQNYAEQMLEVL
TRMB_BURMA      SLDGVHIFFPDPWHKARHHKRRLIQPPFVAQLAAHLKPG-AYLHCATDWQNYAEQMLEVL
TRMB_BURTA      SLDGAHIFFPDPWHKARHHKRRLIQPPFVAQLAARLKPG-AYLHCATDWQNYAEQMLEVL
TRMB_PARXL      SLDGVHIFFPDPWHKARHHKRRLIQPKFVALLVSRLKPG-AYLHCATDWQNYAEQMLEVL
TRMB_THIDA      TLAGIHIFFPDPWHKKRHHKRRLIQAPLVELLASRLAPG-GYIHLATDWQDYAEQMLVVL
TRMB_METFK      SLDGVHIFFPDPWHKKRHHKRRLIQAAFVKLLCSKMKAG-AYLHVATDWQEYAEWVLDIL
TRMB_CUPNH      CLDGVHIYFPDPWHKKRHNKRRLVQPPLVKVLAARLKPG-GYIHCATDWEEYAHQMLEVL
TRMB_CUPPJ      CLDGVHIYFPDPWHKKRHNKRRLVQPPLVKLLASRLKPG-GYIHCATDWEEYAHQMVEVL
TRMB_CUPMC      SLDGVHIYFPDPWHKKRHNKRRLVQPPLVKLLASRLKPG-GYIHCATDWEEYAHQMVEVL
TRMB_RALSO      TLDGIHVFFPDPWHKKRHNKRRLIQGPFVARLAAHLRPG-GYLHCATDWEEYAHQMLEVL
TRMB_ACISJ      ALDGVHIFFPDPWHKKRHNKRRLIQPPLVAQLAARLKPG-GYIHCATDWQPYAEQMLEVL
TRMB_ACIAC      SLDGVHIFFPDPWHKKRHNKRRLVQPPLVAKLARRLKPG-GYLHCATDWQPYAEQMLEVL
TRMB_VEREI      CLAGVHIFFPDPWHKSRHHKRRLIQPPLVARLAARLQAG-GYLHCATDWQPYAEQMLQVL
TRMB_POLSJ      SLDGVHIFFPDPWHKKKHNKRRLIQAPLIAKLAARLKPG-GYLHCATDWQPYAEQILEVL
TRMB_POLNA      SLDGAHIFFPDPWHKTKHNKRRLIQAPLIAKLAARLKPG-GYLHCATDWQPYAEQILEVL
TRMB_RHOFT      SLDGVHIFFPDPWHKKKHNKRRLIQSALIAKLAARLKVG-GYIHCATDWQPYAEQILEVL
TRMB_NEIMB      SLDGIHIFFPDPWHKKRHHKRRLIQAPFIAKLLPKLKTG-GYIHLATDWEEYAQQMLEVL
TRMB_NEIMA      SLDGIHIFFPDPWHKKRHHKRRLIQAPFIAKLLPKLKTG-GYIHLATDWEEYAQQMLEVL
TRMB_NEIMF      SLDGIHIFFPDPWHKKRHHKRRLIQAPFIAKLLPKLKTG-GYIHLATDWEEYARQMLEVL
TRMB_NEIM0      SLDGIHIFFPDPWHKKRHHKRRLIQAPFIAKLLPKLKTG-GYIHLATDWEEYAQQMLEVL
TRMB_NEIG1      SLDGIHIFFPDPWHKKRHHKRRLIQAPFIAKLLPKLKTG-GYIHLATDWEEYAQQMLEVL
TRMB_CHRVO      SLDGVHIFFPDPWHKKRHNKRRLIQAPLVEKLAKKLKPG-GYFHAATDWEDYAIQILEVL
TRMB_AZOSB      ALAGVHVFFPDPWRKARHYKRRLIQPDFVALVAQKLAPG-GYLHCATDWEHYAHWMLEIL
TRMB_AROAE      ALAGVHVFFPDPWHKKRHHKRRIIQPDFVALIASRLAPG-AYLHCATDWEEYAQWMLEVL
TRMB_DECAR      SLDGVHVFFPDPWHKARHNKRRLIQSPFVALLASRLKPG-GYFHCATDWEEYAHQMLEVL
TRMB_BORBR      SLAGVHVYFPDPWPKKRHHKRRLLQPPFVALLASRLAPG-GYLHCATDWEDYAVQMLEVL
TRMB_BORPA      SLAGVHVYFPDPWPKKRHHKRRLLQPPFVALLASRLAPG-GYLHCATDWEDYAVQMLEVL
TRMB_BORPE      SLAGVHVYFPDPWPKKRHHKRRLLQPPFVALLASRLAPG-GYLHCATDWEDYAVQMLEVL
TRMB_BORA1      SLAGVHVYFPDPWPKKRHHKRRLLQPAFVQLLASRIKPG-GYLHCATDWQDYAVQMLEVL
TRMB_NITOC      SLDGVQIFFPDPWPKKRHHKRRLIQPSFVDLLERKIKPG-GWFHLATDWQDYAEQIKAVL
TRMB_ALKEH      SLHGVQLFFPDPWPKKRHHKRRLVQPQWVRAVAAKLAPG-GFLHLATDWADYAEHMLDVL
TRMB_HALHL      SLETVQIFFPDPWPKKRHHKRRIIQPAFLDLLAERLVPG-GALHLATDWADYAEWMLDTL
TRMB_LEIXX      SVAEALLFFPDPWPKARHHRRRLVQPDVVRLLARALAAD-GVLRLATDWEPYADHMLAVL
TRMB_XYLFA      ALDEIRIYFPDPWHKKRHHKRRLIQPLFATLLVRKLRVG-GCLHMATDWADYAEQMWDVL
TRMB_XYLFT      ALDEIRIYFPDPWHKKRHHKRRLIQPLFATLLVRKLRVG-GCLHMATDWADYAEQMWDVL
TRMB_XANC5      ALDEVRIYFPDPWHKKRHNKRRLIQPAFAQLLVRKLREG-GRLHAATDWADYAEQMWDVL
TRMB_XANAC      ALDEVRIYFPDPWHKKRHNKRRLIQPAFAQLLVRKLREG-GRLHAATDWADYAEQMWDVL
TRMB_XANOM      ALDEVRIYFPDPWHKKRHNKRRLIQPAFAQLLVRKLRDG-GRLHAATDWADYAEQMWDVL
TRMB_XANOR      ALDEVRIYFPDPWHKKRHNKRRLIQPAFAQLLVRKLRDG-GRLHAATDWADYAEQMWDVL
TRMB_XANCP      ALDEVRIYFPDPWHKKRHNKRRLVQPAFAQLLVRKLRDG-GRLHAATDWADYAEQMWDVL
TRMB_XANC8      ALDEVRIYFPDPWHKKRHNKRRLVQPAFAQLLVRKLRDG-GRLHAATDWADYAEQMWDVL
TRMB_METCA      ALARILVFFPDPWHKQRHKKRRLVSPAFARLAASRLAPG-GVFHAATDWEDYAMQMLEVL
TRMB_STRAW      SLDGLRVYFPDPWPKKRHHKRRLIQPEFLTLAATRLRPG-ALVHCATDWEPYAEQMLDVL
TRMB_STRCO      SLAGLRVYFPDPWPKKRHHKRRLIQPEFLTLAATRLAPG-AVVHCATDWEPYAEQMLDVL
TRMB_SHESM      SLARVQLFFPDPWHKKRHHKRRIVQAEFAELIRRKLKIG-GVFHMATDWENYSEHMLEVM
TRMB_SHESA      SLARVQLFFPDPWHKKRHHKRRIVQAEFAELIRRKLKIG-GVFHMATDWENYSEHMLEVM
TRMB_SHESR      SLARVQLFFPDPWHKKRHHKRRIVQAEFAELIRRKLKIG-GVFHMATDWENYSEHMLEVM
TRMB_SHEON      SLTRVQLFFPDPWHKKRHHKRRIVQAEFAELIRRKLKIG-GVFHMATDWENYSEHMLEVM
TRMB_SHEPC      SLARVQLFFPDPWHKKRHHKRRIVQAEFAELVRRKLKIG-GVFHMATDWEEYSEHMLEVM
TRMB_SHESW      SLARVQLFFPDPWHKKRHHKRRIVQAEFAELVRSKLKIG-GVFHMATDWEEYSEHMLEVM
TRMB_SHEB8      SLARVQLFFPDPWHKKRHHKRRIVQAEFAELIRRKLKIG-GVFHMATDWEEYSEHMLEVM
TRMB_SHEB5      SLARVQLFFPDPWHKKRHHKRRIVQAEFAELIRRKLKIG-GVFHMATDWEEYSEHMLEVM
TRMB_SHEB9      SLARVQLFFPDPWHKKRHHKRRIVQAEFAELIRRKLKIG-GVFHIATDWEEYSEHMLEVM
TRMB_SHEFN      SLERVQLFFPDPWHKKRHHKRRIVQAEFVQLIRRKLKIG-GVFHMATDWENYSEHMLEIM
TRMB_SHEDO      SLSRVQLFFPDPWHKKRHHKRRIVQAEFAELIRRKLKLG-GVFHMATDWENYSEHMLEVM
TRMB_SHEHH      SLACVQLFFPDPWHKTRHHKRRIVQAPFAELIRSKLKVG-GVFHLATDWENYSEHMLEVM
TRMB_SHEPA      SLACVQLFFPDPWHKTRHHKRRIVQAPFAELIRSKLKVG-GVFHLATDWENYSEHMLEVM
TRMB_SHESH      SLARVQLFFPDPWHKKRHHKRRIVQSEFAQLIRNTLKIG-GVFHLATDWENYSEHMLEVM
TRMB_SHEAM      SLARVQLFFPDPWHKKRHHKRRIVQPEFVELLRRKLKIG-GVFHMATDWENYAEHMLEVM
TRMB_VIBPA      SLATLQLFFPDPWHKKRHHKRRIVQLEFAEMVRQKLIPNEGIFHMATDWENYAEHMIEIM
TRMB_VIBCB      SLATLQLFFPDPWHKKRHHKRRIVQLEFAEMVRQKLILNEGIFHMATDWENYAEHMIEIM
TRMB_VIBVY      SLATLQLFFPDPWHKKRHHKRRIVQLEFAEMVRQKLIPNEGIFHMATDWENYAEHMIEIM
TRMB_VIBVU      SLATLQLFFPDPWHKKRHHKRRIVQLEFAEMVRQKLIPNEGIFHMATDWENYAEHMIEIM
TRMB_VIBCH      SLHTLQLFFPDPWHKKRHHKRRIVQLEFAEMVRQKLMIGSGVFHMATDWENYAEHMVEVM
TRMB_VIBC3      SLHTLQLFFPDPWHKKRHHKRRIVQLEFAEMVRQKLIIGSGVFHMATDWENYAEHMVEVM
TRMB_PHOPR      SLETVQLFFPDPWHKTRHHKRRIVQPAFAEMLRKKLKIG-GTFHMATDWENYAEHMVEVM
TRMB_AERHH      SLACLQLFFPDPWHKSRHHKRRIVQPAFVQDIRQKLAIG-GVFHMATDWENYAEHMLEVM
TRMB_PSEA6      SLSRMQLFFPDPWHKKRHHKRRIVQPEFVEKLRGKLAIG-GVFHMATDWENYAEHMLEIM
TRMB_PSEHT      SLTTLQLFFPDPWHKKRHHKRRIVQGEFVEKLRSQLKMG-GVFHMATDWENYAEHMLEVM
TRMB_COLP3      TLTTVQLFFPDPWHKKKHHKRRIVSAEFVETIRQKLKVG-GVFHMATDWENYAECMLEDM
TRMB_PSYIN      SLAVFQLYFPDPWHKARHHKRRIVQPHFIENMRHKLAIG-GVIHMATDWENYAEHMLAVL
TRMB_SALCH      SLSMVQLFFPDPWHKARHNKRRIVQVPFAELVLSKLKLG-GVFHMATDWEAYAEHMLEVM
TRMB_SALPA      SLSMVQLFFPDPWHKARHNKRRIVQVPFAELVLSKLKLG-GVFHMATDWEAYAEHMLEVM
TRMB_SALTI      SLSMVQLFFPDPWHKARHNKRRIVQVPFAELVLSKLKLG-GVFHMATDWEAYAEHMLEVM
TRMB_SALAR      SLSMVQLFFPDPWHKARHNKRRIVQVPFAELVLSKLKLG-GVFHMATDWEAYAEHMLEVM
TRMB_SALTY      SLSMVQLFFPDPWHKARHNKRRIVQVPFAELVLSKLKLG-GVFHMATDWEAYAEHMLEVM
TRMB_ECOL6      SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLG-GIFHMATDWEPYAEHMLEVM
TRMB_ECOUT      SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLG-GIFHMATDWEPYAEHMLEVM
TRMB_ECOK1      SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLG-GIFHMATDWEPYAEHMLEVM
TRMB_ECOL5      SLRMVQLFFPDPWHKARHNKRRIIQVPFAELVKSKLQLG-GIFHMATDWEPYAEHMLEVM
TRMB_ECOHS      SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLG-GVFHMATDWEPYAEHMLEVM
TRMB_ECO57      SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLG-GVFHMATDWEPYAEHMLEVM
TRMB_ECOLC      SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLG-GVFHMATDWEPYAEHMLEVM
TRMB_SHISS      SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLG-GVFHMATDWEPYAEHMLEVM
TRMB_ECO24      SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLG-GVFHMATDWEPYAEHMLEVM
TRMB_SHIFL      SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLG-GVFHMATDWEPYAEHMLEVM
TRMB_ECOLI      SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLG-GVFHMATDWEPYAEHMLEVM
TRMB_SHIF8      SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLG-GVFHMATDWEPYAEHMLEVM
TRMB_SHIDS      SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLG-GVFHMATDWEPYAEHMLEVM
TRMB_SHIBS      SLRMVQLFFPDPWHKARHNKRRIVQVPFAELVKSKLQLG-GVFHMATDWEPYAEHMLEVM
TRMB_KLEP7      SLNMVQLFFPDPWHKARHNKRRIVQPPFAELVKSKLKLG-GVFHMATDWEAYAVHMLEVM
TRMB_CROS8      SLHMVQLFFPDPWHKARHNKRRIVQVPFAQLVLRKLQPG-GVFHMATDWEPYAEHMLEVM
TRMB_YERPE      SLDMVQLFFPDPWHKARHNKRRIVQTPFVELVKSKLKVG-GVFHMATDWQPYAEHMLEVM
TRMB_YERPP      SLDMVQLFFPDPWHKARHNKRRIVQTPFVELVKSKLKVG-GVFHMATDWQPYAEHMLEVM
TRMB_YERPA      SLDMVQLFFPDPWHKARHNKRRIVQTPFVELVKSKLKVG-GVFHMATDWQPYAEHMLEVM
TRMB_YERPN      SLDMVQLFFPDPWHKARHNKRRIVQTPFVELVKSKLKVG-GVFHMATDWQPYAEHMLEVM
TRMB_YERP3      SLDMVQLFFPDPWHKARHNKRRIVQTPFVELVKSKLKVG-GVFHMATDWQPYAEHMLEVM
TRMB_YERPS      SLDMVQLFFPDPWHKARHNKRRIVQTPFVELVKSKLKVG-GVFHMATDWQPYAEHMLEVM
TRMB_YERE8      SLDMVQLFFPDPWHKARHNKRRIVQAPFVELVKSKLKVG-GVFHMATDWQHYAEHMLEVM
TRMB_SERP5      SLDMVQLFFPDPWHKARHNKRRIVQTPFVELVRRKLKVG-GVFHMATDWQPYAEHMLEVM
TRMB_PECAS      SLSMVQLFFPDPWHKVRHNKRRIVQAPFVELVQSKLKVG-GVFHMATDWEPYARHMLKVM
TRMB_PHOLL      RLEMVQLFFPDPWHKVRHNKRRIVQPPFAELIKSKLKVG-GVFHMATDWQPYAEHMLEVM
TRMB_SODGM      SLALVQLFFPDPWHKARHNKRRIIQAPFVELVGRKLAAG-GVFHMATDWQPYAEHMLAVM
TRMB_IDILO      SLNCVQIFFPDPWHKKRHHKRRIVQPEFVKLLIQKIETG-GVIHLATDWENYAEHMLEVL
TRMB_ACTP2      SLGGLQLYFPDPWQKAKHHKRRIVQPEFITRVLTKLGDN-GFIHFATDWENYAEHMLEVL
TRMB_HAEDU      SLAGLQLYFPDPWQKSKHHKRRIVQTEFVMRLLTKLTAG-GFIHFATDWQNYAEHMLAVL
TRMB_HAES1      SLAGLQLFFPDPWHKTKHHKRRIVQPHFVEKIQQKLVPN-GFVHMATDWENYAEYMLEVL
TRMB_HISS2      SLAGLQLFFPDPWHKTKHHKRRIVQPHFVEKIQQKLVPN-GFVHMATDWENYAEYMLEVL
TRMB_MANSM      SLGGLQLFFPDPWHKSKHHKRRIVQPNFVDNVMQKLQQS-GFIHMATDWENYAEQMLDVL
TRMB_HAEI8      ALGGLQLFFPDPWHKAKHHKRRIVQPHFVTQVIQKLGKN-GFIHMATDWENYAEQMLEVL
TRMB_HAEIN      ALGGLQLFFPDPWHKAKHHKRRIVQPHFVTQVIQKLGEN-GFIHMATDWENYAEQMLEVL
TRMB_HAEIG      TLGGLQLFFPDPWHKAKHHKRRIVQPHFVTQVIQKLSEN-GFIHMATDWENYAEQMLEVL
TRMB_HAEIE      ALGGLQLFFPDPWHKAKHHKRRIVQPHFVAQVVQKLAGN-GFIHMATDWENYAEQMLEVL
TRMB_PASMU      SLGGLQLFFPDPWHKAKHHKRRIVQPQFVNTITQKLTTG-GFIHMATDWENYAEHMLAVL
TRMB_ACTSZ      SLGGLQLFFPDPWHKAKHHKRRIVQPQFVKTVTQKLTSG-GFIHFATDWQNYAEHMLNVL
TRMB_HAHCH      SLDRVQLFFPDPWHKKRHNKRRIVQLEFVQRIRAKLKSG-GVFHMATDWEPYAEHMMEIM
TRMB_MARHV      CLDRVMVFFPDPWHKKKHHKRRLIQPEFVQRIRHKLRVG-GILHLATDWENYAEHMLEVM
TRMB_SACD2      SLDRLQLFFPDPWHKKKHNKRRIVQPEFVEKIRAKLKIG-GHFHMATDWEAYAEHMMEVM
TRMB_ALCBS      SLARVQLYFPDPWHKKKHHKRRIVQPAWVALVQRKLQPG-GILHMATDWENYAEHMMEVM
TRMB_PSEPK      SLDRLMLFFPDPWHKARHHKRRIVQLEFAELVRRKLKPG-GVFHMATDWEPYAEYMLEVM
TRMB_PSEPG      SLDRLMLFFPDPWHKARHHKRRIVQLEFAELVRRKLKPG-GVFHMATDWEPYAEYMLEVM
TRMB_PSEP1      SLDRLMLFFPDPWHKARHHKRRIVQLEFAELVRRKLKPG-GVFHMATDWEPYAEYMLEVM
TRMB_PSEE4      SLDRLMLFFPDPWHKARHHKRRIVQPEFAELVRRKLKVG-GVFHMATDWEPYAEHMLEVM
TRMB_PSEPF      SLDRLMLFFPDPWHKSRHHKRRIVQASFAELVRSKLKVG-GILHMATDWEPYAEYMLEVM
TRMB_PSEF5      SLDRLMLFFPDPWHKSRHHKRRIVQASFAELVRSKLKVG-GILHMATDWEPYAEYMLEVM
TRMB_PSEU2      SLDRLMLFFPDPWHKSRHHKRRIVQPEFAALVRSKLKVG-GVFHMATDWGPYAEYMLEVM
TRMB_PSE14      SLDRLMLFFPDPWHKSRHHKRRIVQPEFAALVRSKLKVG-GVFHMATDWGPYAEYMLEVM
TRMB_PSESM      SLDRLMLFFPDPWHKSRHHKRRIVQPEFAALVRSKLKVG-GVFHMATDWGPYAEYMLEVM
TRMB_PSEAE      SLDRLLLFFPDPWHKKRHHKRRIVQPEFAELVRRKLKVG-GVLHMATDWEPYAEHMLDVM
TRMB_PSEA7      SLDRLLLFFPDPWHKKRHHKRRIVQPEFAELVRRKLKVG-GVLHMATDWEPYAEHMLDVM
TRMB_PSEAB      SLDRLLLFFPDPWHKKRHHKRRIVQPEFAELVRRKLKVG-GVLHMATDWEPYAEHMLDVM
TRMB_PSEMY      SLDRVLLFFPDPWHKSRHHKRRIVQPAFAELVRRKLKIG-GVLHMATDWENYAEHMLEVM
TRMB_PSEU5      SLDRVLLFFPDPWHKSRHHKRRIVQPAFAELVRRKLKVG-GVLHMATDWEPYAEHMLEVM
TRMB_CHRSD      SLTGLQLFFPDPWPKKKHHKRRIVQPAFVELVRTRLAPH-GYLHMATDWEAYAEHMVEVM
TRMB_HYDCU      SLSAVYLFFPDPWHKTKHKKRRILQAEFAEKIAQYLAPG-GQFHMATDWEDYALHMMSVM
TRMB_LEGPA      SLAGVQIFFPDPWHKKRHHKRRLIQSEFIQMLVKKIRPS-GFIHCATDWEDYAEHILNVL
TRMB_LEGPH      SLAGVQIFFPDPWHKKRHHKRRLIQSEFIQMLVKKIRPS-GFIHCATDWEDYAEHILNVL
TRMB_LEGPL      SLAGVQIFFPDPWHKKRHHKRRLIQSEFIQMLVKKIRPS-GFIHCATDWEDYAEHILNVL
TRMB_LEGPC      SLAGVQIFFPDPWHKKRHHKRRLIQSEFIQMLVKKIRPS-GFIHCATDWEDYAEHILNVL
TRMB_FRATF      SLASIQVYFPDPWHKKKHNKRRLVNQTNIDLFAKKLKVG-GVFHYASDWLPYAEEVLELL
TRMB_FRATN      SLASIQVYFPDPWHKKKHNKRRLVNQTNIDLFAKKLKVG-GVFHYASDWLPYAEEVLELL
TRMB_FRATO      SLASIQVYFPDPWHKKKHNKRRLVNQTNIDLFAKKLKVG-GVFHYASDWLPYAEEVLELL
TRMB_FRAP2      SLSGMQIYFPDPWHKKKHNKRRLVNQSNVDLFAKKLKVG-GVFHYASDWLPYAEEVLELL
TRMB_TREDE      SVDGFHIFFPDPWQKKRNHKRRLVRRPRTDLLSKKLKDG-GYIYMVTDWENYAEDAFEQL
TRMB_TREPA      TLAGLHIFFPDPWPKTRHHKRRLLYRPRTDLLARALAPG-GYLYAVTDWAEYARRAQEEL
TRMB_BUCAI      TLSKVQIFFPDPWHKKRHHKRRLLKNIFLKIITKKLIID-GILHIATDSESYAFYILDEI
TRMB_BUCAP      TLSKVQIFFPDPWNKKRHHKRRMIQDFFLIKILKKLNND-GILHIVTDSKEYNFFILNLI
TRMB_BUCBP      SLSEVYILFPDPWPKRRHHKRRIITKELLEVILKKLVFG-GYLNIATDCQIYAKSILNII
TRMB_NOCFA      SLTGVRVFFPDPWPKARHHKRRLLQPATVALIAGRLRPG-GVLHVATDHAGYAEHIAAVG
TRMB_RHOJR      SLTGVRVFFPDPWPKARHHKRRLLQSPTFALIASRLKAG-GVLHVATDHAEYAEAIAEAG
TRMB_MYCSK      SLTGVRVFFPDPWPKARHHKRRLLQPSTVALIADRLRPG-GILHAATDHAGYAEQIAAVG
TRMB_MYCSS      SLTGVRVFFPDPWPKARHHKRRLLQPSTVALIADRLRPG-GILHAATDHAGYAEQIAAVG
TRMB_MYCGI      SLTGVRVFFPDPWPKARHHKRRLLQPDTMALIADRLRPG-GVLHAATDHQGYAAHIAEVG
TRMB_MYCVP      SLTGVRVFFPDPWPKARHHKRRLLQPDTVALIADRLRPG-GILHAATDHMGYAGHIAEVG
TRMB_MYCBP      SLCGVRVFFPDPWPKARHHKRRLLQPATMALIADRLVPS-GVLHAATDHPGYAEHIAAAG
TRMB_MYCTU      SLCGVRVFFPDPWPKARHHKRRLLQPATMALIADRLVPS-GVLHAATDHPGYAEHIAAAG
TRMB_MYCBO      SLCGVRVFFPDPWPKARHHKRRLLQPATMALIADRLVPS-GVLHAATDHPGYAEHIAAAG
TRMB_MYCUA      SLTGVRVFFPDPWPKARHHKRRLIQPSTVVLIADRLLPG-GVFHAATDHPGYAEHIIAAG
TRMB_MYCA1      SLTGVRVFFPDPWPKARHHKRRFLQPGTVGLIADRLLPG-GVLHVATDHAGYAEHIADVG
TRMB_MYCPA      SLTGVRVFFPDPWPKARHHKRRFLQPGTVGLIADRLLPG-GVLHVATDHAGYAEHIADVG
TRMB_MYCLE      SLTGVRVFFPDPWPKVRHHKRRFLQPATVELIADRLLPG-GVLHTATDHPDYAKQIAKFG
TRMB_CORGB      SLDGIRVYFPDPWPKARHNKRRIIQSGPLNLFAKKLKPG-GVLHVATDHADYAEWINELV
TRMB_CORGL      SLDGIRVYFPDPWPKARHNKRRIIQSGPLNLFAKKLKPG-GVLHVATDHADYAEWINELV
TRMB_COREF      SLDGVRIFFPDPWPKARHNKRRIIQSGPLNLIAKKLKPG-GVLHVATDHADYAEWINELV
TRMB_CORDI      SLDGVRIYFPDPWPKARHHKRRIIQSGVLNLIASRLKPG-GVLHVATDHADYAEWITELV
TRMB_CORJK      SLSGVRIYFPDPWPKARHHKRRIVQSGTLHLIASRLKPG-GILHIATDHADYAEWIDELV
TRMB_CUTAK      DLDELWTFFADPWHKKRHHKRRIVNPDTARLVTSRLRPG-GLWRLATDWDDYAHWMLEVL
TRMB_NOCSJ      SLAALWTFFPDPWHKAKHHKRRLVTASFARLVAGRLAPG-AEWRLATDWADYADQMVEVL
TRMB_PAEAT      SVSELWVFFPDPWHKARHHKRRLIQPAFASVAAKALVKG-GYWRIATDWSNYAVHVREVL
TRMB_ARTS2      SVSEVWVFFPDPWHKSRHHKRRLIQPEFAALVAAALKPG-GLFRVATDWSNYAVHVRDVM
TRMB_BIFAA      SIAEVWTFFPDPWPKMRHHKRRIVQPELAADIHRALTDE-GVWRIATDIEDYALHVHEVM
TRMB_BIFLO      TVAEVWTFFPDPWPKKKHHKRRIVQKAMAGDIHRALVTD-GVWRIATDIEDYALHVHEVM
TRMB_PSYCK      HIDRIQLYFPDPWQKKRHHKRRFVSPERMAIVTRSLKQG-GWFHTATDWEHYAFWMVEVL
TRMB_PSYA2      HIDRIQLYFPDPWQKKRHYKRRFVSAERMAIVTRSLKQG-GWFHTATDWEHYAFWMVEVL
TRMB_ACIAD      SINCVQLYFPDPWQKKRHFKRRFVIHERMQLVEQKLELG-GTFHAATDWEPYAEWMLDVL
TRMB_RHIME      SVDQIDLLYPDPWPKRKHWKRRFVSQINLDRFARILKPG-GLFCFASDIDSYINWTLIHC
TRMB_SINMW      SVDQIDLLYPDPWPKRKHWKRRFVSEVNLDRFARILRPG-GVFCFASDIDSYINWTLIHC
TRMB_RHIEC      SLDQIDLLYPDPWPKRKHWKRRFVSKTNLDRFHRVLKPG-GLFCFASDIDTYVNWTLLKC
TRMB_RHIL3      ALDQIDLLYPDPWPKRKHWKRRFVSKTNLDRFHRVLKPG-GLFCFASDIDTYVNWTLIKC
TRMB_AGRFC      SIDHIDLLYPDPWPKKKHWKRRFVSDVNLARFHRVLKPG-GKFCFASDIDTYVNWTLQHC
TRMB_RHILO      SLGGIDLLYPDPWPKKKHWKRRFVSPVNLERFARVLKPG-AKFRFASDIDTYVNWTLLHC
TRMB_BRUAB      SLAGIDLFYPDPWHKRRHWKRRFVSDANLDRFARVLKPG-AKFRFASDIEHYVNWTLQHC
TRMB_BRUA2      SLAGIDLFYPDPWHKRRHWKRRFVSDANLDRFARVLKPG-AKFRFASDIEHYVNWTLQHC
TRMB_BRUME      SLAGIDLFYPDPWHKRRHWKRRFVSDANLDRFARVLKPG-AKFRFASDIEHYVNWTLQHC
TRMB_BRUSU      SLAGIDLFYPDPWHKRRHWKRRFVSDANLDRFARVLKPG-AKFRFASDIEHYVNWTLQHC
TRMB_OCHA4      SLSGIDLFYPDPWHKRRHWKRRFVSDANLDRFARVLKPG-AKFRFASDIEHYVNWTLQHC
TRMB_CHESB      AISRIDLFYPDPWPKKRHWKRRFVNKANLDRFARVLCVD-GQFRFASDIEGYVNWTLLAC
TRMB_BARQU      SLDGIDLLYPDPWPKKKHWKRRFINMKNLNRVARVLKIG-KKFRFATDIDSYANWTLYYF
TRMB_BARHE      SLDGIDLFYPDPWPKKKHWKRRFINMKNLNRFARVLKTG-KKFRFASDIESYVNWTLYHC
TRMB_BARBK      SLNGIDLFYPDPWPKKKHWKRRFINVKNLDRFARVLKKG-GKFRFASDIDTYVNWTLYYF
TRMB_AZOC5      SVSQVELLYPDPWPKRRHWKRRFVRPDNLDLLARALKPG-GVFRFASDVPDYVDWTLREV
TRMB_RHOPS      ALKRIDLIHPDPWPKRRHWKRRFVQDSMIGAMARALIDG-GEFRFVSDIDSYNAWTLAHL
TRMB_RHOP2      DLNRIDLIHPDPWPKRRHWKRRFVQDAMVGAMARALRAN-GEFRFVSDIDSYNAWTLAHL
TRMB_RHOPA      SLARIDLIHPDPWPKRRHWKRRFVQDATVAAMARALTPH-GEFRFVCDIDGYTAWTLAHL
TRMB_NITHX      SLARIDLIHPDPWPKRRHWKRRFVQDATVAEMARVLRPG-GEFRFVSDIADYCAWTLSHL
TRMB_NITWN      SLARIDLIHPDPWPKRRHWKRRFVQDATVAEMARVLRPE-GEFRFVSDIDDYCAWTLTHL
TRMB_RHOP5      SLARIDLIHPDPWPKRRHWKRRFVQDATVTAMARALRDD-GEFRFVCDIDDYSAWTLSHL
TRMB_RHOPB      SLARVDLIHPDPWPKRRHWKRRFVQDTSVAAMARVLHED-GEFRFVSDIDDYCAWTLAHL
TRMB_BRADU      SLSRIDLIHPDPWPKRRHWKRRFVQDRTIAAMARVLKVG-GEFRFVCDIDDYCAWTLSHL
TRMB_RUEST      SLSRAFLLYPDPWPKARHHRRRFVTQEHLEPLARVLKPG-AIFRVATDIPDYVRQTLEEV
TRMB_RUEPO      SISRAFLLYPDPWPKKRHHRRRFVTPEHLEPLARVLKPG-AIFRVATDIPDYVRQTLEEV
TRMB_ROSDO      SIDRAFLLYPDPWPKARHHRRRFVTAEHLDPLARALKPG-SVFRVATDIEDYVRQTLQEV
TRMB_JANSC      SVAKAFLLYPDPWPKARHHRRRFVTTEHLEPLHRAMRPG-AEFRVATDIEDYVRQTMEEV
TRMB_PARDP      SIDKAFLNYPDPWPKARHHRRRFVTPEHLIPLARVMKPG-AEFRVATDIPDYVRQTLEEV
TRMB_RHOS4      SVSKAFLNYPDPWPKKRHHRRRFVTQGYLGPLARVLAPG-ATFRVATDIPDYVRQTLEEV
TRMB_RHORT      CLQRLFVLFPDPWPKRRHARRRMIQPARLDDFARLLADG-GELRVASDDMGYVRWTLMHV
TRMB_MAGSA      SLGRVFVLFPDPWPKTRHADRRFISPETLDVLARVLESG-GELRVASDDPIYVAWAARHL
TRMB_GRABC      VLDRVFLMFPDPWPKARHAKRRFVHPENAATLARVMKPG-AEWRIASDDPTYQAWVPEVM
TRMB_NOVAD      SLSFLYLLHPDPWPKARHAKRRMMNDGPVDLFAAKLRPG-GEFRFGTDHAVYLRHALMVM
TRMB_SPHAL      ALAFVYLLHPDPWPKARHAKRRMMNDGPLDLIAAKLKPG-GEFRFGTDHPIYLRHALMVM
TRMB_ERYLH      ALTMLYLLHPDPWPKNKHAKRRMMNDGPVKMFADKLKPG-GEFRFGTDHPVYLRHALMVM
TRMB_ZYMMO      CLDRAYLLHPDPWPKARHAKRRFMNHGPIGLIARKMKKG-GEFRFGTDHPIYCHWAMMIM
TRMB_CAUVC      CLDRVFIMFPDPWHKARHNKRRLIQPEFVAKLARVMKPG-AALRFATDWADYAEWTTERV
TRMB_CAUSK      SIDRLFIMFPDPWHKARHNKRRLVQPAFVAELARVLKPG-AGFRFATDWADYAQWTVERV
TRMB_MARMM      SLDQIFLLFPDPWHKKRHAKRRFVQQSTRDEFARLLKPG-GRLRIATDVKSYADHCMVEL
TRMB_HYPNA      CLDRAFVLFPDPWPKRRQHKRRLVQADFLSILHPKMKPG-ARLRFATDVKSYADEALLTF
TRMB_MAGMM      SLDGVIINFPDPWRKKRHFKRRIVQTEFLDALAPKMRSG-ADLTLATDWANYAEWMVAHL
TRMB_HELPY      RCEKIFVHFPVPWNEKKH--RRVLSEKFLNEALRVLKPR-GFLELRTDDSLYFEDSLKLA
TRMB_HELPH      KCEKIFVHFPVPWNEKKH--RRVLSEKFLNEALRVLKPR-GFLELRTDDGLYFEDSLKLA
TRMB_HELPJ      RCEKIFVHFPVPWNEKKH--RRVLSEKFLNEALRVLKPR-GFLELRTDDSLCFEDSLKLA
TRMB_HELAH      KCEKIFVHFPVPWNDKKH--RRVLSERFLDEALRVLEPN-GFLELRTDDTLYFEDSLKLA
TRMB_WOLSU      AIERLFVHFPVPWDKKPH--RRIFSRAFLNEAIRTLGVG-GVLELRTDSEDYFLFAKELL
TRMB_HELHP      IAQGIYVHFPVPWNKKHH--RRIFSPKFFQESLRVLDNN-GVLHLRSDDEIYFQDALSLA
TRMB_CAMJE      SVEKIFLHFPVPWDKKPH--RRVIGKDFCKECARVLVQN-GRFELRTDSFEYFNFTLEQF
TRMB_CAMJR      SVEKIFLHFPVPWDKKPH--RRVIGKDFCKECARVLTQN-GRFELRTDSFEYFNFTLEQF
TRMB_CAMJ8      SVEKIFLHFPVPWDKKPH--RRVIGKDFCKECARVLTQN-GRFELRTDSFEYFNFTLEQF
TRMB_CAMJJ      SVEKIFLHFPVPWDKKPH--RRVIGKDFCKECARVLTQN-GRFELRTDSFEYFNFTLEQF
TRMB_CAMJD      SVEKIFLHFPVPWGKKPH--RRVIGKDFCKECARVLVQN-GRFELRTDSFEYFNFTLEQF
TRMB_CAMFF      SVDRLFLHFPVPWEKSEK--RRVVSAEFANECQRVLKSG-GSFELRSDDKNYTDFTISCF
TRMB_SULDN      KIDKIYVHFPVPWDKKPH--RRVISTAFIEEARRILNIG-GTLELRTDSENYYAYSYETF
TRMB_GEOTN      EIARIYLNFSDPWPKKRHEKRRLTYRDFLALYDRILSAD-GDIHLKTDNQSFFEYSLVSL
TRMB_GEOKA      EVSRIYLNFSDPWPKKRHEKRRLTYRDFLALYDRILAED-GDIHLKTDNQSFFEYSLVSL
TRMB_BACHK      EIDRVYLNFSDPWPKKRHTKRRLTYKTFLRNYEEVLVEG-GEIHFKTDNQGLFEYSLMSM
TRMB_BACC1      EIDRVYLNFSDPWPKKRHTKRRLTYKTFLRNYEEVLVEG-GEIHFKTDNQGLFEYSLMSM
TRMB_BACAN      EIDRVYLNFSDPWPKKRHTKRRLTYKTFLRNYEEVLVEG-GEIHFKTDNQGLFEYSLMSM
TRMB_BACCZ      EIDRVYLNFSDPWPKKRHTKRRLTYKTFLRNYEEVLVEG-GEIHFKTDNQGLFEYSLMSM
TRMB_BACCR      EIDRVYLNFSDPWPKKRHTKRRLTYKTFLRNYEEVLVEG-GEIHFKTDNQGLFEYSLMSM
TRMB_BACAH      EIDRVYLNFSDPWPKKRHTKRRLTYKTFLRNYEEVLVEG-GEIHFKTDNQGLFEYSLMSM
TRMB_BACCN      EIDRVYLNFSDPWPKKRHAKRRLTYKTFLRNYEEVLVKD-GEIHFKTDNQALFEYSLMSM
TRMB_BACSU      EVKRVYLNFSDPWPKKRHEKRRLTYSHFLKKYEEVMGKG-GSIHFKTDNRGLFEYSLKSF
TRMB_BACVZ      EIKRVYLNFSDPWPKNRHEKRRLTFKTFLKKYEEVMGET-GEIHFKTDNRGLFEYSLKSF
TRMB_BACLD      EVDRVYLNFSDPWPKKRHEKRRLTNHAFLKKYEQVLGGK-GAIHFKTDNRGLFEYSLTSF
TRMB_LISIN      EIAQIYLNFSDPWPKKRHTKRRLTNPTFLTIYERLLPKA-GEIHFKTDNRSLFEYSLVAF
TRMB_LISW6      EIAQIYLNFSDPWPKKRHTKRRLTNPTFLTIYERLLPKA-GEIHFKTDNRSLFEYSLVAF
TRMB_LISMO      EIAQIYLNFSDPWPKKRHTKRRLTNPTFLTIYERLLPKA-GEIHFKTDNRSLFEYSLVAF
TRMB_LISMF      EIAQIYLNFSDPWPKKRHTKRRLTNPTFLTIYERLLPEA-GEIHFKTDNRSLFEYSLVAF
TRMB_STRT2      EVDMMYLNFSDPWPKSRHEKRRLTYKTFLDTYKQILPKN-GEIHLKTDNRGFFEYSLTSF
TRMB_STRTD      EVDMMYLNFSDPWPKSRHEKRRLTYKTFLDTYKQILPKN-GEIHLKTDNRGFFEYSLTSF
TRMB_STRT1      EVDMMYLNFSDPWPKSRHEKRRLTYKTFLDTYKQILPKN-GEIHLKTDNRGFFEYSLTSF
TRMB_STRA1      EVDLMYLNFSDPWPKKKHEKRRLTYKTFLDTYKDILPEQ-GEIHFKTDNRGLFEYSLASF
TRMB_STRA5      EVDLMYLNFSDPWPKKKHEKRRLTYKTFLDTYKDILPEQ-GEIHFKTDNRGLFEYSLASF
TRMB_STRA3      EVDLMYLNFSDPWPKKKHEKRRLTYKTFLDTYKDILPEQ-GEIHFKTDNRGLFEYSLASF
TRMB_STRP3      EVDMMYLNFSDPWPKTKHEKRRLTYKDFLDTYKRILPEH-GEIHFKTDNRGLFEYSLASF
TRMB_STRPB      EVDMMYLNFSDPWPKTKHEKRRLTYKDFLDTYKRILPEH-GEIHFKTDNRGLFEYSLASF
TRMB_STRPF      EVDMMYLNFSDPWPKTKHEKRRLTYKDFLDTYKRILPEH-GEIHFKTDNRGLFEYSLASF
TRMB_STRPM      EVDMMYLNFSDPWPKTKHEKRRLTYKDFLDTYKRILPEH-GEIHFKTDNRGLFEYSLASF
TRMB_STRPC      EVDMMYLNFSDPWPKTKHEKRRLTYKDFLDTYKRILPEH-GEIHFKTDNRGLFEYSLASF
TRMB_STRP1      EVDMMYLNFSDPWPKTKHEKRRLTYKDFLDTYKRILPEH-GEIHFKTDNRGLFEYSLASF
TRMB_STRPD      EVDMMYLNFSDPWPKTKHEKRRLTYKDFLDTYKRILPEH-GEIHFKTDNRGLFEYSLASF
TRMB_STRPG      EVDMMYLNFSDPWPKTKHEKRRLTYKDFLDTYKRILPEH-GEIHFKTDNRGLFEYSLASF
TRMB_STRP8      EVDMMYLNFSDPWPKTKHEKRRLTYKDFLDTYKRILPEH-GEIHFKTDNRGLFEYSLASF
TRMB_STRP6      EVDMMYLNFSDPWPKTKHEKRRLTYKDFLDTYKRILPEH-GEIHFKTDNRGLFEYSLASF
TRMB_STRSY      EIDQLYLNFSDPWPKKRHEKRRLTYKSFLDTYKEILPEK-GEIHFKTDNRGLFEYSLASF
TRMB_STRS2      EIDQLYLNFSDPWPKKRHEKRRLTYKSFLDTYKEILPEK-GEIHFKTDNRGLFEYSLASF
TRMB_STRMU      EIDLLYLNFSDPWPKKRHEKRRLTYKSFLDTYKKILPEK-GEIHFKTDNRELFEYSLASF
TRMB_STRSV      EIDRLYLNFSDPWPKKRHEKRRLTYQSFLATYQQILPEN-GEIHFKTDNRGLFEYSLVSF
TRMB_STRGC      EIERLYLNFSDPWPKKRHEKRRLTYKSFLDTFKQILPEK-GEVHFKTDNRGLFEYSLVSF
TRMB_STRR6      EIDRLYLNFSDPWPKKRHEKRRLTYKTFLDTFKRILPEN-GEIHFKTDNRGLFEYSLVSF
TRMB_STRPN      EIDRLYLNFSDPWPKKRHEKRRLTYKTFLDTFKRILPEN-GEIHFKTDNRGLFEYSLVSF
TRMB_STRP2      EIDRLYLNFSDPWPKKRHEKRRLTYKTFLDTFKRILPEN-GEIHFKTDNRGLFEYSLVSF
TRMB_LACLM      EIDQVYLNFSDPWPKGRHEKRRLTYKSFLATYEKILRPE-GEIHFKTDNRGLFEYSLVSL
TRMB_LACLA      EIDQVYLNFSDPWPKGRHEKRRLTYKSFLATYEKILRPE-GEIHFKTDNRGLFEYSLVSL
TRMB_LACLS      EIDQVYLNFSDPWPKGRHEKRRLTYKSFLATYEKILRPE-GEIHFKTDNRGLFEYSLVSL
TRMB_ENTFA      EVDLIYLNFSDPWPKKKHEKRRLTYKNFLATDEIILKPN-GEIHFKTDNQGLFEYSLSSF
TRMB_BACHD      EVSRLFINFTDPWPKKRHEKRRLTYKDFLAKYEIVLKEK-GDIHFKTDNQGLFEYSLHSF
TRMB_BACSK      EVDRFFINFTDPWPKKKHAKRRLTNERFLTIYKQLLKQD-GEIHFKTDNQGLFEYSLHSM
TRMB_OCEIH      EISMIYLNFSDPWPKNRHEKRRLTYGRFLEQYQDILGAN-GEVILKTDNRGLFEYSVVSF
TRMB_STAES      EISRIYLNFSDPWPKKRHAKRRLTYHTYLALYKQILKDD-GEIHFKTDNRGLFAFSIESM
TRMB_STAEQ      EISRIYLNFSDPWPKKRHAKRRLTYHTYLALYKQILKDD-GEIHFKTDNRGLFAFSIESM
TRMB_STAHJ      EISRIYLNFSDPWPKKRHAKRRLTYHTFLALYQQILKED-GEIHFKTDNRGLFAFSLESM
TRMB_STAA3      EVSRIYLNFSDPWPKNRHAKRRLTYHTFLALYQQILNDE-GDLHFKTDNRGLFAYSLESM
TRMB_STAA8      EVSRIYLNFSDPWPKNRHAKRRLTYHTFLALYQQILNDE-GDLHFKTDNRGLFAYSLESM
TRMB_STAAB      EVSRIYLNFSDPWPKNRHAKRRLTYHTFLALYQQILNDE-GDLHFKTDNRGLFAYSLESM
TRMB_STAAC      EVSRIYLNFSDPWPKNRHAKRRLTYHTFLALYQQILNDE-GDLHFKTDNRGLFAYSLESM
TRMB_STAAS      EVSRIYLNFSDPWPKNRHAKRRLTYHTFLALYQQILNDE-GDLHFKTDNRGLFAYSLESM
TRMB_STAAW      EVSRIYLNFSDPWPKNRHAKRRLTYHTFLALYQQILNDE-GDLHFKTDNRGLFAYSLESM
TRMB_STAAM      EVSRIYLNFSDPWPKNRHAKRRLTYHTFLALYQQILNDE-GDLHFKTDNRGLFAYSLESM
TRMB_STAAN      EVSRIYLNFSDPWPKNRHAKRRLTYHTFLALYQQILNDE-GDLHFKTDNRGLFAYSLESM
TRMB_STAAR      EVSRIYLNFSDPWPKNRHAKRRLTYHTFLALYQQILNDE-GDLHFKTDNRGLFAYSLESM
TRMB_STAS1      EVSRLYLNFSDPWPKKRHTKRRLTYQTYLALYKQVLKDD-GEIHFKTDNRGLFAYSLESM
TRMB_LACRD      EVAKMYLNFSDPWPKKRHAKRRLTYKTFLATYQQILQDQ-GAIELKTDNMGLFEFSLESM
TRMB_PEDPA      EVSKVFLNFSDPWPKTRHEKRRLTFKTFLKVYEQILVKN-GEVEFKTDNQGLFEYSLYSL
TRMB_LACPL      EVDRLYLNFSDPWPKSRHEKRRLTYKSFLSSYREVLKPN-GQIEFKTDNRGLFEFSLTSM
TRMB_LACS1      EIAGIYLNFSDPWPKKRQTKRRLTYKTFLEQYKEVLDSN-GHIEFKTDNQGLFEYSLVSM
TRMB_LACSS      EVAGVYLNFSDPWPKTRHEKRRLTYKSFLAEYQQIMQPT-GYLRFKTDNQGLFEYSLASL
TRMB_LACP3      EIDGLFLNFSDPWPKTRHEKRRLTYRDFLRQYQAIMKPD-ALLQFKTDNQGLFEYSLVSM
TRMB_LACBA      EVSGLYLNFSDPWPKKRHTKRRLTSPVFLAHYADVLQPE-GQLQFKTDNRGLFEYSLGSL
TRMB_LACJO      SVDIVYLNFSDPWPKTRHEKRRLTYKSFLDKYRQILKPE-GHLEFKTDNRGLFEYSLVSL
TRMB_LACGA      SVDVVYLNFSDPWPKTRHEKRRLTYKSFLDKYRQILKPE-GHLEFKTDNQGLFEYSLVSL
TRMB_LACDA      STSKIYLNFSDPWPKSRHEKRRLTYKDFLAKYQAVLTGD-GLIEFKTDNSGLFAYSVKSM
TRMB_LACDB      STSKIYLNFSDPWPKSRHEKRRLTYKDFLAKYQAVLTGD-GLIEFKTDNSGLFAYSVKSM
TRMB_LACAC      TTDVIYLNFSDPWPKSRHEKRRLTYKSFLNKYQQVLKPE-GHIEFKTDNSGLFAYSVQSM
TRMB_LACH4      STNVIYLNFSDPWPKTRHEKRRLTYKSFLAKYQQVLTKD-GHIEFKTDNSGLFAYSVQSM
TRMB_LEUMM      EVSKVYLNFSDPWPKKRHESRRLTYKSFLKSYEAVLPEH-GEVEFKTDNRHLFEYSMVSF
TRMB_OENOB      EISKIFLNHSDPWPKAKHEKRRLTAENFLKSYSKILLPN-GSLELKTDNLGLFEYSLSSF
TRMB_LACP7      EVDRIYLNFSDPWPKDRHSKRRLTSSEFLARYDQFLVKD-GYVAFKTDNRDLFDFSLEQV
TRMB_CLOD6      ELSRIYINFCDPWPKNRWSKRRLTHSGFLEMYNRVLEDD-GEIHFKTDNEKLFEFSLNEI
TRMB_ALKOO      EIERIYLNFSDPWPKARHDKRRLTHHGFLDIYQKLLKDH-GEIHLKTDSKALFEFSLEQF
TRMB_ALKMQ      NIEKIYLNFSDPWPKERHKKRRLTHQGFLKIYRGLLSEQ-GEIQIKTDNKALFEFSLQQL
TRMB_CLOPS      KIERIYINFCNPWPKDRHKKRRLTHPRQLTKYRDFLVDG-GEIHFKTDDDELFEESLEYF
TRMB_CLOP1      KIERIYINFCNPWPKDRHKKRRLTHTRQLTKYRDFLVDG-GEIHFKTDDDELFEESLEYF
TRMB_CLOPE      KIERIYINFCNPWPKDRHKKRRLTHTRQLTKYRDFLVDG-GEIHFKTDDDELFEESLEYF
TRMB_CLOB8      VVSRIYINFCNPWPKEKHKKRRLTHMRQLEQYKTFLKSE-GEIYFKTDDDELFEESLEYF
TRMB_HUNT2      QIGRIFINFCNPWPKNRHKARRLTHPNQLNQYRTFLAPN-GQIWFKTDDTMLFQDSIKYF
TRMB_CLOTE      EIEKIYINFCNPWPKLRHNKRRLTHNKFLDEYKKFLKGQ-GEIWFKTDDIGLFEDSQEYF
TRMB_CLOK5      EVGRIYINFCNPWPKRRQKKRRLTHTGFLNIYKKFLKPK-SEVWFKTDDRGLFEESQEYF
TRMB_CLOAB      EIARIYINFCNPWPKDRHKKRRLTHTKFLTKYKEFLKPN-SQIWFKTDDDGLFVESLDYF
TRMB_CLONN      EISRIYINFCNPWPKDRHNKRRLTHTRFLTEYKKFIKPG-TEIHFKTDDLDLFNDSLVYF
TRMB_DESHY      QIEKIYINFCNPWPSRRHHHKRLTHPQFLSVYKKLMKDH-SEIWFKTDDDELFKDSLKYF
TRMB_MYCGE      SVQKIFINFPDPWPKKRHIQRRLTSPDFLKLFWNLLVKN-GLIEFKTDNDKLFEYTLTTL
TRMB_MYCPN      SISKIFINFPDPWPKKRHTLRRLTAPHFLKQFHQLLKKQ-GLIEFKTDNDQLFEFTLEVL
TRMB_UREPA      SVDKIYLNFSDPWPKKRHAKKRLTHPCFLEKFAVILKQN-ALVEFKTDNENLFMYTIYDV
TRMB_UREP2      SVDKIYLNFSDPWPKKRHAKKRLTHPCFLEKFAVILKQN-ALVEFKTDNENLFMYTIYDV
TRMB_MYCCT      SFSRIYLNFSDPWPKARHYKKRLTYLGFLDIYSDILIKN-GFLEFKTDNDSLYNFTLEQL
TRMB_MYCMS      SFNKIYLNFSDPWPKTRHYKKRLTYVKFLDIYSDILIKN-GYLEFKTDNDSLYNFTIEQL
TRMB_MESFL      SIDKIYLNFSDPWPKARHSKKRLTYRTFLDIYANIIKSH-GILEFKTDNDGLFAFSLEEI
TRMB_MYCGA      CFDQIYLNFSDPWPKKRHAKKRLVDLAFLNKYQRILKAD-GIIEFKTDNDQLFNYAIEMI
TRMB_MYCPE      EISKIYLNFVDPWPKTHHEKFRLTNSFYLNLFLPLLKQD-GLIEFKTDNLNFFNYSLSVA
TRMB_MYCPU      -FDLIWLTFSDPWPKKRHYKRRLTYEKFLKIYSKILSEN-GLIKLKTDNDDFFQWTLESL
TRMB_MYCHP      -IKTIWLTFSDPWPKKRHYKRRLVYRDFLKIYQNVLDKD-GVVYFKTDNDMLYQFAIDEL
TRMB_MYCH2      -ASTIWLTFPDPWPKNRHYKRRLTYKDFLKIYANLLVKD-GILKLKTDNLKFFEFSIESL
TRMB_MYCH7      -ANTIWLTFPDPWPKNRHYKRRLTYKDFLKIYANLLVKD-GILKLKTDNLKFFEFSIESL
TRMB_MYCHJ      -ASTIWLTFPDPWPKNRHYKRRLTYKDFLEIYANLLVKD-GILKLKTDNLKFFEFSIESL
TRMB_MYCMO      -VNTIWLTFSDPWPKNRHEHRRLTYKTFLDLYKKFLSPQ-GVIKLKTDNDKFFHYSLESM
TRMB_MYCS5      -TNTIWLTFSDPWPKKRHEKRRLTYKSFLDQYKFLLKDKNSNFYLKTDNDLFFNYSLESL
TRMB_BACFR      EVSEIWLTFSDPQ--MKKATKRLTSTYFMERYRKFLVSN-GIIHLKTDSNFMFTYTKYMI
TRMB_BACFN      EVSEIWLTFSDPQ--MKKATKRLTSTYFMERYRKFLVSN-GIIHLKTDSNFMFTYTKYMI
TRMB_BACTN      EVSEIWLTFSDPQ--MKKATKRLTSTYFMERYRKFLKPD-GIIHLKTDSNFMFTYTKYMI
TRMB_PORGI      EVAEIWITFPDPQ--MKKVGKRLTGTRFLSLYDKVLERG-GRIHLKTDSPFLYTYTKALV
TRMB_GRAFK      EVSEIWITFPDPQIKYKRTKHRLTNTDFLQRYKNVLKQD-GIMHLKTDSEFMHGYTLGLL
TRMB_CYTH3      EVKGIWITFPDPKPRESEAKLRLSGLRFMNIYRRLMPAG-GKVFFKTDNRVLFDHTLEVL
TRMB_CHLSY      ALHSIILHFPPPLLRNRQRNQLLVSPQLLECAARTLVPG-GYLSFLTDHPALFALMQELL
TRMB_CHLAA      ALHSIILHFPPPLLRNRQRNQLLVSPQLLECAARTLVPG-GYLSFLTDHPALFALMQELL
TRMB_CHLAD      VLTTIILHFPPPLLRNRQRNQLLVSAQMLGCAERSLVPG-GYLSFLTDHPDLFSLMQELL
TRMB_CHLT3      SVQKIFFHFPVPVVRAKDSKYLIFSEDFLSEMHRALQVG-GMISVISDSAEYFPIMRELG
TRMB_RUBXD      ALRAVYLHFPDPGIKPRYRKRRLFNERFLEEMHRAVVPG-GRMSLVTDDEDYFRQMLELI
TRMB_THEMA      SVEKVYINFPCPWPKKRHESRRITSYDFLQTLSAVLEMD-GTVEFATDEEWYAREVLDTF
TRMB_COPPD      SVDALYINFPLPWPHKKHASRRLFTLPKLQIYASRLVDN-AILQLQTDVKEYAEEAIRNS
TRMB_CHLPD      SISRVYSLFPDPWPKRKHLHYRLFSSEYLRLLNNRLIFG-SEALIVTDSEDYCNWMLKQL
TRMB_AQUAE      YVENIYMNYPDPWFKKRHHKRRLTKPERLYMFAKKLKLG-GEIRIRTDNYEFLEFTKESA
TRMB_NEOSM      VFHKVYILFPDPWPKRRHHKRRIVDVPFFQLLSRSLHPL-AEVVVATDDHDYAQQIYQSA
TRMB_WOLPM      SVERFFILFPDPWPKRSHNKRRLINTEFLNLLAKKILIT-GEIFIATDHQDYAEWIASHI
TRMB_RHOBA      SLDGVHVYFPDPWWKKRHRKRRVLSHDNILNFSRCLRVG-GRLHFWTDVLDYFELTVELI
TRMB_BDEBA      EIDNVYIHFPDPWTSPKKPKNRFVCKENLELLFRLQKPG-SFINFKTDSLVYFLWAMDEI
                           *                                   *            

TRMB_TRIV2      AANPA----------FKKVGSGEWLSE---------------------------------
TRMB_NOSS1      AANPA----------FKKVGTGEWLTE---------------------------------
TRMB_MICAN      QAHPH----------FVRQHQTPWLEE---------------------------------
TRMB_SYNP6      AAEPR----------FQRTCL-DWLPE---------------------------------
TRMB_SYNE7      AAEPR----------FQRTCL-DWLPE---------------------------------
TRMB_TRIEI      SAHGS----------FYRSYN-DWLKE---------------------------------
TRMB_SYNY3      AENDN----------FVFTHDTPWLAE---------------------------------
TRMB_THEEB      RAHGA----------FRSTCT-DWLPQ---------------------------------
TRMB_SYNJA      LEHPQ----------FWNPYQ-GPIDD---------------------------------
TRMB_SYNJB      LEHPQ----------FWDPHQ-GPLDS---------------------------------
TRMB_PROMM      EQSNC----------FERPK-NDSHAWQKA------------------------------
TRMB_PROM3      EQSNC----------FKRPG-DDFHPWQRT------------------------------
TRMB_SYNSC      ELSAC----------FDRPV-EDQRHWRAS------------------------------
TRMB_SYNPX      ELSGC----------FTRPE-SDARPWRAD------------------------------
TRMB_SYNS9      ELSGC----------FDRPE-NDAHPWRRT------------------------------
TRMB_SYNS3      ELSNC----------FARPK-DDPQPWRSS------------------------------
TRMB_SYNPW      ELSGC----------FDRPA-EDARPWRAD------------------------------
TRMB_PROMA      ELSHF----------FDRHS-KYSESNLNA------------------------------
TRMB_PROMT      DENRY----------FTRKN-VGDLRSINK------------------------------
TRMB_PROM1      DENRY----------FTRKN-VGDLRSIDK------------------------------
TRMB_PROMS      SNNFY----------FKTIDKKDFNYSESF------------------------------
TRMB_PROM2      SSNFY----------FKKIDKKDFNYSESF------------------------------
TRMB_PROM9      SNNFN----------FKKIDKNDFNFSESF------------------------------
TRMB_PROMP      SESIK----------FKKIPYQDVDFCESF------------------------------
TRMB_PROM5      LESLK----------FKKLAYEDFRVNESF------------------------------
TRMB_GEOSL      PQMPG----------YANMLAPDIFRHEL-------------------------------
TRMB_GEOMG      PGVEG----------YANMLAPDRYRHEL-------------------------------
TRMB_PELCD      NQIKG----------YENRL-PVPVALDM-------------------------------
TRMB_MYXXD      ESV-G----------FKNPLGSGVFHPYD-------------------------------
TRMB_ANADE      EEV-G----------FRNAAGPGRFAEAA-------------------------------
TRMB_THET8      ERTGL----------YRVEVRPPPEAHLR-------------------------------
TRMB_THET2      ERTGL----------YRVEVRPPPEAHLR-------------------------------
TRMB_DEIGD      EASGV----------MRAELTDPPPAALE-------------------------------
TRMB_DEIRA      EASGV----------MRVERVGPPPAALE-------------------------------
TRMB_CHLAB      QQR--------------LLPKLEE------------------------------------
TRMB_CHLCV      RQC--------------LLPTIED------------------------------------
TRMB_CHLFF      RQY--------------LSPTMED------------------------------------
TRMB_CHLTR      LKY--------------LSPGLKS------------------------------------
TRMB_CHLTA      LKY--------------LSPGLKS------------------------------------
TRMB_CHLMU      LNY--------------LSPGMQD------------------------------------
TRMB_CHLPN      QTH--------------LAPRMET------------------------------------
TRMB_PARUW      YQTG------------GFISLFEA------------------------------------
TRMB_LEPIN      RDS--------------KAFSPEK------------------------------------
TRMB_LEPIC      RDS--------------KAFSPEK------------------------------------
TRMB_LEPBJ      RDS--------------EIFKPET------------------------------------
TRMB_LEPBL      RDS--------------EIFKPET------------------------------------
TRMB_NITEU      RS-------------EERFVNTA-------------------------------------
TRMB_NITEC      SS-------------EQRLINTA-------------------------------------
TRMB_NITMU      SG-------------EPHLSNTA-------------------------------------
TRMB_BURVG      SA-------------EPTLENTA-------------------------------------
TRMB_BURCM      GA-------------EPSLENTA-------------------------------------
TRMB_BURL3      GA-------------EPTLENTA-------------------------------------
TRMB_BURCH      GA-------------EPTLENTA-------------------------------------
TRMB_BURCA      GA-------------EPTLENTA-------------------------------------
TRMB_BURPS      SA-------------DPSLENTA-------------------------------------
TRMB_BURP1      SA-------------DPSLENTA-------------------------------------
TRMB_BURMA      SA-------------DPSLENTA-------------------------------------
TRMB_BURTA      GA-------------DPSLENTA-------------------------------------
TRMB_PARXL      GA-------------EPSLKNTA-------------------------------------
TRMB_THIDA      EA-------------EAQLENTA-------------------------------------
TRMB_METFK      QQ-------------EPLLENTA-------------------------------------
TRMB_CUPNH      SG-------------EPLLENTSTA-----------------------------------
TRMB_CUPPJ      AG-------------EPALENASSA-----------------------------------
TRMB_CUPMC      SG-------------EPALENTSKA-----------------------------------
TRMB_RALSO      SA-------------EPLLENT--------------------------------------
TRMB_ACISJ      SA-------------EPLLSNTA-------------------------------------
TRMB_ACIAC      SA-------------EPLLANSA-------------------------------------
TRMB_VEREI      GA-------------EPLLRNTA-------------------------------------
TRMB_POLSJ      SA-------------EALLKNTADASG---------------------------------
TRMB_POLNA      SA-------------EPLLKNTADAAS---------------------------------
TRMB_RHOFT      SK-------------EPLLKNTATQTHPE-------------------------------
TRMB_NEIMB      SS-------------FDSLQNTA-------------------------------------
TRMB_NEIMA      SS-------------FDSLQNTA-------------------------------------
TRMB_NEIMF      SS-------------FDSLQNTA-------------------------------------
TRMB_NEIM0      SS-------------FDSLQNTA-------------------------------------
TRMB_NEIG1      SS-------------FDNLQNTA-------------------------------------
TRMB_CHRVO      NG-------------NADLENTA-------------------------------------
TRMB_AZOSB      AA-------------EPLLQNTA-------------------------------------
TRMB_AROAE      AA-------------EPALENTA-------------------------------------
TRMB_DECAR      SG-------------EPTLVNSS-------------------------------------
TRMB_BORBR      GG-------------EPLLRNTA-------------------------------------
TRMB_BORPA      GG-------------EPLLRNTA-------------------------------------
TRMB_BORPE      GG-------------EPLLRNTA-------------------------------------
TRMB_BORA1      GG-------------EALLENTA-------------------------------------
TRMB_NITOC      SQ-------------HAGFNQLTN------------------------------------
TRMB_ALKEH      EA-------------EPDLENTCGP-----------------------------------
TRMB_HALHL      EA-------------DARFENTCGP-----------------------------------
TRMB_LEIXX      DA-------------EPVLVNVAGP-----------------------------------
TRMB_XYLFA      DA-------------TPGLVNRAGL-----------------------------------
TRMB_XYLFT      DA-------------TPGLVNRAGL-----------------------------------
TRMB_XANC5      DA-------------TPGLVNRAGP-----------------------------------
TRMB_XANAC      DA-------------TPGLVNRAGP-----------------------------------
TRMB_XANOM      DA-------------TPGLVNRAGP-----------------------------------
TRMB_XANOR      DA-------------TPGLVNRAGP-----------------------------------
TRMB_XANCP      DA-------------TEGLVNRAGP-----------------------------------
TRMB_XANC8      DA-------------TEGLVNRAGP-----------------------------------
TRMB_METCA      NG-------------CETLVNQAPD-----------------------------------
TRMB_STRAW      TA-------------HPDFENTQPT-----------------------------------
TRMB_STRCO      TA-------------HPDFENTVPG-----------------------------------
TRMB_SHESM      NA-------------ANGYKNQSA------------------------------------
TRMB_SHESA      NA-------------ANGYKNQSA------------------------------------
TRMB_SHESR      NA-------------ANGYKNQSA------------------------------------
TRMB_SHEON      NV-------------ASGYKNQSA------------------------------------
TRMB_SHEPC      NA-------------APGYKNQSA------------------------------------
TRMB_SHESW      NA-------------APGYKNQSV------------------------------------
TRMB_SHEB8      QA-------------APGYQNQSS------------------------------------
TRMB_SHEB5      QA-------------APGYQNQSS------------------------------------
TRMB_SHEB9      QA-------------APGYKNQSS------------------------------------
TRMB_SHEFN      NA-------------AEGYKNQST------------------------------------
TRMB_SHEDO      NL-------------APGYKNQSP------------------------------------
TRMB_SHEHH      NA-------------APGYKNQSA------------------------------------
TRMB_SHEPA      TA-------------APGYKNQSA------------------------------------
TRMB_SHESH      GA-------------AEGYKNQSL------------------------------------
TRMB_SHEAM      SA-------------APGYQNQSD------------------------------------
TRMB_VIBPA      NQ-------------APGFENIAQ------------------------------------
TRMB_VIBCB      NQ-------------APGFDNIAE------------------------------------
TRMB_VIBVY      NQ-------------APGYRNIAE------------------------------------
TRMB_VIBVU      NQ-------------APGYRNIAE------------------------------------
TRMB_VIBCH      NQ-------------APGFANLAT------------------------------------
TRMB_VIBC3      NQ-------------APGFANLAT------------------------------------
TRMB_PHOPR      NA-------------APGYKNTAT------------------------------------
TRMB_AERHH      SA-------------AEGYENTSA------------------------------------
TRMB_PSEA6      AV-------------APGYKNLSS------------------------------------
TRMB_PSEHT      QA-------------APGFKNQST------------------------------------
TRMB_COLP3      QS-------------APGYNNLSE------------------------------------
TRMB_PSYIN      QA-------------SPDFKNTSE------------------------------------
TRMB_SALCH      SS-------------IDGYKNLSE------------------------------------
TRMB_SALPA      SS-------------IDGYKNLSE------------------------------------
TRMB_SALTI      SS-------------IDGYKNLSE------------------------------------
TRMB_SALAR      SS-------------IDGYKNLSE------------------------------------
TRMB_SALTY      SS-------------IDGYKNLSE------------------------------------
TRMB_ECOL6      SS-------------IDGYKNLSE------------------------------------
TRMB_ECOUT      SS-------------IDGYKNLSE------------------------------------
TRMB_ECOK1      SS-------------IDGYKNLSE------------------------------------
TRMB_ECOL5      SS-------------IDGYKNLSE------------------------------------
TRMB_ECOHS      SS-------------IDGYKNLSE------------------------------------
TRMB_ECO57      SS-------------IDGYKNLSE------------------------------------
TRMB_ECOLC      SS-------------IDGYKNLSE------------------------------------
TRMB_SHISS      SS-------------IDGYKNLSE------------------------------------
TRMB_ECO24      SS-------------IDGYKNLSE------------------------------------
TRMB_SHIFL      SS-------------IDGYKNLSE------------------------------------
TRMB_ECOLI      SS-------------IDGYKNLSE------------------------------------
TRMB_SHIF8      SS-------------IDGYKNLSE------------------------------------
TRMB_SHIDS      SS-------------IDGYKNLSE------------------------------------
TRMB_SHIBS      SS-------------IDGYKNLSE------------------------------------
TRMB_KLEP7      SS-------------LEGYRNQSA------------------------------------
TRMB_CROS8      SS-------------VEGYENLSP------------------------------------
TRMB_YERPE      SG-------------VSGYLNLSE------------------------------------
TRMB_YERPP      SG-------------VSGYLNLSE------------------------------------
TRMB_YERPA      SG-------------VSGYLNLSE------------------------------------
TRMB_YERPN      SG-------------VSGYLNLSE------------------------------------
TRMB_YERP3      SG-------------VSGYLNLSE------------------------------------
TRMB_YERPS      SG-------------VSGYLNLSE------------------------------------
TRMB_YERE8      SG-------------ANGYRNLSE------------------------------------
TRMB_SERP5      NG-------------ISGYRNLSS------------------------------------
TRMB_PECAS      TS-------------VAGYRNLSD------------------------------------
TRMB_PHOLL      NG-------------VDNYLNLSE------------------------------------
TRMB_SODGM      SD-------------AAFFRSLSS------------------------------------
TRMB_IDILO      ND-------------EPRLTNLSS------------------------------------
TRMB_ACTP2      RQF------------DKELRNTSA------------------------------------
TRMB_HAEDU      RQF------------SPALVNTSP------------------------------------
TRMB_HAES1      TS-------------AVGLRNTSA------------------------------------
TRMB_HISS2      TS-------------AVGLHNTSA------------------------------------
TRMB_MANSM      SQ-------------SKALTNTSK------------------------------------
TRMB_HAEI8      SA-------------NTDLVNTSK------------------------------------
TRMB_HAEIN      SA-------------NTDLVNTSK------------------------------------
TRMB_HAEIG      SA-------------NTDLVNTSK------------------------------------
TRMB_HAEIE      SA-------------NTDLVNTSK------------------------------------
TRMB_PASMU      QQ-------------AEGLQNTSA------------------------------------
TRMB_ACTSZ      QSVQS----------AVGIRNISE------------------------------------
TRMB_HAHCH      SE-------------APGMENISG------------------------------------
TRMB_MARHV      SA-------------SEGFANTQE------------------------------------
TRMB_SACD2      TA-------------APGYENIAG------------------------------------
TRMB_ALCBS      DA-------------AAGFSNLAG------------------------------------
TRMB_PSEPK      SA-------------APGYRNRAA------------------------------------
TRMB_PSEPG      SA-------------APGYRNRAA------------------------------------
TRMB_PSEP1      SA-------------APGYRNRAA------------------------------------
TRMB_PSEE4      KV-------------APGYRNQAA------------------------------------
TRMB_PSEPF      NV-------------APGYRNLAE------------------------------------
TRMB_PSEF5      NV-------------APGYRNLAE------------------------------------
TRMB_PSEU2      SV-------------APGYRNQAE------------------------------------
TRMB_PSE14      SV-------------ASGYRNQAE------------------------------------
TRMB_PSESM      SV-------------APGYRNQAE------------------------------------
TRMB_PSEAE      SA-------------APGYRNQAE------------------------------------
TRMB_PSEA7      SA-------------APGYRNQAE------------------------------------
TRMB_PSEAB      SA-------------APGYRNQAE------------------------------------
TRMB_PSEMY      NA-------------APGYRNLAA------------------------------------
TRMB_PSEU5      NV-------------APGYRNLAQ------------------------------------
TRMB_CHRSD      EE-------------APGYRNTAPPE----------------------------------
TRMB_HYDCU      SA-------------AKGYRNISG------------------------------------
TRMB_LEGPA      SS-------------ESALFNQQK------------------------------------
TRMB_LEGPH      SS-------------ESALFNQQK------------------------------------
TRMB_LEGPL      SS-------------ESALFNQQK------------------------------------
TRMB_LEGPC      SS-------------ESALFNQQK------------------------------------
TRMB_FRATF      EN-------------DSKYRNLYS------------------------------------
TRMB_FRATN      EN-------------DSKYRNLYS------------------------------------
TRMB_FRATO      EN-------------DSKYRNLYS------------------------------------
TRMB_FRAP2      EN-------------DNKYKNLYD------------------------------------
TRMB_TREDE      SE-------------TPNLKSKYE------------------------------------
TRMB_TREPA      AR-------------TPSLTWAPQ------------------------------------
TRMB_BUCAI      KD-------------IKNYKNLSE------------------------------------
TRMB_BUCAP      QN-------------IDNYINLSK------------------------------------
TRMB_BUCBP      EN-------------IKGYINLSN------------------------------------
TRMB_NOCFA      AA-------------EPLLVGLNEATGGDDER----------------------------
TRMB_RHOJR      NA-------------EPLLTSLDWES----------------------------------
TRMB_MYCSK      DA-------------EPLLRRVDL-TDD--------------------------------
TRMB_MYCSS      DA-------------EPLLRRVDL-TDD--------------------------------
TRMB_MYCGI      DA-------------EPRLRRVAMDSAD--------------------------------
TRMB_MYCVP      DA-------------EPRLRRIDPDDAG--------------------------------
TRMB_MYCBP      DA-------------EPRLVRVDPDTEL--------------------------------
TRMB_MYCTU      DA-------------EPRLVRVDPDTEL--------------------------------
TRMB_MYCBO      DA-------------EPRLVRVDPDTEL--------------------------------
TRMB_MYCUA      DA-------------EPALARVDPGVDS--------------------------------
TRMB_MYCA1      AG-------------EPRLRPADPDSP---------------------------------
TRMB_MYCPA      AG-------------EPRLRPANPDSP---------------------------------
TRMB_MYCLE      DG-------------EPLLSRADGRTQ---------------------------------
TRMB_CORGB      EV-------------EPLLEYKGWPWEEC-------------------------------
TRMB_CORGL      EV-------------EPLLEYKGWPWEEC-------------------------------
TRMB_COREF      EV-------------EPLLEYKGWPWPEC-------------------------------
TRMB_CORDI      NV-------------EPQLEFMGWPWDEC-------------------------------
TRMB_CORJK      EV-------------EEQLEYLGWPEDQSD------------------------------
TRMB_CUTAK      SA-------------EPLLKPVDAG-----------------------------------
TRMB_NOCSJ      DA-------------EPMLE----------------------------------------
TRMB_PAEAT      TG-------------STEFENMHEGERSGEESPLTQVWQSGVESVVGGAPVREGRAPVST
TRMB_ARTS2      AG-------------SADFVNLHDGERRGPESPLTQVWQSGVESLVGGAPVKEGRAPVST
TRMB_BIFAA      DE-------------LDGFHNDGALTVSLPVEHVGK-----------------------G
TRMB_BIFLO      DG-------------LDGWKNLGSVTVSLPLEHVGK-----------------------G
TRMB_PSYCK      DG-------------FVGLSNQAG------------------------------------
TRMB_PSYA2      DG-------------FAGLSNQAG------------------------------------
TRMB_ACIAD      DN-------------RPALENLAG------------------------------------
TRMB_RHIME      REHA-----------AFEWTAERAA-----------------------------------
TRMB_SINMW      RDHA-----------AFEWTAAGAA-----------------------------------
TRMB_RHIEC      RDHS-----------GFDWIADNAA-----------------------------------
TRMB_RHIL3      RDHG-----------GFEWIADNAA-----------------------------------
TRMB_AGRFC      ARHG-----------GFEWTATSAD-----------------------------------
TRMB_RHILO      RAHG-----------AFAWQAAEAA-----------------------------------
TRMB_BRUAB      RRHA-----------AFDWQAESPA-----------------------------------
TRMB_BRUA2      RRHA-----------AFDWQAESPA-----------------------------------
TRMB_BRUME      RRHA-----------AFDWQAESPA-----------------------------------
TRMB_BRUSU      RRHA-----------AFDWQAESPA-----------------------------------
TRMB_OCHA4      RRHP-----------AFDWQAEGPS-----------------------------------
TRMB_CHESB      RAHP-----------DFRWVAKSAE-----------------------------------
TRMB_BARQU      THHH-----------SFEWEAENLK-----------------------------------
TRMB_BARHE      SNHH-----------SFEWEAKNPK-----------------------------------
TRMB_BARBK      TNHI-----------SFEWQSDTPK-----------------------------------
TRMB_AZOC5      RAHP-----------AFRWTQTRAD-----------------------------------
TRMB_RHOPS      LRAP-----------EFDWTAERAD-----------------------------------
TRMB_RHOP2      LRAP-----------DFDWTAERAD-----------------------------------
TRMB_RHOPA      LRAP-----------CFDWLAQRAD-----------------------------------
TRMB_NITHX      ARSP-----------GFLWLAERAT-----------------------------------
TRMB_NITWN      ARSP-----------DFLWLAERSA-----------------------------------
TRMB_RHOP5      TRSP-----------DFAWTAERAR-----------------------------------
TRMB_RHOPB      LRSK-----------EFCWTAERAC-----------------------------------
TRMB_BRADU      ARSA-----------DFKWLAERAD-----------------------------------
TRMB_RUEST      PKA------------GFKWLAEGPE-----------------------------------
TRMB_RUEPO      PRA------------GFEWLAERPA-----------------------------------
TRMB_ROSDO      PKH------------GFKWLANAPQ-----------------------------------
TRMB_JANSC      PKA------------GFEWLAEAAS-----------------------------------
TRMB_PARDP      PQA------------GFDLVAEGP------------------------------------
TRMB_RHOS4      PQA------------GFDLVSESG------------------------------------
TRMB_RHORT      TAHP-----------AFRWTAQGPT-----------------------------------
TRMB_MAGSA      DAHP-----------AFE-KILATA-----------------------------------
TRMB_GRABC      ERQT-----------AFELLAVS-------------------------------------
TRMB_NOVAD      RRHKH----------QFEWLAKDAR-----------------------------------
TRMB_SPHAL      RRHRH----------QFEWLAKDAR-----------------------------------
TRMB_ERYLH      RRHTD----------AFEWVVEGPS-----------------------------------
TRMB_ZYMMO      G-QRP----------DFEWLAQTPR-----------------------------------
TRMB_CAUVC      LADP-----------SFRFADEAAD-----------------------------------
TRMB_CAUSK      LADP-----------AFRFADAEAV-----------------------------------
TRMB_MARMM      SGDD-----------RFIWQARTAD-----------------------------------
TRMB_HYPNA      VSDG-----------RFEWLAASPD-----------------------------------
TRMB_MAGMM      EPHT------------AFVNQAEPG-----------------------------------
TRMB_HELPY      LK--------------NFQCEIEIK-----------------------------------
TRMB_HELPH      LK--------------NFQCEIEIK-----------------------------------
TRMB_HELPJ      LK--------------NFQCEIEIK-----------------------------------
TRMB_HELAH      LK--------------HFKSEIEIK-----------------------------------
TRMB_WOLSU      LE--------------LNRVHFSIR-----------------------------------
TRMB_HELHP      LQ--------------QESISLEIH-----------------------------------
TRMB_CAMJE      LT--------------FPAPKFSLR-----------------------------------
TRMB_CAMJR      LT--------------FPVPKFSLR-----------------------------------
TRMB_CAMJ8      LT--------------FPAPKFSLR-----------------------------------
TRMB_CAMJJ      LT--------------FPAPKFSLR-----------------------------------
TRMB_CAMJD      LT--------------FPAPKFSLR-----------------------------------
TRMB_CAMFF      LN--------------LKEAKMEIY-----------------------------------
TRMB_SULDN      IA--------------FEKTTLHIN-----------------------------------
TRMB_GEOTN      SQYG---FVL--AAVQLDLHRSD-------------------------------------
TRMB_GEOKA      SQYG---FVL--ASVQLDLHQSG-------------------------------------
TRMB_BACHK      AEYG---MLL--TYLSLDLHNSD-------------------------------------
TRMB_BACC1      AEYG---MLL--TYLSLDLHNSD-------------------------------------
TRMB_BACAN      AEYG---MLL--TYLSLDLHNSD-------------------------------------
TRMB_BACCZ      AEYG---MLL--TYLSLDLHNSD-------------------------------------
TRMB_BACCR      AEYG---MLL--TYLSLDLHNSD-------------------------------------
TRMB_BACAH      AEYG---MLL--TYLSLDLHNSD-------------------------------------
TRMB_BACCN      AEYG---MVF--TFLSLDLHNSD-------------------------------------
TRMB_BACSU      SEYG---LLL--TYVSLDLHNSN-------------------------------------
TRMB_BACVZ      SEYG---LLL--TEVSLDLHNSD-------------------------------------
TRMB_BACLD      SEYG---LVL--TFVSLDLHQSD-------------------------------------
TRMB_LISIN      SEYN---MLL--TFVSLDLHNSD-------------------------------------
TRMB_LISW6      SEYN---MLL--TFVSLDLHNSD-------------------------------------
TRMB_LISMO      SEYN---MLL--TFVSLDLHNSD-------------------------------------
TRMB_LISMF      SEYN---MLL--TFVSLDLHNSD-------------------------------------
TRMB_STRT2      SQYG---MIL--NKVWLDLHASD-------------------------------------
TRMB_STRTD      SQYG---MIL--NKVWLDLHASD-------------------------------------
TRMB_STRT1      SQYG---MIL--NKVWLDLHASD-------------------------------------
TRMB_STRA1      SQYG---MTL--KQVWLDLHASD-------------------------------------
TRMB_STRA5      SQYG---MTL--KQVWLDLHASD-------------------------------------
TRMB_STRA3      SQYG---MTL--KQVWLDLHASD-------------------------------------
TRMB_STRP3      SQYG---MTL--RQIWLDLHASN-------------------------------------
TRMB_STRPB      SQYG---MTL--RQIWLDLHASN-------------------------------------
TRMB_STRPF      SQYG---MTL--RQIWLDLHASN-------------------------------------
TRMB_STRPM      SQYG---MTL--RQIWLDLHASN-------------------------------------
TRMB_STRPC      SQYG---MTL--RQIWLDLHASN-------------------------------------
TRMB_STRP1      SQYG---MTL--RQIWLDLHASN-------------------------------------
TRMB_STRPD      SQYG---MTL--RQIWLDLHASN-------------------------------------
TRMB_STRPG      SQYG---MTL--RQIWLDLHASN-------------------------------------
TRMB_STRP8      SQYG---MTL--RQIWLDLHASN-------------------------------------
TRMB_STRP6      SQYG---MTL--RQIWLDLHASN-------------------------------------
TRMB_STRSY      SQYG---MVL--KQVWLDLHADG-------------------------------------
TRMB_STRS2      SQYG---MVL--KQVWLDLHADG-------------------------------------
TRMB_STRMU      SQYG---MIL--EQVWLDLHASD-------------------------------------
TRMB_STRSV      SQYG---MKL--KGVWLDLHASD-------------------------------------
TRMB_STRGC      SQYG---MKL--KGVWLDLHASD-------------------------------------
TRMB_STRR6      SQYG---MKL--NGVWLDLHASD-------------------------------------
TRMB_STRPN      SQYG---MKL--NGVWLDLHASD-------------------------------------
TRMB_STRP2      SQYG---MKL--NGVWLDLHASD-------------------------------------
TRMB_LACLM      ANYG---MEL--KKVWLDLHQDEEF-----------------------------------
TRMB_LACLA      ANYG---MEL--KKVWLDLHQDEEF-----------------------------------
TRMB_LACLS      ANYG---MEL--KKVWLDLHQDEEF-----------------------------------
TRMB_ENTFA      SKYG---MII--ERVWLDLHNSE-------------------------------------
TRMB_BACHD      SKYG---MIL--HNVSLDLHNSD-------------------------------------
TRMB_BACSK      STFG---MAF--KNVSLNLHQSG-------------------------------------
TRMB_OCEIH      SQNG---MNI--NEINVDLHAIQ-------------------------------------
TRMB_STAES      SQFG---MYF--TKMNLNLHDED-------------------------------------
TRMB_STAEQ      SQFG---MYF--TKMNLNLHDED-------------------------------------
TRMB_STAHJ      SQYG---MYF--TKLNLNLHDED-------------------------------------
TRMB_STAA3      SQFG---MYF--TKINLNLHQED-------------------------------------
TRMB_STAA8      SQFG---MYF--TKINLNLHQED-------------------------------------
TRMB_STAAB      SQFG---MYF--TKINLNLHQED-------------------------------------
TRMB_STAAC      SQFG---MYF--TKINLNLHQED-------------------------------------
TRMB_STAAS      SQFG---MYF--TKINLNLHQED-------------------------------------
TRMB_STAAW      SQFG---MYF--TKINLNLHQED-------------------------------------
TRMB_STAAM      SQFG---MYF--TKINLNLHQED-------------------------------------
TRMB_STAAN      SQFG---MYF--TKINLNLHQED-------------------------------------
TRMB_STAAR      SQFG---MYF--TKINLNLHQED-------------------------------------
TRMB_STAS1      SQFG---MYF--TKINLNLHEED-------------------------------------
TRMB_LACRD      NNYG---MIF--DGVWLDLHHSEE------------------------------------
TRMB_PEDPA      NNYG---MTF--EGVWLDLHNSEE------------------------------------
TRMB_LACPL      NNFG---MQF--EQVWLDLHAVAT------------------------------------
TRMB_LACS1      NNFG---MKF--DGVWLDLHSSPE------------------------------------
TRMB_LACSS      NAYG---MVF--DDISLDLHNSDL------------------------------------
TRMB_LACP3      NHFG---MTF--DLVSLNLHHDKR------------------------------------
TRMB_LACBA      NNFG---MVF--EGVWLDLHAATD------------------------------------
TRMB_LACJO      NNYG---MKF--DYVSLDLHHADDEI----------------------------------
TRMB_LACGA      NNYG---MKF--DYVSLDLHHAENEI----------------------------------
TRMB_LACDA      NNYG---MHF--DFMSVDLHHESEEI----------------------------------
TRMB_LACDB      NNYG---MHF--DFMSVDLHHESEEI----------------------------------
TRMB_LACAC      NNYG---MFF--DFVSVDLHHEKPEI----------------------------------
TRMB_LACH4      NNFG---MHF--DFVSVDLHHEKPEI----------------------------------
TRMB_LEUMM      MDYG---MRWTPEDYTLDLHADEDK-----------------------------------
TRMB_OENOB      KKFG---LSWPEEQISYDLHHELKK-----------------------------------
TRMB_LACP7      TLSG---WQL--RDVTFDLHHSEYV-----------------------------------
TRMB_CLOD6      AANN---WLL--KNISLDLGNSEY------------------------------------
TRMB_ALKOO      TQKN---FTL--VEVIEDLHGSTD------------------------------------
TRMB_ALKMQ      KEEN---FHF--VQVIYNLHNDGI------------------------------------
TRMB_CLOPS      KECN---FEI--TYITRDLHNSGY------------------------------------
TRMB_CLOP1      KECN---FEI--TYITRDLHNSGY------------------------------------
TRMB_CLOPE      KECN---FEI--TYITRDLHNSGY------------------------------------
TRMB_CLOB8      NEAG---FRI--KYITYDLHNSDV------------------------------------
TRMB_HUNT2      EQCN---FNI--VYLTEDLHASGF------------------------------------
TRMB_CLOTE      KESG---FSI--EYITYDLHKSDF------------------------------------
TRMB_CLOK5      VESG---FSI--DYITYDLHDSGF------------------------------------
TRMB_CLOAB      KECG---FQI--KFMTYDLHKSGF------------------------------------
TRMB_CLONN      EESG---FEL--LYKTYDLHNSDYA-----------------------------------
TRMB_DESHY      AEAG---FIE--KYRTFDLHQSEF------------------------------------
TRMB_MYCGE      QENS-QIFEIIHQITDLNN----SEF----------------------------------
TRMB_MYCPN      QKTV-AHFKIIEQTTDLHN----SPL----------------------------------
TRMB_UREPA      LLKDLTKYEILFLTYNLYTL-VNNVE----------------------------------
TRMB_UREP2      LLKDLTKYEILFLTYNLYTL-VNNVE----------------------------------
TRMB_MYCCT      KLTN--KWEIISNTLDLYN---DQEL----------------------------------
TRMB_MYCMS      NLTN--KWEIVINATDLYN---NTEF----------------------------------
TRMB_MESFL      AENK--NWELIYQTTDLYS---DIEA----------------------------------
TRMB_MYCGA      NSLE--QIKIIAYTNDLHSLDSSDAL----------------------------------
TRMB_MYCPE      RENS---FCLTFATKNLYS----SAH----------------------------------
TRMB_MYCPU      EKNG---LNIINKTSDLEK----SEF----------------------------------
TRMB_MYCHP      KEIN---AKIIYQTSDLHH----CNF----------------------------------
TRMB_MYCH2      KENG---WKITYQTNDLHN----SLV----------------------------------
TRMB_MYCH7      KENG---WKITYQTNDLHN----SLV----------------------------------
TRMB_MYCHJ      KENG---WKITYQTNDLHN----SLV----------------------------------
TRMB_MYCMO      SEFG---MKILYQTNDLHN----SIK----------------------------------
TRMB_MYCS5      QENN---WNLKFVTGDLHN----SIY----------------------------------
TRMB_BACFR      EENG---LPVEFI--TEDLYHSDLVD----------------------------------
TRMB_BACFN      EENG---LPVEFI--TEDLYHSDLVD----------------------------------
TRMB_BACTN      EANQ---LPVEFI--TEDLYHSDLVD----------------------------------
TRMB_PORGI      ELNG---LPVHEI--TDDLYGKGCVEN---------------------------------
TRMB_GRAFK      HGEG---HEILYA--HHDIYKNEYSPK---------------------------------
TRMB_CYTH3      TDQT---LKIKDLVFTHDLYQSPLLA----------------------------------
TRMB_CHLSY      PAFP----------ALRATPASVEELA---------------------------------
TRMB_CHLAA      PAFP----------ALRATPASVEELA---------------------------------
TRMB_CHLAD      PAFP----------RLRGLPASPSELA---------------------------------
TRMB_CHLT3      QNDT----------RYELISDEAKCMA---------------------------------
TRMB_RUBXD      ERDG----------RWRRAHEEPYLTG---------------------------------
TRMB_THEMA      ESSE---------YFVVDVFEEN-------------------------------------
TRMB_COPPD      EESG-----------LFSLADYAVR-----------------------------------
TRMB_CHLPD      PDTG------------FEVENSII------------------------------------
TRMB_AQUAE      KVLD-----------CFEVEEGTL------------------------------------
TRMB_NEOSM      LEVF------------SKVENTEI------------------------------------
TRMB_WOLPM      KQCN-----------SLIYREDD-------------------------------------
TRMB_RHOBA      AEIAP--------ELGVPLPETQR------------------------------------
TRMB_BDEBA      RQSP-----YKIIFETQDLHNSDMK-----------------------------------
                                                                            

TRMB_TRIV2      ------------------NPLPVATERETTTQNRGEPVYRALFERIS-------------
TRMB_NOSS1      ------------------NPLPVATERETTTQNRGEPVYRALFERSS-------------
TRMB_MICAN      ------------------NIFPVPTEREKSTYNKGQPVYRSLFRVR--------------
TRMB_SYNP6      ------------------NPLPVPTEREIAVQNKQLPVYRALFIRQPAD-----------
TRMB_SYNE7      ------------------NPLPVPTEREIAVQNKQLPVYRALFIRQPAD-----------
TRMB_TRIEI      ------------------NILPVLSEREKVTLGKNQPVYRALFIKLEEPTPNIISP----
TRMB_SYNY3      ------------------NPLGVPTEREIACFNLQRPVYRCLLQRTP-------------
TRMB_THEEB      ------------------SPWPVATEREKCVLNKGLAVYRWQFERCAV------------
TRMB_SYNJA      ------------------NPFGIPTEREWQCLQLGLPIYRYWLERR--------------
TRMB_SYNJB      ------------------NPLGIPTEREWQCLQLDLPIYRYWLERR--------------
TRMB_PROMM      ------------------NPLPVPTERERYVLDQGLQVYRRLYQRNDQQAPELSNLEALW
TRMB_PROM3      ------------------NPMPVPTERERYVLDQGLQVYRRLYQRNDQQAPELSNLEALW
TRMB_SYNSC      ------------------NPLSVPTERERYVLKQNLPVYRVLYRRNQNPLPSVSDLEQRW
TRMB_SYNPX      ------------------NPLPVPTEREQYVLEKNLPVYRVLYRRNASPLPDPEALKSRW
TRMB_SYNS9      ------------------NPLTVPTERERYVMDQQLPVYRVLFRRNHTHQPPIEEFEQHW
TRMB_SYNS3      ------------------NPLPVATERERYVQEQGQPTYRVLFERTQAELPALRDLEMAW
TRMB_SYNPW      ------------------NPLPVPTERERYVQELGLPAYRVLYRRNRQPLPDPEELEIAW
TRMB_PROMA      ------------------NPFKFCTEREKYAIHQGVKVYRQLYFRNSTGIL---------
TRMB_PROMT      ------------------NPYNVMTDREILSLKKNLLIYRVMYIRNSLLFTN--------
TRMB_PROM1      ------------------NPYDVMTDREIFSLKKNLLIYRVMYIRNSLLFTN--------
TRMB_PROMS      ------------------NPNKVKTNREKYVINNQLDIFERIYIKI--------------
TRMB_PROM2      ------------------NPNKVKTNRENYVIVNQINIFERIYMRI--------------
TRMB_PROM9      ------------------NPSQVKTNREKYVIVNQLDIFERIYIKI--------------
TRMB_PROMP      ------------------NPNRIQTNREKYVILNQLKIYESIYKKI--------------
TRMB_PROM5      ------------------NPIKTQTKREKYVLLSQFEIYESIYIRI--------------
TRMB_GEOSL      -------------------EGYHLSKYMQKFMAEGKRIYFIHYRT----TMEG-------
TRMB_GEOMG      -------------------EGYHLSKYMMKFMAEGKRIYFVHYRK----TAEGAA-----
TRMB_PELCD      -------------------AGYPLSKYMRRFLAQGQSIHFIHHRRNPQHTCETAAPQPVH
TRMB_MYXXD      -------------------PEEVPSTRERRYLASGEPVYRARLLKPA-------------
TRMB_ANADE      -------------------PDEIPSTRERRYLASGEPVWRLRLVKA--------------
TRMB_THET8      -------------------TKYALKWKEAGRAFFHAAFIKLREDPAPWPPLRRY------
TRMB_THET2      -------------------TKYALKWKEAGRTFFHAAFIKLREDPAPWPPLRRY------
TRMB_DEIGD      -------------------TKYARKWRELGLEVQHARFVPTHHPHVPHGTVARFPDSEDA
TRMB_DEIRA      -------------------TKYAQKWRDLGLGVNHARFVPTRHDPVPNGTFAPY--SEED
TRMB_CHLAB      ------------PYYCKMLENYGDSWFERLWRSKGQEIFYTEFVKKVGI-----------
TRMB_CHLCV      ------------PYYCKVLDNYGDSWFERLWRSKGQEIFYTEFVKKVGI-----------
TRMB_CHLFF      ------------PYYCEV-ENYGNSWFETLWRSKGREIFYTEFVKKLGYS----------
TRMB_CHLTR      ------------PHYINVKDNYGGSWFENLWRSKGQEIFCTEFIKRVGI-----------
TRMB_CHLTA      ------------PHYINVKDNYGGSWFENLWRSKGQEIFCTEFIKRVGI-----------
TRMB_CHLMU      ------------PYYVNVKDNYGGSWFENLWRSKGEKIFCTEFVKRVGI-----------
TRMB_CHLPN      ------------PYYIKMTDTYGNSWFENLWRTKGQEIFYTEFIKKAGI-----------
TRMB_PARUW      ------------PYYTTSYPGYGSSYFEELWREKGKSIHYHVFRKI--------------
TRMB_LEPIN      ------------VELKSERNEIPVSHFERKKREEGKRIYYIDRVLVQK------------
TRMB_LEPIC      ------------VELKSERNEIPVSHFERKKREEGKRIYYIDRVLVQK------------
TRMB_LEPBJ      ------------MEFRLERKEIPVSHFERKKRKEGKRIYYIDQILIRK------------
TRMB_LEPBL      ------------MEFRLERKEIPVSHFERKKRKEGKRIYYIDQILIRK------------
TRMB_NITEU      ------------VDYAARPAYRPLTKFEQRGMKLGHTIRDIIFTRTA-------------
TRMB_NITEC      ------------ADYAPRPAYRPLTKFEQRGMKLGHTIRDLIFTKAA-------------
TRMB_NITMU      ------------VGYAPRPEYRPLTKFEQRGLRLGHEVWDVIFRKKQGA-----------
TRMB_BURVG      ------------ADYAPRPDYRPVTKFERRGLRLGHGVWDLVFRKRAA------------
TRMB_BURCM      ------------ADYAPRPDYRPITKFERRGLRLGHGVWDLVFRKRAG------------
TRMB_BURL3      ------------ADYAPRPDYRPVTKFERRGLRLGHGVWDLVFRKRAA------------
TRMB_BURCH      ------------ADYAPRPDYRPVTKFERRGLRLGHGVWDLVFRKRAD------------
TRMB_BURCA      ------------ADYAPRPDYRPVTKFERRGLRLGHGVWDLVFRKRAD------------
TRMB_BURPS      ------------QDYAPRPGYRPVTKFERRGLRLGHGVWDLVFRKKHAG-----------
TRMB_BURP1      ------------QDYAPRPGYRPVTKFERRGLRLGHGVWDLVFRKKHAG-----------
TRMB_BURMA      ------------QNYAPRPGYRPVTKFERRGLRLGHGVWDLVFRKKHAG-----------
TRMB_BURTA      ------------QDYAPRPDYRPVTKFERRGLRLGHGVWDLVFRKKRAG-----------
TRMB_PARXL      ------------DGYAPRPEYRPVTKFERRGLRLGHGVWDLVFRKRGAG-----------
TRMB_THIDA      ------------AAYVPRPDTRPLTKFEQRGIRLGHGVWDLVFRRR--------------
TRMB_METFK      ------------QSYAPKPDYRPLTKFENRGIKLGHGVWDIIFRRK--------------
TRMB_CUPNH      -----------ADGFAERPDYRPVTKFERRGVRLGHGVWDVVFRKRAA------------
TRMB_CUPPJ      -----------ADGFSERPEYRPITKFERRGVRLGHGVWDVVFRKRG-------------
TRMB_CUPMC      -----------DGGFAERPDYRPVTKFEKRGLRLGHGVWDVVFRKK--------------
TRMB_RALSO      -----------ADGFAPRPDYRPVTKFEKRGLRLGHGVWDVVFRKRAA------------
TRMB_ACISJ      ------------EGYAPQPDYRPLTKFENRGMRLGHGVWDLVFTRR--------------
TRMB_ACIAC      ------------DGYAPQPDYRPLTKFENRGLRLGHGVWDILFRRVA-------------
TRMB_VEREI      ------------PGFAPKPGYRPLTKFENRGLRLGHGVRDLVFERRH-------------
TRMB_POLSJ      ------------GGYAPKPDYRPLTKFENRGIKLGHGVWDVVFTRV--------------
TRMB_POLNA      ------------DGYAPKPGYRPLTKFENRGIKLGHGVWDVVFTRA--------------
TRMB_RHOFT      -----------LAGYAPKPYYRPLTKFENRGIKLGHGVWDIVFERV--------------
TRMB_NEIMB      ------------ADYAPTPDYRPETKFEARGKRLGHGVWDLVFKRIG-------------
TRMB_NEIMA      ------------ADYAPTPDYRPETKFEARGKRLGHGVWDLVFKRIG-------------
TRMB_NEIMF      ------------ADYAPTPDYRPETKFEARGKRLGHGVWDLVFKRMG-------------
TRMB_NEIM0      ------------TDYAPTPDYRPETKFEARGKRLGHGVWDLVFKRIR-------------
TRMB_NEIG1      ------------ADYAPTPDYRPETKFEARGKRLGHGVWDLVFKRIG-------------
TRMB_CHRVO      ------------DGYAPRPDYRPLTKFEARGIKLGHGVWDVIFRRK--------------
TRMB_AZOSB      ------------DGFAPRPDYRPLTKFENRGLKLGHGVWDLVFRRR--------------
TRMB_AROAE      ------------DGYAPRPAYRPLTKFENRGLKLGHGVWDLVFRRRG-------------
TRMB_DECAR      ------------EGFAPRPDYRPLTKFENRGLRLGHGVWDVIFRKKQLA-----------
TRMB_BORBR      ------------DGYAPRPDFRPQTKFETRGLRLGHGVWDLMFKRA--------------
TRMB_BORPA      ------------DGYAPRPDFRPQTKFETRGLRLGHGVWDLMFKRA--------------
TRMB_BORPE      ------------DGYAPRPDFRPQTKFETRGLRLGHGVWDLMFKRA--------------
TRMB_BORA1      ------------QDYAERPAYRPQTKFETRGLRLGHGVWDLIFKRKA-------------
TRMB_NITOC      ------------EGQSTQ---RPRTKFEARGQQQGHGVWDLRFKRSVDS-----------
TRMB_ALKEH      ------------RQFSPRGE-RPETKFERRGLRKGHQVFDLYYRKREHPG----------
TRMB_HALHL      ------------RAFVPPPPPRPQTKFERRGLRKGHQVHDLIYRLRPDTAG---------
TRMB_LEIXX      ------------GAFIPRPEARPVTKFERRGEKLGHSIFDLEYRPLP-------------
TRMB_XYLFA      ------------RGQVPCPDWRVQTRFERRGQNLGHRVWDLLYDRV--------------
TRMB_XYLFT      ------------RGQVPCPDWRVQTRFERRGQNLGHRVWNLLYDRV--------------
TRMB_XANC5      ------------RGHVERPAWRPQTHFETRGQKLGHGVWDLLYDRDSGIGNRKGNCPRRP
TRMB_XANAC      ------------RGHVERPTWRPQTHFETRGQKLGHGVWDLLYDRDSGIGNRE-------
TRMB_XANOM      ------------RGHVERPAWRPQTHFETRGQKLGHGVWDLVYDRDPGVGSGDA------
TRMB_XANOR      ------------RGHVERPAWRPQTHFETRGQKLGHGVWDLVYDRDPGVGSGDA------
TRMB_XANCP      ------------RGHVARPAWRPQTHFETRGQKLGHGVWDLLYDRESGMENRE-------
TRMB_XANC8      ------------RGHVARPAWRPQTHFETRGQKLGHGVWDLLYDRESGMENRE-------
TRMB_METCA      ------------GRFSERPAYRTPTKFEQRGQRLGHGVWDLVYRRS--------------
TRMB_STRAW      ------------GGYAPRPGFRPLTRFEGQGLDKGHVVNDLLFRRVQPRDQHRDLPPSAT
TRMB_STRCO      ------------GGFAPRPEHRPLTRFEGQGLDKGHVVNDLLFRRVQ----HKEPPPNG-
TRMB_SHESM      -----------DGTVVPRPDHRPLTKFEARGHRLGHGVWDLMFERIA-------------
TRMB_SHESA      -----------DGTVVPRPDHRPLTKFEARGHRLGHGVWDLMFERIA-------------
TRMB_SHESR      -----------DGTVVPRPDHRPLTKFEARGHRLGHGVWDLMFERIA-------------
TRMB_SHEON      -----------DGTVVPRPDHRPLTKFEARGHRLGHGVWDLMFERIA-------------
TRMB_SHEPC      -----------DGTVVPRPDHRPLTKFEARGHRLGHGVWDLMFERIA-------------
TRMB_SHESW      -----------DDTVVPRPDHRPLTKFEARGHRLGHGVWDLMFERIV-------------
TRMB_SHEB8      -----------DGTVVPRPDHRPLTKFEARGHRLGHGVWDLMFERIA-------------
TRMB_SHEB5      -----------DGTVVPRPDHRPLTKFEARGHRLGHGVWDLMFERIA-------------
TRMB_SHEB9      -----------DGTVVPRPDHRPLTKFEARGHRLGHGVWDLMFERIA-------------
TRMB_SHEFN      -----------TGTVVERPEHRPLTKFEARGHRLGHGVWDIMFERTA-------------
TRMB_SHEDO      -----------TGTVVERPDHRPLTKFEARGHRLGHGVWDIMFERIS-------------
TRMB_SHEHH      -----------TGDVVERPDHRPLTKFEARGHRLGHGVWDLMFERV--------------
TRMB_SHEPA      -----------TGDVVERPAHRPLTKFEARGHRLGHGVWDLMFERV--------------
TRMB_SHESH      -----------TGDVVERPDHRPLTKFEARGHRLGHGVWDIMFERID-------------
TRMB_SHEAM      -----------TQTYVPRPDHRPLTKFENRGQRLGHGVWDLMFERVE-------------
TRMB_VIBPA      -----------DGDFVPRPEDRPLTKFEARGHRLGHGVWDIKYKRIA-------------
TRMB_VIBCB      -----------EGDFIPRPEERPLTKFEARGHRLGHGVWDIKFKRTA-------------
TRMB_VIBVY      -----------AGDYIPRPEERPLTKFEARGHRLGHGVWDIKFKRVS-------------
TRMB_VIBVU      -----------AGDYIPRPEERPLTKFEARGHRLGHGVWDIKFKRVS-------------
TRMB_VIBCH      -----------DGDYVPRPDERPLTKFEQRGHRLGHGVWDIKYQRTA-------------
TRMB_VIBC3      -----------DGDYIPRPDERPLTKFEQRGHRLGHGVWDIKYQRTA-------------
TRMB_PHOPR      -----------DGDYIARPDDRPLTKFEARGHRLGHGVWDMKYTRTE-------------
TRMB_AERHH      -----------TGNWVPRPDWRPLTKFEQRGHRLGHGVWDLIFKRVN-------------
TRMB_PSEA6      -----------TSDYVPRPEQRPLTKFEQRGHRLGHGVWDLMFERVA-------------
TRMB_PSEHT      -----------TNDYVPRPDLRPLTKFEQRGHRLGHGVWDLMFERTK-------------
TRMB_COLP3      -----------SNDYVPRPDSRPLTKFENRGQNLGHGVWDLQFAKKA-------------
TRMB_PSYIN      -----------S-DYAPRPEWRPLTKFENRGNNLGHGVWDLLFERIS-------------
TRMB_SALCH      -----------SNDYVPRPESRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_SALPA      -----------SNDYVPRPESRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_SALTI      -----------SNDYVPRPESRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_SALAR      -----------SNDYVPRPQSRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_SALTY      -----------SNDYVPRPESRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_ECOL6      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_ECOUT      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_ECOK1      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERMK-------------
TRMB_ECOL5      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_ECOHS      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_ECO57      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_ECOLC      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_SHISS      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_ECO24      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_SHIFL      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_ECOLI      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_SHIF8      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_SHIDS      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_SHIBS      -----------SNDYVPRPASRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_KLEP7      -----------SNDYVPRPESRPVTKFEQRGHRLGHGVWDLMFERVK-------------
TRMB_CROS8      -----------TQDYVPRPASRPVTKFEQRGHRLGHGVWDLMFGRVK-------------
TRMB_YERPE      -----------QNDYVPRPDSRPLTKFELRGQRLGHGVWDLMFERKE-------------
TRMB_YERPP      -----------QNDYVPRPDSRPLTKFELRGQRLGHGVWDLMFERKE-------------
TRMB_YERPA      -----------QNDYVPRPDSRPLTKFELRGQRLGHGVWDLMFERKE-------------
TRMB_YERPN      -----------QNDYVPRPDSRPLTKFELRGQRLGHGVWDLMFERKE-------------
TRMB_YERP3      -----------QNDYVPRPDSRPLTKFELRGQRLGHGVWDLMFERKE-------------
TRMB_YERPS      -----------QNDYVPRPDSRPLTKFELRGQRLGHGVWDLMFERKE-------------
TRMB_YERE8      -----------QNDYVPRPDSRPLTKFELRGQRLGHGVWDLMFERKE-------------
TRMB_SERP5      -----------DNDYVPRPDSRPLTKFELRGQRLGHGVWDLMFERKE-------------
TRMB_PECAS      -----------NNEYVVRPESRPLTKFEARGQRLGHGVWDLMFERIK-------------
TRMB_PHOLL      -----------NGDYVPRPSSRPITKFELRGQRLGHGVWDIMFKRIK-------------
TRMB_SODGM      -----------TGDYVPRPASRPLTKFEQRGQRLGHGVWDLMFAKTV-------------
TRMB_IDILO      -----------SGDYVPRPENRPKTKFERRGEGKGHGVWDLQFKTNKSATLLG-------
TRMB_ACTP2      -----------TNDFIPRPDFRPLTKFEERAHRLGHGVWDLYFVKQA-------------
TRMB_HAEDU      -----------TGDFIDRPAFRPLTKFEARGQRLGHAVWDLYFVKK--------------
TRMB_HAES1      -----------TNDYIPRPDFRPLTKFEQRGHKLGHGVWDLFFIKNIT------------
TRMB_HISS2      -----------TNDYIPRPDFRPLTKFEQRGHKLGHGVWDLFFIKNIT------------
TRMB_MANSM      -----------TNDFIPRPDFRPLTKFEQRGHRLGHGVWDLYFVKN--------------
TRMB_HAEI8      -----------NGDYIPRPDFRPLTKFEARGYKLGHGVWDLYFVKK--------------
TRMB_HAEIN      -----------NGDYIPRPDFRPLTKFEARGYKLGHGVWDLYFVKK--------------
TRMB_HAEIG      -----------NGNYIPRPDFRPLTKFEARGHKLGHGVWDLYFVKK--------------
TRMB_HAEIE      -----------NGDYIPRPDFRPLTKFEARGHRLGHGVWDLYFVKK--------------
TRMB_PASMU      -----------THDYIPRPDFRPLTKFEQRGHRLGHGVWDLYYIKK--------------
TRMB_ACTSZ      -----------TGDFIPRPDFRPLTKFEQRGQKLGHGIWDLYFIKN--------------
TRMB_HAHCH      -----------AGQFSPRPDTRPVTKFEKRGERLGHGVWDLMFRRVD-------------
TRMB_MARHV      -----------QGGYSPKPDDRPITKFEKRGESLGHGVWDLLFYRTN-------------
TRMB_SACD2      -----------GSEFAPQPSYRPTTKFERRGENLGHGVWDIIFSRSL-------------
TRMB_ALCBS      -----------PSAFSPRPSWRPETKFERRGEKLGHGVWDLLFEKRA-------------
TRMB_PSEPK      -----------DGTYVPRPEERPITKFERRGERLGHGVWDLKFEKVD-------------
TRMB_PSEPG      -----------DGTYVPRPEERPITKFERRGERLGHGVWDLKFEKVD-------------
TRMB_PSEP1      -----------DGTYVPRPEERPITKFERRGERLGHGVWDLKFEKVD-------------
TRMB_PSEE4      -----------DGAYVPRPEERPITKFERRGERLGHGVWDLKFEKVD-------------
TRMB_PSEPF      -----------DGKCVPRPAERPITKFERRGERLGHGVWDLKFEKLA-------------
TRMB_PSEF5      -----------DGKCVPRPAERPITKFERRGERLGHGVWDLKFEKLA-------------
TRMB_PSEU2      -----------DNQYVPRPAERPITKFERRGEKLGHGVWDLKFEKVD-------------
TRMB_PSE14      -----------DNQYVPRPAERPITKFERRGEKLGHGVWDLKFEKVD-------------
TRMB_PSESM      -----------DNQYVPRPAERPITKFERRGEKLGHGVWDLKFEKVD-------------
TRMB_PSEAE      -----------DGRFVPRPQERPVTKFERRGERLGHGVWDLKFERVD-------------
TRMB_PSEA7      -----------DGRFVPRPQERPVTKFERRGERLGHGVWDLKFERVD-------------
TRMB_PSEAB      -----------DGRFVARPQERPVTKFERRGERLGHGVWDLKFERID-------------
TRMB_PSEMY      -----------DGTYVPRPEERPVTKFERRGERLGHGVWDLKFQRQE-------------
TRMB_PSEU5      -----------DGRCVPRPTERPVTKFERRGERLGHGVWDLKFQRID-------------
TRMB_CHRSD      -----------SAPYVPRPEFRPLTKFESRGERLGHGVWDLIYARVE-------------
TRMB_HYDCU      -----------EGQYTPRPDYRPLTKFEQRGHRLGHGVWDLVFERI--------------
TRMB_LEGPA      -----------EGGYSPRPDSRPLTKFEQRGERLGHGVWDLVFIKNKEVTNDKACNSY--
TRMB_LEGPH      -----------EGGYSPRPDSRPLTKFELRGERLGHGVWDLVFIKK--------------
TRMB_LEGPL      -----------EGGYSPRPDSRPLTKFELRGERLGHGVWDLVFIKK--------------
TRMB_LEGPC      -----------EGGYSPRPDSRPLTKFEQRGERLGHGVWDLVFIKK--------------
TRMB_FRATF      -------------GFAPRPEWRPLTKFEKRGQNLDHPISDILFEKI--------------
TRMB_FRATN      -------------GFAPRPEWRPLTKFEKRGQNLDHPISDILFEKI--------------
TRMB_FRATO      -------------GFAPRPEWRPLTKFEKRGQNLDHPISDILFEKI--------------
TRMB_FRAP2      -------------GFAPRPEWRPLTKFEKRGQNLDHPISDILFEKI--------------
TRMB_TREDE      -------------KFAPSQSWRPTTKFEKKGLKKEHVINELIFEKD--------------
TRMB_TREPA      -------------GARP---WRPATEFERKAQTQGRAIHELFFIKA--------------
TRMB_BUCAI      -----------KNNFVKRPVSRIITKFEKKGLLQGKKIFDLMFQLKK-------------
TRMB_BUCAP      -----------KRMCFEHFKYRLVTNFEKKAKLSGNKIFDLIFKLKK-------------
TRMB_BUCBP      -----------TGDYVIRSDYRLVTKFEKKGLVLGNKIFNLKFKSIFNNSNFL-------
TRMB_NOCFA      -----------ARTLAPIGLDRPVTKFEDKAHRAGSAITEFVWGKIE-------------
TRMB_RHOJR      ----------------PMTHERPVTKFEDKAHQVGSAITELIWGKIRS------------
TRMB_MYCSK      ---------------LPISVRRPVTKYERKA-LAGPDVAELLWEKVP-------------
TRMB_MYCSS      ---------------LPISVRRPVTKYERKA-LAGPDVAELLWEKVP-------------
TRMB_MYCGI      ---------------LPMSVTRPVTKYERKA-LAGPVVTELLWERTP-------------
TRMB_MYCVP      ---------------LPISTARPVTKYQRKA-LAGTEVAELLWEKTTP------------
TRMB_MYCBP      ---------------LPISVVRPATKYERKAQLGGGAVIELLWKKHGCSERDLKIR----
TRMB_MYCTU      ---------------LPISVVRPATKYERKAQLGGGAVIELLWKKHGCSERDLKIR----
TRMB_MYCBO      ---------------LPISVVRPATKYERKAQLGGGAVIELLWKKHGCSERDLKIR----
TRMB_MYCUA      ---------------LPVSVVRPTTKYEMKAHNAGSSINELIWKKQR-------------
TRMB_MYCA1      ---------------LPISVARPTTKYETKAQDAGSAVTEFIWLRR--------------
TRMB_MYCPA      ---------------LPISVARPTTKYETKAQDAGSAVTEFIWLRR--------------
TRMB_MYCLE      ---------------LPISTVRPTTKYETKAQHAGNVVTELIWKKRS-------------
TRMB_CORGB      ---------------PQLTDRQVITKFEGKGLEKDHVINEYLWQKVQN------------
TRMB_CORGL      ---------------PQLTDRQVITKFEGKGLEKDHVINEYLWQKVQN------------
TRMB_COREF      ---------------PQLTDRQVITKFEGKGLDKDHTINEYLWQKKQ-------------
TRMB_CORDI      ---------------PQLTDRQVITKFEGKGLDKDHTITEFLWRRK--------------
TRMB_CORJK      --------------IPQLTDRQVITKFEGKGLDKEHIIREYLWRKK--------------
TRMB_CUTAK      -----------PDGFSPRWPERPVTRYENKGLTAGRTIHDLTWRRVDES-----------
TRMB_NOCSJ      ------------GGVVERWAERPVTKFERKGIAAGRAITDLAYRRRGAAR----------
TRMB_PAEAT      EHTGPNEGVDEEGGWAPRFDGRIRTSFENKAHEAGRMIFDLTYRKR--------------
TRMB_ARTS2      EHTGPNEGVDETGGWAPRFEGRIRTSFENKAHEAGRLIFDLCYRRL--------------
TRMB_BIFAA      NADEAAALRHADFAESERFDGRVLTNFEKKGLAAGRVIHDFTYRRV--------------
TRMB_BIFLO      NADMAADMPHADFTESERFEGRVLTNFEKKGLAAGRVIHDFTYQAVTLN-----------
TRMB_PSYCK      -----------AGNFTSRPDFRPMTKFERRGLASGHGVWDLIYLKD--------------
TRMB_PSYA2      -----------AGNFTDRPDFRPMTKFERRGLERGHGVWDLIYLKD--------------
TRMB_ACIAD      -----------KGNSYPRPEWRPQTKFERRGIESGHKINDFIFKKIGS------------
TRMB_RHIME      -------------DWLTPFAGWPSTRYEAKARREGRSSAYLAFRRA--------------
TRMB_SINMW      -------------DWLAPFAGWPSTRYEAKARREGRSSAYLSFRRS--------------
TRMB_RHIEC      -------------DWLTPYEGWPSTRYEAKARREGRSSAYLTFRKI--------------
TRMB_RHIL3      -------------DWLTPYEGWPSTRYEAKARREGRSSAYLTFRKV--------------
TRMB_AGRFC      -------------DWRTPYANWPGTRYENKAKREGRSSAYLTFIRR--------------
TRMB_RHILO      -------------DWHRPYEGWPGTRYEAKAIREGRRPAYLTFVRK--------------
TRMB_BRUAB      -------------DWNDAYEGWPGTRYEAKAFHEGRRAAYLTFIRR--------------
TRMB_BRUA2      -------------DWNDAYEGWPGTRYEAKAFHEGRRAAYLTFIRR--------------
TRMB_BRUME      -------------DWNDAYEGWPGTRYEAKAFREGRRAAYLTFIRR--------------
TRMB_BRUSU      -------------DWNDAYEGWPGTRYEAKAFREGRRAVYLTFIRR--------------
TRMB_OCHA4      -------------DWNHAYEGWPGTRYEAKAFREGRRAAYLTFIRR--------------
TRMB_CHESB      -------------DWRHPYEGWPGTRYEAKAMREGRHPAYLTFVRV--------------
TRMB_BARQU      -------------DWKTPYPLWPGTRYEEKALREGRTPTYLTFIKK--------------
TRMB_BARHE      -------------DWKTPYTLWSGTRYEAKALREGRAPTYLTFIKK--------------
TRMB_BARBK      -------------DWKIPYPLWPSTRYEAKALRENRVPTYLTFIKK--------------
TRMB_AZOC5      -------------DWRTPYEGWPGTRYEAKAIAAGRVPTYLSFARV--------------
TRMB_RHOPS      -------------DWRKPWSGYTMTRYGRKAEREGRRASYLRFRRIAA------------
TRMB_RHOP2      -------------DWRKPWPNYTMTRYGRKAEREGRRAAYLRFRRRAA------------
TRMB_RHOPA      -------------DWRKPWPNYTMTRYGRKAEREGRRANYLRFERL--------------
TRMB_NITHX      -------------DWHNPWPDYTMTRYGRKAEREGRRAAYLRFRRESDAAQA--------
TRMB_NITWN      -------------DWQDPWSGYTMTRYGRKAMREGRRAAYLRFRRERTAV----------
TRMB_RHOP5      -------------DWQNPFAGYTMTRYGRKAEREGRRAAYLHFQRNAA------------
TRMB_RHOPB      -------------DWQLPFAGYTMTRYGRKAEREGRRAAYLHFRRAAAAPNDRAKAGEL-
TRMB_BRADU      -------------DFRQPWDGYTMTRYGRKAAREGRKAAYLRFRRS--------------
TRMB_RUEST      -------------DWRKPWGDWISTRYEQKALREGRTPHYLTFQRQD-------------
TRMB_RUEPO      -------------DWRQPWGDWISTRYEQKALREGRVPHYLTFRRLEG------------
TRMB_ROSDO      -------------DWRRPWPDWISTRYEQKALREGRTPHYLTFVRE--------------
TRMB_JANSC      -------------DWREPWCDWVSTRYEQKALREGRVPHYMTFQKRSL------------
TRMB_PARDP      ----------------QAWEDWPSTRYEQKALREGRVPHYVTFRRRS-------------
TRMB_RHOS4      ----------------EAWEDWLSTRYEQKALREGRVPHYMTFRRQG-------------
TRMB_RHORT      -------------DWRERPADWVETRYEAKALQAGRKPAYLIFRRRPRAADPGTLAEAPA
TRMB_MAGSA      -------------DRSAVPADWPATRYEQKCI-TGRAPVFFLYRRRAR------------
TRMB_GRABC      ---------------NERPEGWPPTRYEAKAIRAGRQPLYWRYVRR--------------
TRMB_NOVAD      -------------DFQVRPGGWPETRYEHKARTVYGHEVWYFRFRRR-------------
TRMB_SPHAL      -------------DFQVRPGGWPETRYEAKARAQ-GHEVWYFRWRRR-------------
TRMB_ERYLH      -------------DWQNRPSGWPETRYEHKARTKFGHEVWYFRFRRR-------------
TRMB_ZYMMO      -------------DFLQRPEDWPQTRYEKKAREK-GHEVWYFRYRRV-------------
TRMB_CAUVC      --------------RNAIPADHVTTRYEEKKLGD-CAPVFLDFTRG--------------
TRMB_CAUSK      --------------RNAPPADHVTTRYEEKKLGD-CAPVFLDFVRI--------------
TRMB_MARMM      -------------DWTLPPADHITTRYETKNLGD-CAPVFMDFLRV--------------
TRMB_HYPNA      -------------DWRCPPQDHVTTRYESKRLGD-CKPVWFDFRIR--------------
TRMB_MAGMM      -------------PFAAPPPWWIETNFERKGVAAGRIIRHLHYKKR--------------
TRMB_HELPY      ----------------KNAQIPVVSKYEARWNKLKKDIYDLRIYSLEWNETPFDN---HA
TRMB_HELPH      ----------------KNAQIPVISKYEARWNKLKKDIYDLRIYSLELNETPFYN---HA
TRMB_HELPJ      ----------------KNAQIPVVSKYEARWNKLKKDIYDLKIYSLGLDENPTQN---HA
TRMB_HELAH      ----------------KNAQIPVVSKYEARWNKLKKDIYDLRIYSLESNETPFNN---HA
TRMB_WOLSU      ----------------KNFDAPISSKYEDRWRKQNKNIYDLLLHNDQHSPDPLR-----P
TRMB_HELHP      ----------------KNQQEVITSKYEARWKKQQKNIYDLKIFHTYKNTNNEKNVKNTQ
TRMB_CAMJE      ----------------KNENLEISSKYEDRWKKQEKNIYDLWVWNFNQECKNYEL-----
TRMB_CAMJR      ----------------KNENLEISSKYEDRWKKQEKNIYDLWVWNFNQECKNYEL-----
TRMB_CAMJ8      ----------------KNENLEISSKYEDRWKKQEKNIYDLWVWNFNQECKNYEL-----
TRMB_CAMJJ      ----------------KNENLEISSKYEDRWKKQEKNIYDLWVWNFNQECKNYEL-----
TRMB_CAMJD      ----------------KNENLEISSKYEDRWKKQEKNIYDLWVWNFNQECQNYEL-----
TRMB_CAMFF      ----------------KNRFLDVSSKYEDRWIKQNRDIYDVVFTNLIVSEQKVLH-----
TRMB_SULDN      ----------------KNRDIAITSKYEDRWKRMQKNFYDVTMINSEESPELSLE-----
TRMB_GEOTN      ------------------IVGNVMTEYEEKFSAKGNRIYRCEALRPPQQS----------
TRMB_GEOKA      ------------------MTDNVMTEYEEKFSAKGNRIYRCEAVRPPRRSS---------
TRMB_BACHK      ------------------FEGNIMTEYEEKFSSKGHRIYRVEAKYRTEPMQ---------
TRMB_BACC1      ------------------FEGNIMTEYEEKFSSKGHRIYRVEAKYRTEPMQ---------
TRMB_BACAN      ------------------FEGNIMTEYEEKFSSKGHRIYRVEAKYRTEPMQ---------
TRMB_BACCZ      ------------------FEGNIMTEYEEKFSSKGHRIYRVEAKYRTEPMQ---------
TRMB_BACCR      ------------------FEGNIMTEYEEKFSSKGHRIYRVEAKYRTEPMQ---------
TRMB_BACAH      ------------------FEGNIMTEYEEKFSSKGHRIYRVEAKYRTEPMQ---------
TRMB_BACCN      ------------------FEGNIMTEYEEKFSSKGHRIYRVEAKYRTEPVQ---------
TRMB_BACSU      ------------------LEGNIMTEYEEKFSALGQPIYRAEVEWRT-------------
TRMB_BACVZ      ------------------PKGNIMTEYEEKFSALGQPIYRAEVEWRTKDRL---------
TRMB_BACLD      ------------------FEGNVMTEYEEKFAAKGQPIYRVEAEWRT-------------
TRMB_LISIN      ------------------YEGNIKTEYEEKFSAKGFPIYRLEAKFDRD------------
TRMB_LISW6      ------------------YEGNIKTEYEEKFSAKGFPIYRLEAKFDRN------------
TRMB_LISMO      ------------------YEGNIKTEYEEKFSAKGFPIYRLEAKFDRN------------
TRMB_LISMF      ------------------YEGNIKTEYEEKFSAKGFPIYRLEAKFDRN------------
TRMB_STRT2      ------------------YEGNVMTEYERKFSEKGQAIYRVEAQFKD-------------
TRMB_STRTD      ------------------YEGNVMTEYERKFSEKGQAIYRVEAQFKD-------------
TRMB_STRT1      ------------------YEGNVMTEYERKFSEKGQAIYRVEAQFKD-------------
TRMB_STRA1      ------------------YQQNIMTEYERKFSNKGQVIYRVEARF---------------
TRMB_STRA5      ------------------YQQNIMTEYERKFSNKGQVIYRVEARF---------------
TRMB_STRA3      ------------------YQQNIMTEYERKFSNKGQVIYRVEARF---------------
TRMB_STRP3      ------------------YEGNVMTEYEEKFSNKGQVIYRVEANF---------------
TRMB_STRPB      ------------------YEGNVMTEYEEKFSNKGQVIYRVEANF---------------
TRMB_STRPF      ------------------YEGNVMTEYEEKFSNKGQVIYRVEANF---------------
TRMB_STRPM      ------------------YEGNVMTEYEEKFSNKGQVIYRVEANF---------------
TRMB_STRPC      ------------------YEGNVMTEYEEKFSNKGQVIYRVEANF---------------
TRMB_STRP1      ------------------YEGNVMTEYEEKFSNKGQVIYRVEANF---------------
TRMB_STRPD      ------------------YEGNVMTEYEEKFSNKGQVIYRVEANF---------------
TRMB_STRPG      ------------------YEGNVMTEYEEKFSNKGQVIYRVEANF---------------
TRMB_STRP8      ------------------YEGNVMTEYEEKFSNKGQVIYRVEANF---------------
TRMB_STRP6      ------------------YEGNVMTEYEEKFSNKGQVIYRVEANF---------------
TRMB_STRSY      ------------------LEGNVMTEYEEKFSNKGQVIYRVEAQFQ--------------
TRMB_STRS2      ------------------LEGNVMTEYEEKFSNKGQVIYRVEAQFQ--------------
TRMB_STRMU      ------------------YENNVMTEYEEKFSQKGQVIYRVEARF---------------
TRMB_STRSV      ------------------FEDNVLTEYEQKFANKGQVIYRVEAAFE--------------
TRMB_STRGC      ------------------FEGNVLTEYEQKFSSKGQVIYRVEAVFQ--------------
TRMB_STRR6      ------------------FEGNVMTEYEQKFSNKGQVIYRVEAEF---------------
TRMB_STRPN      ------------------FEGNVMTEYEQKFSNKGQVIYRVEAEF---------------
TRMB_STRP2      ------------------FEGNVMTEYEQKFSNKGQVIYRVEAEF---------------
TRMB_LACLM      ------------------APQNVMTEYEQKFSQKGQVIYRLEAKFLPKK-----------
TRMB_LACLA      ------------------APQNVMTEYEQKFSQKGQVIYRLEAKFLPKK-----------
TRMB_LACLS      ------------------APQNVMTEYEQKFSQKGQVIYRLEAKFLPKK-----------
TRMB_ENTFA      ------------------FEGNIMTEYEEKFSSRGQRIYRVEARFVAK------------
TRMB_BACHD      ------------------FEGNIKTEYEEKFAKKGMRIYRCEAQFRTNEESHNL------
TRMB_BACSK      ------------------MEENVMTEYEEKFSAKGMPIYRLEATFRP-------------
TRMB_OCEIH      ------------------DETNVMTEYEEKFSTKGQPIYRCKAAFEK-------------
TRMB_STAES      ------------------DEDNIVTEYEKKFSEKGSRIYRMEAKFHKCFE----------
TRMB_STAEQ      ------------------DEDNIVTEYEKKFSEKGSRIYRMEAKFHKCFE----------
TRMB_STAHJ      ------------------DEDNILTEYEKKFSEKGSRIYRMEAKFHKSI-----------
TRMB_STAA3      ------------------DGSNILTEYEKKFSDKGSRIYRMEAKFHSQK-----------
TRMB_STAA8      ------------------DGSNILTEYEKKFSDKGSRIYRMEAKFHSQK-----------
TRMB_STAAB      ------------------DGSNILTEYEKKFSDKGSRIYRMEAKFHSQK-----------
TRMB_STAAC      ------------------DGSNILTEYEKKFSDKGSRIYRMEAKFHSQK-----------
TRMB_STAAS      ------------------DGSNILTEYEKKFSNKGSRIYRMEAKFHSQK-----------
TRMB_STAAW      ------------------DGSNILTEYEKKFSNKGSRIYRMEAKFHSQK-----------
TRMB_STAAM      ------------------DGSNILTEYEKKFSDKGSRIYRMEAKFHSQK-----------
TRMB_STAAN      ------------------DGSNILTEYEKKFSDKGSRIYRMEAKFHSQK-----------
TRMB_STAAR      ------------------DGSNILTEYEKKFSDKGSRIYRMEAKFHSQK-----------
TRMB_STAS1      ------------------DEENIETEYERKFSDKGSRIYRMEAKFH--------------
TRMB_LACRD      ------------------NEHNVETEYEQKFAAKGQPIYKLIANFK--------------
TRMB_PEDPA      ------------------NEDNVETEYEHKFSAKGQPIYKLKAHF---------------
TRMB_LACPL      ------------------PEDNVETEYEQKFSAAG-PIYKIIATFPAK------------
TRMB_LACS1      ------------------AEDNVMTEYEEKFSKKGQPIFKLEAHF---------------
TRMB_LACSS      ------------------AEDNIQTEYEEKFSKRGQVIYRLEAHYK--------------
TRMB_LACP3      ------------------VTDNVPTEYEEKFSADGGRIYELVAHFKH-------------
TRMB_LACBA      ------------------GVEDIQTEYEQKFSKKG-PIYQVIAHFPTNN-----------
TRMB_LACJO      ------------------FERNVETEYEHKFAAKGNPIYCLHAHFVK-------------
TRMB_LACGA      ------------------LERNVETEYEHKFAAKGNPIYCLHAHFE--------------
TRMB_LACDA      ------------------VEKNVETEYEHKFASKGQPIYCLHAGFLAK------------
TRMB_LACDB      ------------------VEKNVETEYEHKFASKGQPIYCLHAGFLAK------------
TRMB_LACAC      ------------------VEKNIETEYEHKFAAKGNPIYALHAHFETK------------
TRMB_LACH4      ------------------VEKNIETEYEHKFAAKGNPIYALHADFEA-------------
TRMB_LEUMM      ------------------VQGNVETEYEQKFMAKGQPIYKIKAHF---------------
TRMB_OENOB      ------------------NPVNIETEYEKKFAEMNQPEYWIRVNF---------------
TRMB_LACP7      -------------------EGNIMTEYEERFSSMGNPIHRLVAFREKE------------
TRMB_CLOD6      -------------------ENNVTTEYEDKFMSQGMRIFRCEAKKRN-------------
TRMB_ALKOO      -------------------KEIAKTEYEEKFIAEGKPIYKCIARIE--------------
TRMB_ALKMQ      -------------------KDPFMTEYEEKFVKAGKTIYKCIATV---------------
TRMB_CLOPS      -------------------EYNVVTEHEEMFSKQGIKIKFLIAKKL--------------
TRMB_CLOP1      -------------------EYNVVTEHEEMFSKQGIKIKFLIAKKL--------------
TRMB_CLOPE      -------------------EYNVVTEHEEMFSKQGIKIKFLIAKKL--------------
TRMB_CLOB8      -------------------EGNVQTEHEKMFSEQGIKIKFLIAMKDN-------------
TRMB_HUNT2      -------------------EGNIETEHERMFLEQGCKIKFLIAEKK--------------
TRMB_CLOTE      -------------------KDNIMTEYETKFTSMGMKTMFLIAKLK--------------
TRMB_CLOK5      -------------------TDNVVTEYEEKFTNLGMKTMFLIARIV--------------
TRMB_CLOAB      -------------------DKNIVTEYESKFLKLGINIKFLIAELK--------------
TRMB_CLONN      -------------------DENLMTEYETKFKEKGIKSKFLIAKLK--------------
TRMB_DESHY      -------------------TENIKTEYEEKFSNQGVKIKFGIFVVNKGRQN---------
TRMB_MYCGE      ------------------SFQNSITEYEQRFMELEIPIKKLVIKKII-------------
TRMB_MYCPN      ------------------TSTNIMTEYEQRFVSLGVKIKKLTLEKLN-------------
TRMB_UREPA      ------------------LLKNIPTEYEKKFVMQGERIKKVNFRFLKNNQ----------
TRMB_UREP2      ------------------LLKNIPTEYEKKFVMQGERIKKVNFRFLKNNQ----------
TRMB_MYCCT      ------------------LKDNVPTEYETKFHLANKNIYKIVIKNLK-------------
TRMB_MYCMS      ------------------LKDNIPTEYETKFHLANKNIYKIVIKNLK-------------
TRMB_MESFL      ------------------LKNNIPTEYETKFHTAGKNINKLIIKKTF-------------
TRMB_MYCGA      ------------------LKNNVITEYEQRFINLKKNINKIVFKFI--------------
TRMB_MYCPE      ------------------AKDNIQTEYERKWSNRGYKINKLVIKNNISQ-----------
TRMB_MYCPU      ------------------AKDNVKTSYEQKFVSLGKNINFVEFSFKK-------------
TRMB_MYCHP      ------------------KIENVFTDYEEKFNKLNKNINFIAFTFN--------------
TRMB_MYCH2      ------------------NSSNIKTTYEEKWVNLNYKIHYLEAIFI--------------
TRMB_MYCH7      ------------------NSSNIKTTYEEKWVNLNYKIHYLEAIFI--------------
TRMB_MYCHJ      ------------------NSSNIKTTYEEKWVNLNYKIHYLEAIFI--------------
TRMB_MYCMO      ------------------NLDNEMTDYEKKWSSLGKSINYLEASF---------------
TRMB_MYCS5      ------------------NETNIKTGYEIKWMDKTK-INFLIASKGENA-----------
TRMB_BACFR      ------------------DILGIKTYYEQQWLDRGLSIKYIKFLLPQ-EGELREPDIEIE
TRMB_BACFN      ------------------DILGIKTYYEQQWLDRGLSIKYIKFLLPQ-EGELREPDIEIE
TRMB_BACTN      ------------------DILSIKTYYEQQWLDRGLNIKYIKFRLPQ-EGVLQEPDVEIE
TRMB_PORGI      ------------------EILGIRTYYEQQWLERGLTIKYISFGLGEPDCEYREPDIEIE
TRMB_GRAFK      ------------------EVTGIQTFYENQYLENGKPITYIRFKIK--------------
TRMB_CYTH3      ------------------EHYGIQTTYEKTYLNQGVQINYLKFEFLPL------------
TRMB_CHLSY      ------------------VF---ESHYHRRWAARGRTISGLRIERVMED-----------
TRMB_CHLAA      ------------------VF---ESHYHRRWAARGRTISGLRIERVMED-----------
TRMB_CHLAD      ------------------VF---ESHYHRRWAARGREIRGLRIERIAEE-----------
TRMB_CHLT3      ------------------LEPDEKSYYHKYWDAQGR--EKFRFILVKK------------
TRMB_RUBXD      ------------------FDPPVKSRFQKMWERRGR--TIYRFELVRP------------
TRMB_THEMA      ------------------FKRDVETRYERKWKSQGKKTFLIVARKVKNGTVKRLMEGENT
TRMB_COPPD      ------------------NEVQVGTKYEQKWVSQGKKIYKVVLRKKRHVSVPNYLDKEVI
TRMB_CHLPD      -------------------PPQFDTRFERKWLEQNFNTFFRILLKKARHIET--------
TRMB_AQUAE      ------------------NVKEPLTKYEQKWLSMGKTLYKLILRKVKEPKFVEHPEVEEV
TRMB_NEOSM      --------------------PKNASRFASKASNRIFGYKMVYDATDA-------------
TRMB_WOLPM      ------------------FTSYTLTKYHRRALKDQRKVRFFKVSVINNLQTMDQ------
TRMB_RHOBA      ---------------ESTHDLDFHTHFERRSRKMGIPVYRVCYRKRS-------------
TRMB_BDEBA      -------------------DQNFETAFEKIFLREGIKINFVRLQKI--------------
                                        .                                   

TRMB_TRIV2      ------------------------------------------------------------
TRMB_NOSS1      ------------------------------------------------------------
TRMB_MICAN      ------------------------------------------------------------
TRMB_SYNP6      ------------------------------------------------------------
TRMB_SYNE7      ------------------------------------------------------------
TRMB_TRIEI      ------------------------------------------------------------
TRMB_SYNY3      ------------------------------------------------------------
TRMB_THEEB      ------------------------------------------------------------
TRMB_SYNJA      ------------------------------------------------------------
TRMB_SYNJB      ------------------------------------------------------------
TRMB_PROMM      QQVDNPSKEEHSDC----------------------------------------------
TRMB_PROM3      QQVDNPSEEEHSDC----------------------------------------------
TRMB_SYNSC      QEIDNPAEALTT------------------------------------------------
TRMB_SYNPX      QELDNPAETVFTDI----------------------------------------------
TRMB_SYNS9      QEIDNPGNAPTPDA----------------------------------------------
TRMB_SYNS3      QQVDNSKDAAPTPHG---------------------------------------------
TRMB_SYNPW      QRVDNPANDAVPPDG---------------------------------------------
TRMB_PROMA      ------------------------------------------------------------
TRMB_PROMT      ------------------------------------------------------------
TRMB_PROM1      ------------------------------------------------------------
TRMB_PROMS      ------------------------------------------------------------
TRMB_PROM2      ------------------------------------------------------------
TRMB_PROM9      ------------------------------------------------------------
TRMB_PROMP      ------------------------------------------------------------
TRMB_PROM5      ------------------------------------------------------------
TRMB_GEOSL      ------------------------------------------------------------
TRMB_GEOMG      ------------------------------------------------------------
TRMB_PELCD      RGFRTAWSANNG------------------------------------------------
TRMB_MYXXD      ------------------------------------------------------------
TRMB_ANADE      ------------------------------------------------------------
TRMB_THET8      -DVAHALLSGELPQDL-ALEKTPVRLK-------EGVAVFLEVARG--KEGFYVLTHVEE
TRMB_THET2      -DVAHALLSGELPQDL-ALEKTAVRLK-------EGVAVFLEVARG--KEGFYVLTHVEE
TRMB_DEIGD      PAVPHAILTLPAAFDPGAFHKHTARGGQTREDPVGWTVVLLELYRSLKQDGWVMLAHVVE
TRMB_DEIRA      PAVPHAVLTLPADFSPQHFDKLTVRGK-------TWTVVLLDLYATLRRGGWVALAHVVE
TRMB_CHLAB      ------------------------------------------------------------
TRMB_CHLCV      ------------------------------------------------------------
TRMB_CHLFF      ------------------------------------------------------------
TRMB_CHLTR      ------------------------------------------------------------
TRMB_CHLTA      ------------------------------------------------------------
TRMB_CHLMU      ------------------------------------------------------------
TRMB_CHLPN      ------------------------------------------------------------
TRMB_PARUW      ------------------------------------------------------------
TRMB_LEPIN      ------------------------------------------------------------
TRMB_LEPIC      ------------------------------------------------------------
TRMB_LEPBJ      ------------------------------------------------------------
TRMB_LEPBL      ------------------------------------------------------------
TRMB_NITEU      ------------------------------------------------------------
TRMB_NITEC      ------------------------------------------------------------
TRMB_NITMU      ------------------------------------------------------------
TRMB_BURVG      ------------------------------------------------------------
TRMB_BURCM      ------------------------------------------------------------
TRMB_BURL3      ------------------------------------------------------------
TRMB_BURCH      ------------------------------------------------------------
TRMB_BURCA      ------------------------------------------------------------
TRMB_BURPS      ------------------------------------------------------------
TRMB_BURP1      ------------------------------------------------------------
TRMB_BURMA      ------------------------------------------------------------
TRMB_BURTA      ------------------------------------------------------------
TRMB_PARXL      ------------------------------------------------------------
TRMB_THIDA      ------------------------------------------------------------
TRMB_METFK      ------------------------------------------------------------
TRMB_CUPNH      ------------------------------------------------------------
TRMB_CUPPJ      ------------------------------------------------------------
TRMB_CUPMC      ------------------------------------------------------------
TRMB_RALSO      ------------------------------------------------------------
TRMB_ACISJ      ------------------------------------------------------------
TRMB_ACIAC      ------------------------------------------------------------
TRMB_VEREI      ------------------------------------------------------------
TRMB_POLSJ      ------------------------------------------------------------
TRMB_POLNA      ------------------------------------------------------------
TRMB_RHOFT      ------------------------------------------------------------
TRMB_NEIMB      ------------------------------------------------------------
TRMB_NEIMA      ------------------------------------------------------------
TRMB_NEIMF      ------------------------------------------------------------
TRMB_NEIM0      ------------------------------------------------------------
TRMB_NEIG1      ------------------------------------------------------------
TRMB_CHRVO      ------------------------------------------------------------
TRMB_AZOSB      ------------------------------------------------------------
TRMB_AROAE      ------------------------------------------------------------
TRMB_DECAR      ------------------------------------------------------------
TRMB_BORBR      ------------------------------------------------------------
TRMB_BORPA      ------------------------------------------------------------
TRMB_BORPE      ------------------------------------------------------------
TRMB_BORA1      ------------------------------------------------------------
TRMB_NITOC      ------------------------------------------------------------
TRMB_ALKEH      ------------------------------------------------------------
TRMB_HALHL      ------------------------------------------------------------
TRMB_LEIXX      ------------------------------------------------------------
TRMB_XYLFA      ------------------------------------------------------------
TRMB_XYLFT      ------------------------------------------------------------
TRMB_XANC5      DNPQRPQFSLCQFPIPDSPFPAPNGHRADADQRYEARPRAGRFHDGDVPVRAHSRRRGGI
TRMB_XANAC      ---------------SQEQLPSASG-----------------------------------
TRMB_XANOM      ------------------------------------------------------------
TRMB_XANOR      ------------------------------------------------------------
TRMB_XANCP      ---------------SPGQAPAAPG-----------------------------------
TRMB_XANC8      ---------------SPGQAPAAPG-----------------------------------
TRMB_METCA      ------------------------------------------------------------
TRMB_STRAW      EAD---------------------------------------------------------
TRMB_STRCO      ------------------------------------------------------------
TRMB_SHESM      ------------------------------------------------------------
TRMB_SHESA      ------------------------------------------------------------
TRMB_SHESR      ------------------------------------------------------------
TRMB_SHEON      ------------------------------------------------------------
TRMB_SHEPC      ------------------------------------------------------------
TRMB_SHESW      ------------------------------------------------------------
TRMB_SHEB8      ------------------------------------------------------------
TRMB_SHEB5      ------------------------------------------------------------
TRMB_SHEB9      ------------------------------------------------------------
TRMB_SHEFN      ------------------------------------------------------------
TRMB_SHEDO      ------------------------------------------------------------
TRMB_SHEHH      ------------------------------------------------------------
TRMB_SHEPA      ------------------------------------------------------------
TRMB_SHESH      ------------------------------------------------------------
TRMB_SHEAM      ------------------------------------------------------------
TRMB_VIBPA      ------------------------------------------------------------
TRMB_VIBCB      ------------------------------------------------------------
TRMB_VIBVY      ------------------------------------------------------------
TRMB_VIBVU      ------------------------------------------------------------
TRMB_VIBCH      ------------------------------------------------------------
TRMB_VIBC3      ------------------------------------------------------------
TRMB_PHOPR      ------------------------------------------------------------
TRMB_AERHH      ------------------------------------------------------------
TRMB_PSEA6      ------------------------------------------------------------
TRMB_PSEHT      ------------------------------------------------------------
TRMB_COLP3      ------------------------------------------------------------
TRMB_PSYIN      ------------------------------------------------------------
TRMB_SALCH      ------------------------------------------------------------
TRMB_SALPA      ------------------------------------------------------------
TRMB_SALTI      ------------------------------------------------------------
TRMB_SALAR      ------------------------------------------------------------
TRMB_SALTY      ------------------------------------------------------------
TRMB_ECOL6      ------------------------------------------------------------
TRMB_ECOUT      ------------------------------------------------------------
TRMB_ECOK1      ------------------------------------------------------------
TRMB_ECOL5      ------------------------------------------------------------
TRMB_ECOHS      ------------------------------------------------------------
TRMB_ECO57      ------------------------------------------------------------
TRMB_ECOLC      ------------------------------------------------------------
TRMB_SHISS      ------------------------------------------------------------
TRMB_ECO24      ------------------------------------------------------------
TRMB_SHIFL      ------------------------------------------------------------
TRMB_ECOLI      ------------------------------------------------------------
TRMB_SHIF8      ------------------------------------------------------------
TRMB_SHIDS      ------------------------------------------------------------
TRMB_SHIBS      ------------------------------------------------------------
TRMB_KLEP7      ------------------------------------------------------------
TRMB_CROS8      ------------------------------------------------------------
TRMB_YERPE      ------------------------------------------------------------
TRMB_YERPP      ------------------------------------------------------------
TRMB_YERPA      ------------------------------------------------------------
TRMB_YERPN      ------------------------------------------------------------
TRMB_YERP3      ------------------------------------------------------------
TRMB_YERPS      ------------------------------------------------------------
TRMB_YERE8      ------------------------------------------------------------
TRMB_SERP5      ------------------------------------------------------------
TRMB_PECAS      ------------------------------------------------------------
TRMB_PHOLL      ------------------------------------------------------------
TRMB_SODGM      ------------------------------------------------------------
TRMB_IDILO      ------------------------------------------------------------
TRMB_ACTP2      ------------------------------------------------------------
TRMB_HAEDU      ------------------------------------------------------------
TRMB_HAES1      ------------------------------------------------------------
TRMB_HISS2      ------------------------------------------------------------
TRMB_MANSM      ------------------------------------------------------------
TRMB_HAEI8      ------------------------------------------------------------
TRMB_HAEIN      ------------------------------------------------------------
TRMB_HAEIG      ------------------------------------------------------------
TRMB_HAEIE      ------------------------------------------------------------
TRMB_PASMU      ------------------------------------------------------------
TRMB_ACTSZ      ------------------------------------------------------------
TRMB_HAHCH      ------------------------------------------------------------
TRMB_MARHV      ------------------------------------------------------------
TRMB_SACD2      ------------------------------------------------------------
TRMB_ALCBS      ------------------------------------------------------------
TRMB_PSEPK      ------------------------------------------------------------
TRMB_PSEPG      ------------------------------------------------------------
TRMB_PSEP1      ------------------------------------------------------------
TRMB_PSEE4      ------------------------------------------------------------
TRMB_PSEPF      ------------------------------------------------------------
TRMB_PSEF5      ------------------------------------------------------------
TRMB_PSEU2      ------------------------------------------------------------
TRMB_PSE14      ------------------------------------------------------------
TRMB_PSESM      ------------------------------------------------------------
TRMB_PSEAE      ------------------------------------------------------------
TRMB_PSEA7      ------------------------------------------------------------
TRMB_PSEAB      ------------------------------------------------------------
TRMB_PSEMY      ------------------------------------------------------------
TRMB_PSEU5      ------------------------------------------------------------
TRMB_CHRSD      ------------------------------------------------------------
TRMB_HYDCU      ------------------------------------------------------------
TRMB_LEGPA      ------------------------------------------------------------
TRMB_LEGPH      ------------------------------------------------------------
TRMB_LEGPL      ------------------------------------------------------------
TRMB_LEGPC      ------------------------------------------------------------
TRMB_FRATF      ------------------------------------------------------------
TRMB_FRATN      ------------------------------------------------------------
TRMB_FRATO      ------------------------------------------------------------
TRMB_FRAP2      ------------------------------------------------------------
TRMB_TREDE      ------------------------------------------------------------
TRMB_TREPA      ------------------------------------------------------------
TRMB_BUCAI      ------------------------------------------------------------
TRMB_BUCAP      ------------------------------------------------------------
TRMB_BUCBP      ------------------------------------------------------------
TRMB_NOCFA      ------------------------------------------------------------
TRMB_RHOJR      ------------------------------------------------------------
TRMB_MYCSK      ------------------------------------------------------------
TRMB_MYCSS      ------------------------------------------------------------
TRMB_MYCGI      ------------------------------------------------------------
TRMB_MYCVP      ------------------------------------------------------------
TRMB_MYCBP      ------------------------------------------------------------
TRMB_MYCTU      ------------------------------------------------------------
TRMB_MYCBO      ------------------------------------------------------------
TRMB_MYCUA      ------------------------------------------------------------
TRMB_MYCA1      ------------------------------------------------------------
TRMB_MYCPA      ------------------------------------------------------------
TRMB_MYCLE      ------------------------------------------------------------
TRMB_CORGB      ------------------------------------------------------------
TRMB_CORGL      ------------------------------------------------------------
TRMB_COREF      ------------------------------------------------------------
TRMB_CORDI      ------------------------------------------------------------
TRMB_CORJK      ------------------------------------------------------------
TRMB_CUTAK      ------------------------------------------------------------
TRMB_NOCSJ      ------------------------------------------------------------
TRMB_PAEAT      ------------------------------------------------------------
TRMB_ARTS2      ------------------------------------------------------------
TRMB_BIFAA      ------------------------------------------------------------
TRMB_BIFLO      ------------------------------------------------------------
TRMB_PSYCK      ------------------------------------------------------------
TRMB_PSYA2      ------------------------------------------------------------
TRMB_ACIAD      ------------------------------------------------------------
TRMB_RHIME      ------------------------------------------------------------
TRMB_SINMW      ------------------------------------------------------------
TRMB_RHIEC      ------------------------------------------------------------
TRMB_RHIL3      ------------------------------------------------------------
TRMB_AGRFC      ------------------------------------------------------------
TRMB_RHILO      ------------------------------------------------------------
TRMB_BRUAB      ------------------------------------------------------------
TRMB_BRUA2      ------------------------------------------------------------
TRMB_BRUME      ------------------------------------------------------------
TRMB_BRUSU      ------------------------------------------------------------
TRMB_OCHA4      ------------------------------------------------------------
TRMB_CHESB      ------------------------------------------------------------
TRMB_BARQU      ------------------------------------------------------------
TRMB_BARHE      ------------------------------------------------------------
TRMB_BARBK      ------------------------------------------------------------
TRMB_AZOC5      ------------------------------------------------------------
TRMB_RHOPS      ------------------------------------------------------------
TRMB_RHOP2      ------------------------------------------------------------
TRMB_RHOPA      ------------------------------------------------------------
TRMB_NITHX      ------------------------------------------------------------
TRMB_NITWN      ------------------------------------------------------------
TRMB_RHOP5      ------------------------------------------------------------
TRMB_RHOPB      ------------------------------------------------------------
TRMB_BRADU      ------------------------------------------------------------
TRMB_RUEST      ------------------------------------------------------------
TRMB_RUEPO      ------------------------------------------------------------
TRMB_ROSDO      ------------------------------------------------------------
TRMB_JANSC      ------------------------------------------------------------
TRMB_PARDP      ------------------------------------------------------------
TRMB_RHOS4      ------------------------------------------------------------
TRMB_RHORT      GEGADNNP----------------------------------------------------
TRMB_MAGSA      ------------------------------------------------------------
TRMB_GRABC      ------------------------------------------------------------
TRMB_NOVAD      ------------------------------------------------------------
TRMB_SPHAL      ------------------------------------------------------------
TRMB_ERYLH      ------------------------------------------------------------
TRMB_ZYMMO      ------------------------------------------------------------
TRMB_CAUVC      ------------------------------------------------------------
TRMB_CAUSK      ------------------------------------------------------------
TRMB_MARMM      ------------------------------------------------------------
TRMB_HYPNA      ------------------------------------------------------------
TRMB_MAGMM      ------------------------------------------------------------
TRMB_HELPY      FDFSFDTITISK---KSVGTILKTKKIIQEGYFVHVCNIYENK-----GDFLVELSMGDF
TRMB_HELPH      FDFSFDTITMSE---KSVGTILKTKKIIQEGYFVHVCNIYENK-----GDFLVELSMGDF
TRMB_HELPJ      LDFSFDTITIDK---ESVGAILKTPKIIKEGYFVHVCNIYENK-----GDFLVELSMGDF
TRMB_HELAH      FDFSFDTITLNQ---KSVGMILKTPKIIKEGYFVHVCNIYENK-----GDFLVELSMGDF
TRMB_WOLSU      SDFSFKPLKRCD---AAELR-----REIREGWFASIERLYRSKDG---KSMAIRSSFGDF
TRMB_HELHP      KNFYFDKILRKN---LDNYKNF-PHKKIANDWFLHIDNLYCA--G---DIYVLALCFGDF
TRMB_CAMJE      NEFNLSSVEFSKEDLKKIEQNFKNITIKKDDFFLHFESIYKQDEN-----LLLKVAFGAF
TRMB_CAMJR      NEFNLSSVEFSKEDLKKIEQNFKNITIKKDDFFLHFESIYKQDEN-----LLLKVAFGAF
TRMB_CAMJ8      NEFNLSSVEFSKEDLKKIEQNFKNITIKKDDFFLHFESIYKQDEN-----LLLKVAFGAF
TRMB_CAMJJ      NEFNLSSVEFSKEDLKKIEQNFKNITIKKDDFFLHFESIYKQDEN-----LLLKVAFGAF
TRMB_CAMJD      NEFNLSSVEFSKEDLKKIEQNFKNITIKKDDFFLHFESIYKQDEN-----LLLKVAFGAF
TRMB_CAMFF      GDFEFGTVLE-----EDILSKFENKTIKKDDYFIHMERIYKKDSSEKNGGLLLRVAFGSF
TRMB_SULDN      GDFNFSHVKLN----TQEVINLYKKTQKFDSGFINFERSYFLDDG-----AMLRVSMGNF
TRMB_GEOTN      ------------------------------------------------------------
TRMB_GEOKA      ------------------------------------------------------------
TRMB_BACHK      ------------------------------------------------------------
TRMB_BACC1      ------------------------------------------------------------
TRMB_BACAN      ------------------------------------------------------------
TRMB_BACCZ      ------------------------------------------------------------
TRMB_BACCR      ------------------------------------------------------------
TRMB_BACAH      ------------------------------------------------------------
TRMB_BACCN      ------------------------------------------------------------
TRMB_BACSU      ------------------------------------------------------------
TRMB_BACVZ      ------------------------------------------------------------
TRMB_BACLD      ------------------------------------------------------------
TRMB_LISIN      ------------------------------------------------------------
TRMB_LISW6      ------------------------------------------------------------
TRMB_LISMO      ------------------------------------------------------------
TRMB_LISMF      ------------------------------------------------------------
TRMB_STRT2      ------------------------------------------------------------
TRMB_STRTD      ------------------------------------------------------------
TRMB_STRT1      ------------------------------------------------------------
TRMB_STRA1      ------------------------------------------------------------
TRMB_STRA5      ------------------------------------------------------------
TRMB_STRA3      ------------------------------------------------------------
TRMB_STRP3      ------------------------------------------------------------
TRMB_STRPB      ------------------------------------------------------------
TRMB_STRPF      ------------------------------------------------------------
TRMB_STRPM      ------------------------------------------------------------
TRMB_STRPC      ------------------------------------------------------------
TRMB_STRP1      ------------------------------------------------------------
TRMB_STRPD      ------------------------------------------------------------
TRMB_STRPG      ------------------------------------------------------------
TRMB_STRP8      ------------------------------------------------------------
TRMB_STRP6      ------------------------------------------------------------
TRMB_STRSY      ------------------------------------------------------------
TRMB_STRS2      ------------------------------------------------------------
TRMB_STRMU      ------------------------------------------------------------
TRMB_STRSV      ------------------------------------------------------------
TRMB_STRGC      ------------------------------------------------------------
TRMB_STRR6      ------------------------------------------------------------
TRMB_STRPN      ------------------------------------------------------------
TRMB_STRP2      ------------------------------------------------------------
TRMB_LACLM      ------------------------------------------------------------
TRMB_LACLA      ------------------------------------------------------------
TRMB_LACLS      ------------------------------------------------------------
TRMB_ENTFA      ------------------------------------------------------------
TRMB_BACHD      ------------------------------------------------------------
TRMB_BACSK      ------------------------------------------------------------
TRMB_OCEIH      ------------------------------------------------------------
TRMB_STAES      ------------------------------------------------------------
TRMB_STAEQ      ------------------------------------------------------------
TRMB_STAHJ      ------------------------------------------------------------
TRMB_STAA3      ------------------------------------------------------------
TRMB_STAA8      ------------------------------------------------------------
TRMB_STAAB      ------------------------------------------------------------
TRMB_STAAC      ------------------------------------------------------------
TRMB_STAAS      ------------------------------------------------------------
TRMB_STAAW      ------------------------------------------------------------
TRMB_STAAM      ------------------------------------------------------------
TRMB_STAAN      ------------------------------------------------------------
TRMB_STAAR      ------------------------------------------------------------
TRMB_STAS1      ------------------------------------------------------------
TRMB_LACRD      ------------------------------------------------------------
TRMB_PEDPA      ------------------------------------------------------------
TRMB_LACPL      ------------------------------------------------------------
TRMB_LACS1      ------------------------------------------------------------
TRMB_LACSS      ------------------------------------------------------------
TRMB_LACP3      ------------------------------------------------------------
TRMB_LACBA      ------------------------------------------------------------
TRMB_LACJO      ------------------------------------------------------------
TRMB_LACGA      ------------------------------------------------------------
TRMB_LACDA      ------------------------------------------------------------
TRMB_LACDB      ------------------------------------------------------------
TRMB_LACAC      ------------------------------------------------------------
TRMB_LACH4      ------------------------------------------------------------
TRMB_LEUMM      ------------------------------------------------------------
TRMB_OENOB      ------------------------------------------------------------
TRMB_LACP7      ------------------------------------------------------------
TRMB_CLOD6      ------------------------------------------------------------
TRMB_ALKOO      ------------------------------------------------------------
TRMB_ALKMQ      ------------------------------------------------------------
TRMB_CLOPS      ------------------------------------------------------------
TRMB_CLOP1      ------------------------------------------------------------
TRMB_CLOPE      ------------------------------------------------------------
TRMB_CLOB8      ------------------------------------------------------------
TRMB_HUNT2      ------------------------------------------------------------
TRMB_CLOTE      ------------------------------------------------------------
TRMB_CLOK5      ------------------------------------------------------------
TRMB_CLOAB      ------------------------------------------------------------
TRMB_CLONN      ------------------------------------------------------------
TRMB_DESHY      ------------------------------------------------------------
TRMB_MYCGE      ------------------------------------------------------------
TRMB_MYCPN      ------------------------------------------------------------
TRMB_UREPA      ------------------------------------------------------------
TRMB_UREP2      ------------------------------------------------------------
TRMB_MYCCT      ------------------------------------------------------------
TRMB_MYCMS      ------------------------------------------------------------
TRMB_MESFL      ------------------------------------------------------------
TRMB_MYCGA      ------------------------------------------------------------
TRMB_MYCPE      ------------------------------------------------------------
TRMB_MYCPU      ------------------------------------------------------------
TRMB_MYCHP      ------------------------------------------------------------
TRMB_MYCH2      ------------------------------------------------------------
TRMB_MYCH7      ------------------------------------------------------------
TRMB_MYCHJ      ------------------------------------------------------------
TRMB_MYCMO      ------------------------------------------------------------
TRMB_MYCS5      ------------------------------------------------------------
TRMB_BACFR      LDSYRSYNRSKRSGLQTSK-----------------------------------------
TRMB_BACFN      LDSYRSYNRSKRSGLQTSK-----------------------------------------
TRMB_BACTN      LDPYRSYNRSKRSGLQTSK-----------------------------------------
TRMB_PORGI      PDSYRSYNRSRRSQAVPS------------------------------------------
TRMB_GRAFK      ------------------------------------------------------------
TRMB_CYTH3      ------------------------------------------------------------
TRMB_CHLSY      ------------------------------------------------------------
TRMB_CHLAA      ------------------------------------------------------------
TRMB_CHLAD      ------------------------------------------------------------
TRMB_CHLT3      ------------------------------------------------------------
TRMB_RUBXD      ------------------------------------------------------------
TRMB_THEMA      MAHSVFEGNVTWEKLKELEGKVFKDKNKIFVVKKVYRDGDYLLKVISTDEGGFQQVYYLN
TRMB_COPPD      MPHAIVHDSHGTLKAGTYRTTFGTIKLWEPFSNNQAMLLIPAIVSDDDFIGVSLQQRVYI
TRMB_CHLPD      ------------------------------------------------------------
TRMB_AQUAE      RELFPVKVKVESVDPKKIESREIKLDEEVYFKTFKVWQRDKDFLVECLLSEKGYLQKFFI
TRMB_NEOSM      ------------------------------------------------------------
TRMB_WOLPM      ------------------------------------------------------------
TRMB_RHOBA      ------------------------------------------------------------
TRMB_BDEBA      ------------------------------------------------------------
                                                                            

TRMB_TRIV2      ----------------------------------------------------------
TRMB_NOSS1      ----------------------------------------------------------
TRMB_MICAN      ----------------------------------------------------------
TRMB_SYNP6      ----------------------------------------------------------
TRMB_SYNE7      ----------------------------------------------------------
TRMB_TRIEI      ----------------------------------------------------------
TRMB_SYNY3      ----------------------------------------------------------
TRMB_THEEB      ----------------------------------------------------------
TRMB_SYNJA      ----------------------------------------------------------
TRMB_SYNJB      ----------------------------------------------------------
TRMB_PROMM      ----------------------------------------------------------
TRMB_PROM3      ----------------------------------------------------------
TRMB_SYNSC      ----------------------------------------------------------
TRMB_SYNPX      ----------------------------------------------------------
TRMB_SYNS9      ----------------------------------------------------------
TRMB_SYNS3      ----------------------------------------------------------
TRMB_SYNPW      ----------------------------------------------------------
TRMB_PROMA      ----------------------------------------------------------
TRMB_PROMT      ----------------------------------------------------------
TRMB_PROM1      ----------------------------------------------------------
TRMB_PROMS      ----------------------------------------------------------
TRMB_PROM2      ----------------------------------------------------------
TRMB_PROM9      ----------------------------------------------------------
TRMB_PROMP      ----------------------------------------------------------
TRMB_PROM5      ----------------------------------------------------------
TRMB_GEOSL      ----------------------------------------------------------
TRMB_GEOMG      ----------------------------------------------------------
TRMB_PELCD      ----------------------------------------------------------
TRMB_MYXXD      ----------------------------------------------------------
TRMB_ANADE      ----------------------------------------------------------
TRMB_THET8      EDLTQDLLLEVRKSARGVY-AGVSRFGSPLITEAVKGAVRALVDRLEAHGLEVVQDHT
TRMB_THET2      EDLTQDLLLEVRKSARGVY-AGVSRFGSPLITEAVKGAVRALVDRLEAHGLEVVQDHT
TRMB_DEIGD      GELTQEVLIGISARGDGSHLVRLASFGGPIITPGVKAAVGVVTDWLEEQGAAVRHRGY
TRMB_DEIRA      GDLTQEVLVGITEREDGTHLVRLAKFGGPIITPGVKAAVGAVTEWLEGQGAVVKHRGY
TRMB_CHLAB      ----------------------------------------------------------
TRMB_CHLCV      ----------------------------------------------------------
TRMB_CHLFF      ----------------------------------------------------------
TRMB_CHLTR      ----------------------------------------------------------
TRMB_CHLTA      ----------------------------------------------------------
TRMB_CHLMU      ----------------------------------------------------------
TRMB_CHLPN      ----------------------------------------------------------
TRMB_PARUW      ----------------------------------------------------------
TRMB_LEPIN      ----------------------------------------------------------
TRMB_LEPIC      ----------------------------------------------------------
TRMB_LEPBJ      ----------------------------------------------------------
TRMB_LEPBL      ----------------------------------------------------------
TRMB_NITEU      ----------------------------------------------------------
TRMB_NITEC      ----------------------------------------------------------
TRMB_NITMU      ----------------------------------------------------------
TRMB_BURVG      ----------------------------------------------------------
TRMB_BURCM      ----------------------------------------------------------
TRMB_BURL3      ----------------------------------------------------------
TRMB_BURCH      ----------------------------------------------------------
TRMB_BURCA      ----------------------------------------------------------
TRMB_BURPS      ----------------------------------------------------------
TRMB_BURP1      ----------------------------------------------------------
TRMB_BURMA      ----------------------------------------------------------
TRMB_BURTA      ----------------------------------------------------------
TRMB_PARXL      ----------------------------------------------------------
TRMB_THIDA      ----------------------------------------------------------
TRMB_METFK      ----------------------------------------------------------
TRMB_CUPNH      ----------------------------------------------------------
TRMB_CUPPJ      ----------------------------------------------------------
TRMB_CUPMC      ----------------------------------------------------------
TRMB_RALSO      ----------------------------------------------------------
TRMB_ACISJ      ----------------------------------------------------------
TRMB_ACIAC      ----------------------------------------------------------
TRMB_VEREI      ----------------------------------------------------------
TRMB_POLSJ      ----------------------------------------------------------
TRMB_POLNA      ----------------------------------------------------------
TRMB_RHOFT      ----------------------------------------------------------
TRMB_NEIMB      ----------------------------------------------------------
TRMB_NEIMA      ----------------------------------------------------------
TRMB_NEIMF      ----------------------------------------------------------
TRMB_NEIM0      ----------------------------------------------------------
TRMB_NEIG1      ----------------------------------------------------------
TRMB_CHRVO      ----------------------------------------------------------
TRMB_AZOSB      ----------------------------------------------------------
TRMB_AROAE      ----------------------------------------------------------
TRMB_DECAR      ----------------------------------------------------------
TRMB_BORBR      ----------------------------------------------------------
TRMB_BORPA      ----------------------------------------------------------
TRMB_BORPE      ----------------------------------------------------------
TRMB_BORA1      ----------------------------------------------------------
TRMB_NITOC      ----------------------------------------------------------
TRMB_ALKEH      ----------------------------------------------------------
TRMB_HALHL      ----------------------------------------------------------
TRMB_LEIXX      ----------------------------------------------------------
TRMB_XYLFA      ----------------------------------------------------------
TRMB_XYLFT      ----------------------------------------------------------
TRMB_XANC5      DRAGGLGRHRTGGAGRIVRRFLR-----------------------------------
TRMB_XANAC      ----------------------------------------------------------
TRMB_XANOM      ----------------------------------------------------------
TRMB_XANOR      ----------------------------------------------------------
TRMB_XANCP      ----------------------------------------------------------
TRMB_XANC8      ----------------------------------------------------------
TRMB_METCA      ----------------------------------------------------------
TRMB_STRAW      ----------------------------------------------------------
TRMB_STRCO      ----------------------------------------------------------
TRMB_SHESM      ----------------------------------------------------------
TRMB_SHESA      ----------------------------------------------------------
TRMB_SHESR      ----------------------------------------------------------
TRMB_SHEON      ----------------------------------------------------------
TRMB_SHEPC      ----------------------------------------------------------
TRMB_SHESW      ----------------------------------------------------------
TRMB_SHEB8      ----------------------------------------------------------
TRMB_SHEB5      ----------------------------------------------------------
TRMB_SHEB9      ----------------------------------------------------------
TRMB_SHEFN      ----------------------------------------------------------
TRMB_SHEDO      ----------------------------------------------------------
TRMB_SHEHH      ----------------------------------------------------------
TRMB_SHEPA      ----------------------------------------------------------
TRMB_SHESH      ----------------------------------------------------------
TRMB_SHEAM      ----------------------------------------------------------
TRMB_VIBPA      ----------------------------------------------------------
TRMB_VIBCB      ----------------------------------------------------------
TRMB_VIBVY      ----------------------------------------------------------
TRMB_VIBVU      ----------------------------------------------------------
TRMB_VIBCH      ----------------------------------------------------------
TRMB_VIBC3      ----------------------------------------------------------
TRMB_PHOPR      ----------------------------------------------------------
TRMB_AERHH      ----------------------------------------------------------
TRMB_PSEA6      ----------------------------------------------------------
TRMB_PSEHT      ----------------------------------------------------------
TRMB_COLP3      ----------------------------------------------------------
TRMB_PSYIN      ----------------------------------------------------------
TRMB_SALCH      ----------------------------------------------------------
TRMB_SALPA      ----------------------------------------------------------
TRMB_SALTI      ----------------------------------------------------------
TRMB_SALAR      ----------------------------------------------------------
TRMB_SALTY      ----------------------------------------------------------
TRMB_ECOL6      ----------------------------------------------------------
TRMB_ECOUT      ----------------------------------------------------------
TRMB_ECOK1      ----------------------------------------------------------
TRMB_ECOL5      ----------------------------------------------------------
TRMB_ECOHS      ----------------------------------------------------------
TRMB_ECO57      ----------------------------------------------------------
TRMB_ECOLC      ----------------------------------------------------------
TRMB_SHISS      ----------------------------------------------------------
TRMB_ECO24      ----------------------------------------------------------
TRMB_SHIFL      ----------------------------------------------------------
TRMB_ECOLI      ----------------------------------------------------------
TRMB_SHIF8      ----------------------------------------------------------
TRMB_SHIDS      ----------------------------------------------------------
TRMB_SHIBS      ----------------------------------------------------------
TRMB_KLEP7      ----------------------------------------------------------
TRMB_CROS8      ----------------------------------------------------------
TRMB_YERPE      ----------------------------------------------------------
TRMB_YERPP      ----------------------------------------------------------
TRMB_YERPA      ----------------------------------------------------------
TRMB_YERPN      ----------------------------------------------------------
TRMB_YERP3      ----------------------------------------------------------
TRMB_YERPS      ----------------------------------------------------------
TRMB_YERE8      ----------------------------------------------------------
TRMB_SERP5      ----------------------------------------------------------
TRMB_PECAS      ----------------------------------------------------------
TRMB_PHOLL      ----------------------------------------------------------
TRMB_SODGM      ----------------------------------------------------------
TRMB_IDILO      ----------------------------------------------------------
TRMB_ACTP2      ----------------------------------------------------------
TRMB_HAEDU      ----------------------------------------------------------
TRMB_HAES1      ----------------------------------------------------------
TRMB_HISS2      ----------------------------------------------------------
TRMB_MANSM      ----------------------------------------------------------
TRMB_HAEI8      ----------------------------------------------------------
TRMB_HAEIN      ----------------------------------------------------------
TRMB_HAEIG      ----------------------------------------------------------
TRMB_HAEIE      ----------------------------------------------------------
TRMB_PASMU      ----------------------------------------------------------
TRMB_ACTSZ      ----------------------------------------------------------
TRMB_HAHCH      ----------------------------------------------------------
TRMB_MARHV      ----------------------------------------------------------
TRMB_SACD2      ----------------------------------------------------------
TRMB_ALCBS      ----------------------------------------------------------
TRMB_PSEPK      ----------------------------------------------------------
TRMB_PSEPG      ----------------------------------------------------------
TRMB_PSEP1      ----------------------------------------------------------
TRMB_PSEE4      ----------------------------------------------------------
TRMB_PSEPF      ----------------------------------------------------------
TRMB_PSEF5      ----------------------------------------------------------
TRMB_PSEU2      ----------------------------------------------------------
TRMB_PSE14      ----------------------------------------------------------
TRMB_PSESM      ----------------------------------------------------------
TRMB_PSEAE      ----------------------------------------------------------
TRMB_PSEA7      ----------------------------------------------------------
TRMB_PSEAB      ----------------------------------------------------------
TRMB_PSEMY      ----------------------------------------------------------
TRMB_PSEU5      ----------------------------------------------------------
TRMB_CHRSD      ----------------------------------------------------------
TRMB_HYDCU      ----------------------------------------------------------
TRMB_LEGPA      ----------------------------------------------------------
TRMB_LEGPH      ----------------------------------------------------------
TRMB_LEGPL      ----------------------------------------------------------
TRMB_LEGPC      ----------------------------------------------------------
TRMB_FRATF      ----------------------------------------------------------
TRMB_FRATN      ----------------------------------------------------------
TRMB_FRATO      ----------------------------------------------------------
TRMB_FRAP2      ----------------------------------------------------------
TRMB_TREDE      ----------------------------------------------------------
TRMB_TREPA      ----------------------------------------------------------
TRMB_BUCAI      ----------------------------------------------------------
TRMB_BUCAP      ----------------------------------------------------------
TRMB_BUCBP      ----------------------------------------------------------
TRMB_NOCFA      ----------------------------------------------------------
TRMB_RHOJR      ----------------------------------------------------------
TRMB_MYCSK      ----------------------------------------------------------
TRMB_MYCSS      ----------------------------------------------------------
TRMB_MYCGI      ----------------------------------------------------------
TRMB_MYCVP      ----------------------------------------------------------
TRMB_MYCBP      ----------------------------------------------------------
TRMB_MYCTU      ----------------------------------------------------------
TRMB_MYCBO      ----------------------------------------------------------
TRMB_MYCUA      ----------------------------------------------------------
TRMB_MYCA1      ----------------------------------------------------------
TRMB_MYCPA      ----------------------------------------------------------
TRMB_MYCLE      ----------------------------------------------------------
TRMB_CORGB      ----------------------------------------------------------
TRMB_CORGL      ----------------------------------------------------------
TRMB_COREF      ----------------------------------------------------------
TRMB_CORDI      ----------------------------------------------------------
TRMB_CORJK      ----------------------------------------------------------
TRMB_CUTAK      ----------------------------------------------------------
TRMB_NOCSJ      ----------------------------------------------------------
TRMB_PAEAT      ----------------------------------------------------------
TRMB_ARTS2      ----------------------------------------------------------
TRMB_BIFAA      ----------------------------------------------------------
TRMB_BIFLO      ----------------------------------------------------------
TRMB_PSYCK      ----------------------------------------------------------
TRMB_PSYA2      ----------------------------------------------------------
TRMB_ACIAD      ----------------------------------------------------------
TRMB_RHIME      ----------------------------------------------------------
TRMB_SINMW      ----------------------------------------------------------
TRMB_RHIEC      ----------------------------------------------------------
TRMB_RHIL3      ----------------------------------------------------------
TRMB_AGRFC      ----------------------------------------------------------
TRMB_RHILO      ----------------------------------------------------------
TRMB_BRUAB      ----------------------------------------------------------
TRMB_BRUA2      ----------------------------------------------------------
TRMB_BRUME      ----------------------------------------------------------
TRMB_BRUSU      ----------------------------------------------------------
TRMB_OCHA4      ----------------------------------------------------------
TRMB_CHESB      ----------------------------------------------------------
TRMB_BARQU      ----------------------------------------------------------
TRMB_BARHE      ----------------------------------------------------------
TRMB_BARBK      ----------------------------------------------------------
TRMB_AZOC5      ----------------------------------------------------------
TRMB_RHOPS      ----------------------------------------------------------
TRMB_RHOP2      ----------------------------------------------------------
TRMB_RHOPA      ----------------------------------------------------------
TRMB_NITHX      ----------------------------------------------------------
TRMB_NITWN      ----------------------------------------------------------
TRMB_RHOP5      ----------------------------------------------------------
TRMB_RHOPB      ----------------------------------------------------------
TRMB_BRADU      ----------------------------------------------------------
TRMB_RUEST      ----------------------------------------------------------
TRMB_RUEPO      ----------------------------------------------------------
TRMB_ROSDO      ----------------------------------------------------------
TRMB_JANSC      ----------------------------------------------------------
TRMB_PARDP      ----------------------------------------------------------
TRMB_RHOS4      ----------------------------------------------------------
TRMB_RHORT      ----------------------------------------------------------
TRMB_MAGSA      ----------------------------------------------------------
TRMB_GRABC      ----------------------------------------------------------
TRMB_NOVAD      ----------------------------------------------------------
TRMB_SPHAL      ----------------------------------------------------------
TRMB_ERYLH      ----------------------------------------------------------
TRMB_ZYMMO      ----------------------------------------------------------
TRMB_CAUVC      ----------------------------------------------------------
TRMB_CAUSK      ----------------------------------------------------------
TRMB_MARMM      ----------------------------------------------------------
TRMB_HYPNA      ----------------------------------------------------------
TRMB_MAGMM      ----------------------------------------------------------
TRMB_HELPY      DWPVRLFVLLT---ENQIFYLNKSPLKTLNNHKAHLLLQNILSQKGIG----------
TRMB_HELPH      DWPVRLFVLLT---ENQIFYLNKSPLKTLNNHKAHLLLQNILSQKGIG----------
TRMB_HELPJ      DWPVRLFVLLA---ENQVFYLNKSPLKTLNNHKAHLLLQNILSQKELDERDHRSE---
TRMB_HELAH      DWPMRLFVLSV---KNQVFYLNKSPLKTLNNHKAHLLLQNIL--KEFDEYNHCSE---
TRMB_WOLSU      AYPEKKYLWIK---GEEARYFGSSPIPSLANHQAHKLLEEWLS---------------
TRMB_HELHP      NQPQSKFLQIEFCNNVSARYIGSNPIPTQAAIKAHKYLIQILTQE-------------
TRMB_CAMJE      NKPEHCYLHLD---KT-IDFAFKEPFKIQENIKAINELKEILKVQFKI----------
TRMB_CAMJR      NKPEHCYLHLD---KT-IDFAFKEPFKIQENIKAINELKEILKVQFKI----------
TRMB_CAMJ8      NKPEHCYLHLD---KT-IDFVFKEPFKIQENIKAINELKEILKVQFKI----------
TRMB_CAMJJ      NKPEHCYLHLD---KT-IDFVFKEPFKIQENIKAINELKEILKVQFKI----------
TRMB_CAMJD      NKSEHCYLHLD---KT-IDFAFKEPFKIQENIKAINELKEILKVQFKI----------
TRMB_CAMFF      YRPEHCFILVE---NSKASYFIKKPLLTYENLKAHSTLKEYLSCSTS-----------
TRMB_SULDN      DKPEHLYVIVK---ENKAYYYPKTPLRSKSNLMAHKLLNGVLCE--------------
TRMB_GEOTN      ----------------------------------------------------------
TRMB_GEOKA      ----------------------------------------------------------
TRMB_BACHK      ----------------------------------------------------------
TRMB_BACC1      ----------------------------------------------------------
TRMB_BACAN      ----------------------------------------------------------
TRMB_BACCZ      ----------------------------------------------------------
TRMB_BACCR      ----------------------------------------------------------
TRMB_BACAH      ----------------------------------------------------------
TRMB_BACCN      ----------------------------------------------------------
TRMB_BACSU      ----------------------------------------------------------
TRMB_BACVZ      ----------------------------------------------------------
TRMB_BACLD      ----------------------------------------------------------
TRMB_LISIN      ----------------------------------------------------------
TRMB_LISW6      ----------------------------------------------------------
TRMB_LISMO      ----------------------------------------------------------
TRMB_LISMF      ----------------------------------------------------------
TRMB_STRT2      ----------------------------------------------------------
TRMB_STRTD      ----------------------------------------------------------
TRMB_STRT1      ----------------------------------------------------------
TRMB_STRA1      ----------------------------------------------------------
TRMB_STRA5      ----------------------------------------------------------
TRMB_STRA3      ----------------------------------------------------------
TRMB_STRP3      ----------------------------------------------------------
TRMB_STRPB      ----------------------------------------------------------
TRMB_STRPF      ----------------------------------------------------------
TRMB_STRPM      ----------------------------------------------------------
TRMB_STRPC      ----------------------------------------------------------
TRMB_STRP1      ----------------------------------------------------------
TRMB_STRPD      ----------------------------------------------------------
TRMB_STRPG      ----------------------------------------------------------
TRMB_STRP8      ----------------------------------------------------------
TRMB_STRP6      ----------------------------------------------------------
TRMB_STRSY      ----------------------------------------------------------
TRMB_STRS2      ----------------------------------------------------------
TRMB_STRMU      ----------------------------------------------------------
TRMB_STRSV      ----------------------------------------------------------
TRMB_STRGC      ----------------------------------------------------------
TRMB_STRR6      ----------------------------------------------------------
TRMB_STRPN      ----------------------------------------------------------
TRMB_STRP2      ----------------------------------------------------------
TRMB_LACLM      ----------------------------------------------------------
TRMB_LACLA      ----------------------------------------------------------
TRMB_LACLS      ----------------------------------------------------------
TRMB_ENTFA      ----------------------------------------------------------
TRMB_BACHD      ----------------------------------------------------------
TRMB_BACSK      ----------------------------------------------------------
TRMB_OCEIH      ----------------------------------------------------------
TRMB_STAES      ----------------------------------------------------------
TRMB_STAEQ      ----------------------------------------------------------
TRMB_STAHJ      ----------------------------------------------------------
TRMB_STAA3      ----------------------------------------------------------
TRMB_STAA8      ----------------------------------------------------------
TRMB_STAAB      ----------------------------------------------------------
TRMB_STAAC      ----------------------------------------------------------
TRMB_STAAS      ----------------------------------------------------------
TRMB_STAAW      ----------------------------------------------------------
TRMB_STAAM      ----------------------------------------------------------
TRMB_STAAN      ----------------------------------------------------------
TRMB_STAAR      ----------------------------------------------------------
TRMB_STAS1      ----------------------------------------------------------
TRMB_LACRD      ----------------------------------------------------------
TRMB_PEDPA      ----------------------------------------------------------
TRMB_LACPL      ----------------------------------------------------------
TRMB_LACS1      ----------------------------------------------------------
TRMB_LACSS      ----------------------------------------------------------
TRMB_LACP3      ----------------------------------------------------------
TRMB_LACBA      ----------------------------------------------------------
TRMB_LACJO      ----------------------------------------------------------
TRMB_LACGA      ----------------------------------------------------------
TRMB_LACDA      ----------------------------------------------------------
TRMB_LACDB      ----------------------------------------------------------
TRMB_LACAC      ----------------------------------------------------------
TRMB_LACH4      ----------------------------------------------------------
TRMB_LEUMM      ----------------------------------------------------------
TRMB_OENOB      ----------------------------------------------------------
TRMB_LACP7      ----------------------------------------------------------
TRMB_CLOD6      ----------------------------------------------------------
TRMB_ALKOO      ----------------------------------------------------------
TRMB_ALKMQ      ----------------------------------------------------------
TRMB_CLOPS      ----------------------------------------------------------
TRMB_CLOP1      ----------------------------------------------------------
TRMB_CLOPE      ----------------------------------------------------------
TRMB_CLOB8      ----------------------------------------------------------
TRMB_HUNT2      ----------------------------------------------------------
TRMB_CLOTE      ----------------------------------------------------------
TRMB_CLOK5      ----------------------------------------------------------
TRMB_CLOAB      ----------------------------------------------------------
TRMB_CLONN      ----------------------------------------------------------
TRMB_DESHY      ----------------------------------------------------------
TRMB_MYCGE      ----------------------------------------------------------
TRMB_MYCPN      ----------------------------------------------------------
TRMB_UREPA      ----------------------------------------------------------
TRMB_UREP2      ----------------------------------------------------------
TRMB_MYCCT      ----------------------------------------------------------
TRMB_MYCMS      ----------------------------------------------------------
TRMB_MESFL      ----------------------------------------------------------
TRMB_MYCGA      ----------------------------------------------------------
TRMB_MYCPE      ----------------------------------------------------------
TRMB_MYCPU      ----------------------------------------------------------
TRMB_MYCHP      ----------------------------------------------------------
TRMB_MYCH2      ----------------------------------------------------------
TRMB_MYCH7      ----------------------------------------------------------
TRMB_MYCHJ      ----------------------------------------------------------
TRMB_MYCMO      ----------------------------------------------------------
TRMB_MYCS5      ----------------------------------------------------------
TRMB_BACFR      ----------------------------------------------------------
TRMB_BACFN      ----------------------------------------------------------
TRMB_BACTN      ----------------------------------------------------------
TRMB_PORGI      ----------------------------------------------------------
TRMB_GRAFK      ----------------------------------------------------------
TRMB_CYTH3      ----------------------------------------------------------
TRMB_CHLSY      ----------------------------------------------------------
TRMB_CHLAA      ----------------------------------------------------------
TRMB_CHLAD      ----------------------------------------------------------
TRMB_CHLT3      ----------------------------------------------------------
TRMB_RUBXD      ----------------------------------------------------------
TRMB_THEMA      LSGRDGKWVLKLDEGSDPYRTPALKWSLRRIPEELTAQGSP-----------------
TRMB_COPPD      SVSPHREGFIVKLDNHADVFKTENVKSLIWLIANQISNGNIKRINVQPPSKLEYEPA-
TRMB_CHLPD      ----------------------------------------------------------
TRMB_AQUAE      QIKRKEDGYVIDVSPYSEVLRTRNLQRSIQTVAQLLS---------------------
TRMB_NEOSM      ----------------------------------------------------------
TRMB_WOLPM      ----------------------------------------------------------
TRMB_RHOBA      ----------------------------------------------------------
TRMB_BDEBA      ----------------------------------------------------------