CLUSTAL format seed alignment for MF_01060

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q2NRR4_SODGM          ----------------------------MITRSFRWTWKSFITLGAVLSTA---SGLVKP
W0HQK1_9GAMM          ----------------------------MITRSFRWTWKSFITLGAALSTA---SGLVKP
G7LVI6_9GAMM          ----------------------------MFSVSSRGIKTSLPPLALALSLGISFSTLAAP
I2B8P0_SHIBC          ----------------------------MITPARPHKRPSLTAAAVRLAVA---GLFFSP
A0A0J5M769_PLUGE      ----------------------------MTKPALRHVALLSAPAALHIALG---GLLLTA
A6TAV8_KLEP7          ----------------------------MTSTDARRPAAL--PCSLRLAIG---GALIAL
E3G4E8_ENTLS          ----------------------------MMTRTSRRPLPG--RLAVPLALG---GALLSL
A7MKC8_CROS8          ----------------------------MSQPVTRRPRTL--FFAIQVALS---GALLAF
TREA_SHIDS            ----------------------------MKSPAPSR------PQKMALIPA---CIFLCF
TREA_ECOLI            ----------------------------MKSPAPSR------PQKMALIPA---CIFLCF
D2TLZ9_CITRI          ----------------------------MPTPAVRHSGSL--SWAVKLALT---GTLLTF
TREA_SALTY            ----------------------------MIPPEIRRSVLL--QKAIKLALA---GTLLTF
TREA_CITK8            ----------------------------MITPALRHSGTL--SFAIKLTVA---STLLTF
R9VFY2_9ENTR          ----------------------------MTRPVLHRPRAL--LLVMQIALG---GALLAT
A0A0H3CHG0_ENTCC      ----------------------------MITPQKLR------PRLLPLVLG---SALLAV
A4WBE4_ENT38          ----------------------------MTIIDLRRPAAL--PLALRVALG---GALLGV
B2VDT8_ERWT9          -----------------------------MRRAFRQQSSV--PLFVSLLLS---GALAAG
D8MQZ3_ERWBE          -----------------------------MQRVEKRQWKA--VLVLPLMVA-----ALTQ
E1SAD0_PANVC          ------------------------MTKIEVSADSRRQRYA--PFLLTLLLS--------V
E6WBA5_PANSA          --------------------------------MIKNVVFT--PGHLRLLLS---TALLMG
U3U2B6_9ENTR          --------------------------------MIKNVVFT--PARLTLLLS---AALLSA
TREA_RALSO            ---------------------MLDPRGLARPSRFCPRIIYAGTSHIRRATA---AALLAA
Q63MI6_BURPS          ------------------MVTPRHRPLHVENPFYRRLLNA--PAWVALVAAAGIGCTSAT
C5AJQ3_BURGB          -------------------------MLVLAAAFVSLPACSDMNTAQSATPA---AARAAG
A4JPU7_BURVG          ------------MTSRRAESIASHPGLHPSTPAPRPRWAAVLAIAYLAVAG---CAAQAD
B4EFD2_BURCJ          ------------MTSRRAAPLASRFSSRQSPPAPRLRWAAALAIAYLAVAG---CAAQAD
G8MN45_9BURK          ----MLSEQEDRTRPSETSPVQSPFRGGSMIALSSHRAAHEASRRFRFKAHRMLSAWLVL
B2JMW7_PARP8          MRTLSLSCMRSWTVETNHPTAVSSQSMQRAAPLYAPPMRRRHAARAAALSGI--VLFAGF
B2TBQ7_PARPJ          -----------------MIESSQPRNFGRAGIASRTAFRSVESTRLHRIAAA--SSFVFL
D5WLI8_BURSC          ----------------MSIQSLSRISAASNAPFFPSSNKYFVPRRSPITLGVACIATLVF
E6WW24_PSEUU          ---------------------------MPRHPARRF------LFVLPLLLG---ACAAQP
TREA_PSEAE            ----------------------------MPDRTALPRAML--AAWVLLLLA---ACSQGP
TREA_XANCP            --------------------------MPHAPARSGDAMSAAAPPCCTSLLGLSLSMFVAP
A1TIN8_ACIAC          -----------------------------MIPAAPSCRTPLLSLVLGLLLGTAGTTAMAE
D2UGD8_XANAP          ----------------------------MSHAAPPSCTPLL-SLSLGLLLGN--CDATAE
                                                                                  

Q2NRR4_SODGM          LPPVKRTP-------------QDET-----LQSPDIMLGQLYIDVQTAKLYPDQKTFADA
W0HQK1_9GAMM          LPPVKRTP-------------QDET-----PQSPDIMLGQLYIDVQTAKLYPDQKTFADA
G7LVI6_9GAMM          ATQQATTI-------------SRPGAAMAAPQPPDVLLGPLFSDVQRAKLFPDQKTFADA
I2B8P0_SHIBC          LLTPLYAA-------------TPEN-----PRSPDELFGPLFTAVQSAGLFADQKTFVDA
A0A0J5M769_PLUGE      ALAARADE-------------ART------PQPPDILLGPLFNDVQSAKLFPDQKTFADA
A6TAV8_KLEP7          MSLNAQAE-------------DGKTA--P-PPSPDILLGPLFNDVQSAKLFADQKTFADA
E3G4E8_ENTLS          AAAVHAED-------------AKPTP----PQSPDELLGPLFSDVQRAKLFPDQKTFADA
A7MKC8_CROS8          STLPASAE-------------EPSGAERPAPQSPDQLLGPLFTDVQSAKLFPDQKTFADA
TREA_SHIDS            AALSVQAE-------------ETSVT----PQPPDILLGPLFNDVQNAKLFPDQKTFAGA
TREA_ECOLI            AALSVQAE-------------ETPVT----PQPPDILLGPLFNDVQNAKLFPDQKTFADA
D2TLZ9_CITRI          ASQSANAE-------------APLTN--P-PQPPDILLGPLFNDVQNARLFPDQKTFADA
TREA_SALTY            ASFSATAA-------------DPSSDTET-PQPPDILLGPLFNDVQNAKLFPDQKTFADA
TREA_CITK8            ASLSAHAE-------------EQPAS--P-PQPPDILLGPLFNDVQSVKLFPDQKTFADA
R9VFY2_9ENTR          ATHSFAAE-------------AQNT-----PQPPDVLLGPLFSDVQTAKLFPDQKTFVDA
A0A0H3CHG0_ENTCC      AATGNAEE-------------MNSGQ----TNSPDILLGPLFNDVQSAKLFPDQKTFADA
A4WBE4_ENT38          AAFSHAEE-------------AQSTQ----KQSPDILLGPLFVDVQSAKLFPDQKTFADA
B2VDT8_ERWT9          CSVQAQEE---------------RPVFDTIPQPPDVQLGPLFTAVQAANLYPDQKTFADA
D8MQZ3_ERWBE          TGYAAEND-------------AGQHLLSSAPQPPDIRLGPLFHAVQAAKLYPDQKTFADA
E1SAD0_PANVC          PAFTAHAD-------------DNSRMLNNQPQPPDVRLGPLFNAVQQAKFYPDQKTFADA
E6WBA5_PANSA          SAVAHAED-------------NGRMLNNP-PQPPDVRLGPLFNAVQQAKFYPDQKTFADA
U3U2B6_9ENTR          SAV-HAED-------------NSRMLSAQ-PQPPDVRLGPLFSAVQQARFYPDQKTFADA
TREA_RALSO            SLCALPAC-------------ADVGVGAALPLSPDKLYGELFVAVQTAQVYPDQKTFVDT
Q63MI6_BURPS          LARADSSP-AHASTAAAVASAASAPGAASIPPPPSQLYGDLFVAVQTAQIFADQKTFVDS
C5AJQ3_BURGB          TDAAAAAA-------------QPAGL----LPPPSQLYGDLFVAVQTAQLFPDQKTFVDS
A4JPU7_BURVG          NANHAASQ-----PAMQTAAAPASAASGALLPPPSQLYGDLFVAVQTAQLYPDQKTFVDA
B4EFD2_BURCJ          NANQAAAQAVGQSAIPATTAAAAAPASGTLPPPPSQLYGDLFVAVQTAQLYPDQKTFVDA
G8MN45_9BURK          SAVVHLAH-------------ADTQSGYTLPPPPSELYGDLFVAVQTGGVYPDQKTFVDA
B2JMW7_PARP8          AGSALIAN-------------ADTQVGSALPPPPDQLYGDLFVAVQTQQIYPDQKTFVDA
B2TBQ7_PARPJ          INLAGVCH-------------ADTQVGGPLPPAPDKLYGDLFVAVQTAQIYPDQKTFVDA
D5WLI8_BURSC          ASASCLAD---------------TQVGAALPPAPDILYGDLFVAVQTAQIFNDQKTFVDS
E6WW24_PSEUU          PVAHRPAQ-----------VQPAVVADTRAVRTPDRAWPNVFAAVQEAQLFEDQKFFVDA
TREA_PSEAE            APTPPASW-------------GWQDASGERAIAPDEAYPELFQAVQENRLFSDQKHFVDA
TREA_XANCP            CALAATPL-----------EGAVVSAPAPTPPTPDLAYPELFQAVQRGELFDDQKHFVDF
A1TIN8_ACIAC          AVPATTLT----------APATTLTAPAPPPQTPDLAYPELFQAVQQHELFDDQKHFVDA
D2UGD8_XANAP          QAVPALTQ-------------AKQEP----PQTPDLAYPELFQDVQEQALFDDQKHFVDA
                                                      .*.     ::  **   .: *** *.. 

Q2NRR4_SODGM          VPRRAPSAIIADYQNKRLRKNFNLRHFVDKNFIFPTDRVKYVTPTGQSLREHIITLWPVL
W0HQK1_9GAMM          VPRRAPAAIIADYQNKRLRKNFNLRHFVDKNFIFPTDRVKYVPPTGQSLREHIITLWPVL
G7LVI6_9GAMM          VPNRNPAAILEAYTRQKPSPGFNLRRFVESNFTLPQEGEAYVPPAGQTLRQHIDGLWGVL
I2B8P0_SHIBC          VPRSDPQMILADYRMQQKQSGFDLGHFVQVNFILPKEGARYVPPQGESLREHIDNLWPVL
A0A0J5M769_PLUGE      VPKSDPLMILADYRMQRGQRSFDLRHFVDVNFSLPQEKEKYVPPKDQSLRQHIDGLWPVL
A6TAV8_KLEP7          IPNSDPLMILADYRMQKNQASFDLRHFVELNFTLPKENDTYVPPKGQTLRQHIDGLWPVL
E3G4E8_ENTLS          VPKSDPLMILADYRMQRNQYSFDLRHFVDVNFTLPEEKKKYVPPAGRSLREHITSLWPVL
A7MKC8_CROS8          VPNSDPLMILADYRMQRNQSGFDLRHFVELNFTLPQKGEAYVPPAGQSLREHIDGLWPVL
TREA_SHIDS            VPNSDPLMILADYRMQQNQSGFDLRHFVNVNFTLPKEGEKYVPPEGQSLREHIDGLWPIL
TREA_ECOLI            VPNSDPLMILADYRMQQNQSGFDLRHFVNVNFTLPKEGEKYVPPEGQSLREHIDGLWPVL
D2TLZ9_CITRI          VPNSDPRTILADYRMQKNQSSFDLRHFVNVNFTLPKEGEKYVPPKGQSLREHIDGLWPVL
TREA_SALTY            IPNSDPLMILADYRMQRNQSGFDLRHFVDVNFTLPKAGEKYVPPAGQSLREHIDGLWPVL
TREA_CITK8            VPNSDPLMILADYRMQRNQSGFDLRHFVDVNFTLPKEGEKYVPPEGQSLREHIDGLWPVL
R9VFY2_9ENTR          VPKGDPLMILADYRMQRTQTSFDLRHFVDVNFTLPKEGEKYVPPEGQNLREHIDGLWPVL
A0A0H3CHG0_ENTCC      VPKSDPLTILADYRMQRRQSGFDLRHFVDMNFTLPAEGEKYVPPAGQSLREHIDGLWPVL
A4WBE4_ENT38          VPKSDPLMILADYRMQHKQSGFDLRHFVEMNFTLPGEGEKYVPPAGQNLREHIDGLWPVL
B2VDT8_ERWT9          VPKSDPELILSDWQMQKMQRNFDLKRFVATNFSMPATGDVYTSPKGQSLRAHINGLWPVL
D8MQZ3_ERWBE          VPKSNPTSILADWQMQKKQSNFDLRHFVEANFTLPAAGEKYVPPSGQSLREHINGLWPVL
E1SAD0_PANVC          VPKFDPASILADWQMQKKQRNFDLKRFVDANFTLPATGDKYVPPAGQNLREHIDGLWPVL
E6WBA5_PANSA          VPNYNPASILADWQMQKSQRNFDLKHFVDANFTLPKQQDKYVPPAGQSLRAHIDGLWPVL
U3U2B6_9ENTR          VPKYDPASILADWQMQKGQRNFDLMRFVDTNFTLPKAQDKYVPPAGQSLRAHINGLWPVL
TREA_RALSO            VPKADPAVILQAYRAQKDVPGFSLKAFVDQYFTVPFE-TVITPPAGQSLRAHINWLWPAL
Q63MI6_BURPS          TPNADPATIVQLYQQQKGQPGFSLKAFVAQYFT-PPSDESVTPPPNQMLREHIDWLWPKL
C5AJQ3_BURGB          TPDADPSTIVQFYAQQKDAPGFSLREFVAKHFT-PPVDSVVTPPANQTLRAHIDWLWPRL
A4JPU7_BURVG          TPNTDPATIVQLYQQQKSQPGFSLKAFVDQYFTAPPQGGV-TPPANLTLRQHIDWLWPQL
B4EFD2_BURCJ          TPDTDPATIVQLYQQQKSQPGFSLKAFVDQHFTPPPAGGV-TPPPNQTLRQHIDWLWPQL
G8MN45_9BURK          VPKIDPAQIVQAYQQQKLAPGFVLKNFVAQYFT-PPTDQSITPPPNQSLREHIDWLWPEL
B2JMW7_PARP8          LPKTDPTTILQAYDAQKNQANFSLKAFVDQYFTAPSE-PIITPPANQSLRDHINWLWPEL
B2TBQ7_PARPJ          TPNADPAAIVQLYEQQKHNPGFSLAKFVNKYFT-PPSEPVITPPANQTLREHINWLWPAL
D5WLI8_BURSC          TPNGSPAAIVQLYETQRNQPGFSLQQFVSQYFT-PPPDQSITPPPNQSLREHIDWLWTGL
E6WW24_PSEUU          VPRSDPATVEAAYARDHVAPGFDLGAFVERHFVLPAAAAGTDIPRRDSLRAHIDALWPLL
TREA_PSEAE            LPLREPARIRADYLRERERPGFDLRAFVGRNFEESGSVETAPPEAGADLASHISDLWPAL
TREA_XANCP            LPLRDPALINADYLAQHEHAGFDLRKFVDANFEESPPVQTDAIRQDTALREHIDALWPKL
A1TIN8_ACIAC          LPLRDPALINADYLAQRQQPGFDLRRFVAANFEESDPVQTGAIRQDTGLREHIDALWPRL
D2UGD8_XANAP          TPRRDPALINTDYLAQRQKPDFDLRHFVAANFEESGPALPEAIHQDSDLGTHIDALWPLL
                       *   *  :   :  ..   .* *  **   *  .             *  **  **  *

Q2NRR4_SODGM          TR--NDARVR-PHDSLLQMPHDYVVPGGRFREIYYWDSYFTMLGLAESGKWDLVRGMTEN
W0HQK1_9GAMM          TR--NDARVR-PHDSLLPMPYDYVVPGGRFREIYYWDSYFTMLGLAESGKWDLVRGMTDN
G7LVI6_9GAMM          TR--TTRQVQ-AYDSLLPLPHSYVVPGGRFREIYYWDSYFTMLGLAESGNWTLVRNMTDN
I2B8P0_SHIBC          TR--ETPQAR-PWDSLLPLPRPYVVPGGRFREIYYWDSYFTMLGLAESGHRDRVENMVDN
A0A0J5M769_PLUGE      TR--TTGTPE-KWDSLLALPKPYVVPGGRFREVYYWDSYFTMLGLAESGHWDNVADMVDN
A6TAV8_KLEP7          TR--STVEVE-KWDSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLAESGHWDKVEDMVAN
E3G4E8_ENTLS          TR--TADSAA-RWDSLLPLPKPYVVPGGRFREIYYWDSYFTMLGLAASGRWDSVEDMVAN
A7MKC8_CROS8          TR--STDSAS-KWDSLLPLPKPYVVPGGRFREVYYWDTYFTMLGLAESNHWDKVQDMVDN
TREA_SHIDS            TR--STENTE-KWDSLLPLPEPYVVPGGRFREVYYWDSYFTMLGLAESGHWDKVADMVAN
TREA_ECOLI            TR--STENTE-KWDSLLPLPEPYVVPGGRFREVYYWDSYFTMLGLAESGHWDKVADMVAN
D2TLZ9_CITRI          TR--SADSAG-KWDSLLPLPEPYVVPGGRFREVYYWDSYFTMLGLAESNQWDKIADMVAN
TREA_SALTY            TR--STKNVE-KWDSLLPLPESYVVPGGRFREIYYWDSYFTMLGLAESGHWDKVADMVAN
TREA_CITK8            TR--TTESAG-KWDSLLPLPEPYVVPGGRFREVYYWDSYFTMLGLAESDHWDKVADMVAN
R9VFY2_9ENTR          TR--TTDSAG-KWDSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLAESGHWDKIEDMISN
A0A0H3CHG0_ENTCC      TR--TTDKASNKWDSLLPLPKSYVVPGGRFREVYYWDSYFTMLGLAESGHWDKISDMVDN
A4WBE4_ENT38          TR--TTDKAS-KWDSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLAESGHWDKISDMVAN
B2VDT8_ERWT9          TR--SDKVDN-QWGSLLPLPNPYVVPGGRFREVYYWDSYFTMLGLAESGRWERVQDMVDN
D8MQZ3_ERWBE          TR--STQQAS-QWDSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLAESGHWDRVQDMVEN
E1SAD0_PANVC          TR--TTSSAG-QYDSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLAESGHWDKVQDMTDN
E6WBA5_PANSA          TR--STPQTS-QYDSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLAESGHWDRVQDMVDN
U3U2B6_9ENTR          TR--STPTAS-QYDSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLAESGHWDRVQDMVDN
TREA_RALSO            TR--TTATAP-DNSSLIPLPKPYVVPGGRFREVYYWDTYFTMLGLQASGRDDLVDSMLDN
Q63MI6_BURPS          TR--TTTTAP-PYSSLIALPKPYVVPGGRFREGYYWDTYFTMLGLQEAGREDLVDNMLDN
C5AJQ3_BURGB          TR--NTDGAP-RYGSLIALPKPYVVPGGRFREGYYWDSYFTMLGLQDAGREDLVDAMLDN
A4JPU7_BURVG          TR--TTTSVP-PYSSLVPMPKPYVVPGGRFREGYYWDTYFTMLGLQVSGREDLVDDMLDN
B4EFD2_BURCJ          TR--TSVTVP-QYSSLIPMPKPYVVPGGRFREGYYWDTYFTMLGLQVSGREDLVDDMLDN
G8MN45_9BURK          TRLTTTANVP-PNSSLIPMPKQYVVPGGRFREGYYWDTYFTMLGLQEAGREDLVDDMLDN
B2JMW7_PARP8          TR--TTTSVP-SYSSLIPMPKAYVVPGGRFREGYYWDTYFTMLGLQESGHEDLVDNMLDN
B2TBQ7_PARPJ          TR--TTTSAP-PNSSLIPLPKPYVVPGGRFREGYYWDTYFTMLGLQESGNENLVDDMLDN
D5WLI8_BURSC          TR--TTTSAP-DYSSLIPLPKPYVVPGGRFREGYYWDTYFTMLGLQESGREDLVDDMLDN
E6WW24_PSEUU          TR--RSPEPL-PHDSLLPLPQPYVVPGGRFREVYYWDSYFTMLGLAESGQHALVGQMLDN
TREA_PSEAE            TR--HYEQVP-AHSSLLPLPKPYVVPGGRFREVYYWDSYFTMLGLAESGQHQRVRDMLDN
TREA_XANCP            VR--SQTNVP-AHSSLLALPHPYVVPGGRFREVYYWDSYFTMLGLVKSGETTLSRQMLDN
A1TIN8_ACIAC          VR--RQVEVP-PYSSLLPLPHPYVVPGGRFREVYYWDSYFTMLGLVESGEQEHSRQMLDN
D2UGD8_XANAP          VR--HQTEVP-AYSSLLALPHPYVVPGGRFGEIYYWDSYFTMLGLVHSGQTERSRQMLDN
                      .*           .**: :*  ******** * ****:*******  :.       *  *

Q2NRR4_SODGM          FAHEINVFGRIPNGNRSYYISRSQPPFFSLMVDLVASQD-GAEVYQRYLPQLKKEYDYWM
W0HQK1_9GAMM          FAHEINVFGRIPNGNRSYYISRSQPPFFSLMVDLLAGHD-GGEVYERYLPQMKKEYDYWM
G7LVI6_9GAMM          FAHEIDRYGHIPNGNRSYYLSRSQPPFFSFMVELLAQHQ-GDKVYAHYLPQLKKEYHYWM
I2B8P0_SHIBC          FASEIDTWGHIPNGNRSYYLSRSQPPFFPLMVELLAGDD--SATLARYLPQLEKEYRYWM
A0A0J5M769_PLUGE      FAYEIDTWGHIPNGNRSYYLSRSQPPFFAMMVELLATHD-GDSALKKYLPQMKKEHDYWM
A6TAV8_KLEP7          FAAEIDAWGHIPNGNRTYYLSRSQPPFFSFMVSLLATHD-GDQVLKTYQPQLEKEYRYWM
E3G4E8_ENTLS          FAWEIDAWGHIPNGNRSYYLSRSQPPFFAFMVELLASRD-GDAALKKYLPQMEKEHAYWM
A7MKC8_CROS8          FAHEIDAWGHIPNGNRSYYLSRSQPPFFAFMVELLATHEGGDETLKKYLPQLQKEYAYWM
TREA_SHIDS            FAHEIDTYGHIPNGNRSYYLSRSQPPFFALMVELLAQHE-GDAALKQYLPQMQKEYAYWM
TREA_ECOLI            FAHEIDTYGHIPNGNRSYYLSRSQPPFFALMVELLAQHE-GDAALKQYLPQMQKEYAYWM
D2TLZ9_CITRI          FGWEIDSFGHIPNGNRTYYLSRSQPPFFSLMVELLAQHE-GDETLKKYLPQLQKEYAYWM
TREA_SALTY            FGYEIDAWGHIPNGNRTYYLSRSQPPFFAFMVELLAQHE-GDDALKEYLPQLQKEYAYWM
TREA_CITK8            FGYELDSWGHIPNGNRTYYLSRSQPPFFAFMVELLAQHE-GDDALKKYLPQLQKEYAYWM
R9VFY2_9ENTR          FGHEIDTWGHIPNGNRSYYLSRSQPPFFSLMVELLATHD-GDEALKTWLPQMEKEYQYWM
A0A0H3CHG0_ENTCC      FAYELDTWGHIPNGNRSYYLSRSQPPFFSLMVELLATHD--SEALKKYRPQMEKEYAYWM
A4WBE4_ENT38          FGYELDSWGHIPNGNRSYYLSRSQPPFFSLMVELLATHD--KEALKTYRAQMEKEYAYWM
B2VDT8_ERWT9          FAYQLDTYGHIPNGNRSYYLSRSQPPFFSMMVDLLAQHG-GDKIYGQYRPQLEKEYRYWM
D8MQZ3_ERWBE          FAHELDTYGHIPNGNRSYYLSRSQPPFFSMMVDLLAQHQ-GDSAYSKYLPELQKEYNYWM
E1SAD0_PANVC          FASLLDRYGHIPNGNRSYYLSRSQPPFFSLMVDLLATHD-DGKAYTHYLPQLQKEYDYWM
E6WBA5_PANSA          FASELDRYGHIPNGNRSYYLSRSQPPFFSLMIDLLATHD-GDSVYTHYLPQLQKEYDYWM
U3U2B6_9ENTR          FASELDKYGHIPNGNRSYYLSRSQPPFFSLMVDLLASHK-GDDVYRQYLPQLQKEYDYWM
TREA_RALSO            FAYQINRFGHIPNGNRTYYLSRSQPPFFALMVELAATKE-GEAAYTRYLAPLRKEYAYWM
Q63MI6_BURPS          FAYLIDTVGHVPNGNRSYYVSRSQPPFFAYMVTLAAKAE-GNRVYQKYLPALRKEYAYWM
C5AJQ3_BURGB          FAYLIDTVGHVPNGNRTYYASRSQPPFFAYMVELAAKKE-GNGVYQKYLPALRKEYAYWM
A4JPU7_BURVG          FAYLIDTVGHIPNGNRTYYASRSQPPFFAYMVTLAARAE-GDTVYQKYLPALRKEYAYWM
B4EFD2_BURCJ          FAYLIDTVGHIPNGNRTYYASRSQPPFFAYMVTLAAQVE-GDKVYQKYLPALRKEHAYWM
G8MN45_9BURK          FAYLIDTIGHIPNGNRTYYVSRSQPPFFSYMVELAAHKE-GGRVYQKYLPQLRREHDYWM
B2JMW7_PARP8          FAYMIDTYGHIPNGNRTYYLSRSQPPFFSYMVELAAKVE-GGRVYQKYLPQMRKEYAYWM
B2TBQ7_PARPJ          FAYEIDTFGHIPNGNRTYYLDRSQPPFFSHMVELAAKME-GHGVYQKYLPALRKEYAYWM
D5WLI8_BURSC          FAYMIDTFGHIPNGNRTYYLSRSQPPFYSYMVELAAQKE-GNKVYQKYLPELRKEYAYWM
E6WW24_PSEUU          FAHLIDRWGHIPNGNRSYYLSRSQPPFFSHMVELEARAD--PAVATRYLAQLRREHAFWM
TREA_PSEAE            FAYLIDTYGHIPNGNRSYYLSRSQPPFFAYMVDLQARRE-GDAAYRRYLPQLQKEYAYWM
TREA_XANCP            FAYLIDTYGHIPNGNRTYYLSRSQPPLFSYMVELQAGVE-GEAVYQRYLPQLQKEYAYWM
A1TIN8_ACIAC          FAYMIDTYGHIPNGNRTYYLSRSQPPFFSYMVQLQAKVE-GDAAYARYLPQLQKEYAYWM
D2UGD8_XANAP          FAYLIDTYGHIPNGNRTYYLSRSQPPFFSHMVQLQAQVE-GDGAYARYLPQLQKEYAYWM
                      *.  ::  *.:*****:** .*****::. *: * *           : . : .*: :**

Q2NRR4_SODGM          EGYE--TLDPGVAAGRLARMHDGAFLNRYWDDEDTPRTESYLDDILTASEAKDRPVAEVY
W0HQK1_9GAMM          EGYE--SLDPGVAAGRLARMHDGAFLNRYWDDEDTPRTESYLDDILTASEAKDRPAAEVY
G7LVI6_9GAMM          RGSV--GLPNGQAGDRVVRLDDGSVLNRYWDERDTPRTESYMEDITTASQAADRPAAEVY
I2B8P0_SHIBC          AGSE--QLKPGEASARVVRMKGGELLNRYWDDKDTPRPESWREDIHTARSAPERPAAEVY
A0A0J5M769_PLUGE      AGSE--GLEKDSAVARVVRMGDGSLLNRYWDDRDTPRPESWLDDITTAKSNPDRRAADIY
A6TAV8_KLEP7          AGAD--ALPPGSADKRAVRMADGALLNRYWDDSDTPRPESWLDDVKTAKSNPNRPATEIY
E3G4E8_ENTLS          EGQD--ALSPGKADKRVVKMDDGAVLNRYWDNEDTPRPESWLDDVNTAKSDPGRPATGIY
A7MKC8_CROS8          EGSE--NLAPGDAHERVVKLKDGAVLNRYWDDRDAPRTESWLDDVTTAKNNPDRPATDIY
TREA_SHIDS            DGVE--NLQAGQQEKRVVKLQDGTLLNRYWDDRDTPRPESWVEDIATAKSNPNRPATEIY
TREA_ECOLI            DGVE--NLQAGQQEKRVVKLQDGTLLNRYWDDRDTPRPESWVEDIATAKSNPNRPATEIY
D2TLZ9_CITRI          EGAE--TLQTGQQNKRVVKLDDGSVLNRYWDERDTPRPESWVEDIATAKSNPDRPAAEIY
TREA_SALTY            EGVE--TLQPGQQNQRVVKLEDGSVLNRYWDDRDTPRPESWVEDIATAKSNPNRPATEIY
TREA_CITK8            EGVE--NLQPGEQNKRVVKLDDGTVLNRYWDDRDTPRPESWMEDITTAKSNPNRPATEIY
R9VFY2_9ENTR          EGAD--TLQPGQANKRVVKLSDGSILNRYWDDRDTPRPESWLDDVTTAKNNPNRPATEIY
A0A0H3CHG0_ENTCC      EGAD--ALQAGEANKRVVKLEDGSLLNRYWDDRDTPRPESWLDDITTAKSNPNRPATEIY
A4WBE4_ENT38          EGAE--TLQPGQANKRVVKLDDGSILNRYWDDRDTPRPESWLDDVTTAKNNPNRPATEIY
B2VDT8_ERWT9          TGVDDEALRPGSATQRVVKLRDGTILNRYWDDRDVPRTESWREDTITARQAAGPDRAQLY
D8MQZ3_ERWBE          ADAD--SVKPGQASKRVVKLKDGTLLNRYWDARDVPRTESYMDDIATAQKANNRNKAELY
E1SAD0_PANVC          ADSD--NVAAGAASKRVIKLADGTLLNRYWDARDVPRTESWMDDIATAQKAPQRNKAELY
E6WBA5_PANSA          ADSD--KVPAGQASKRVIKLSDGTLLNRYWDERDVPRTESWLDDVNTAKKATQRDKAQVY
U3U2B6_9ENTR          ADSD--KVAAGQASKRVVKLSDGTLLNRYWDDHDVPRTESWLDDVNTAKKAPERNKQQVY
TREA_RALSO            RGAA--GTAPGQASGNVVVLPDGTVLNRYWDDEATPRPESYLQDVATAQQAPDRPAAEVW
Q63MI6_BURPS          QGER--TTPRGQATRNVVAMPDGSVLNRYWDASDTPRDESYLEDVKTAQQASGRPAAEVW
C5AJQ3_BURGB          QGEA--STPRGSASAHVVAMPDGAILNRYWDASATPRDESYLEDVQTARAATGRPAAEVW
A4JPU7_BURVG          QGES--AAPRGEAVRHVVAMPDGAVLNRYWDASDTPRDESYLEDVTTAKAVPSRPANDVY
B4EFD2_BURCJ          QGET--TTPRGQAARHVVAMPDGAVLNRYWDASDTPRDESYLEDVTTAKSVPSRPANEVY
G8MN45_9BURK          QGEN--TLQPGDAVRNVVMLPDKTVLNRYWDARDTPRDESYLEDVNTAKQVANRPANEVY
B2JMW7_PARP8          QGAS--STKPGEATRNVVVLPDRTVLNRYWDELDTPRDESYLEDVQTAQKATGRAPNEVY
B2TBQ7_PARPJ          QGES--TTRPGSATRNVVVMPDRTVLNRYWDELDTPRDESYLEDIQTAQQASGRNPNDVY
D5WLI8_BURSC          QGST--STPRGGATRNVVVLNDGTVLNRYWDDLDTPRDESYLEDVQTAQ-ASGRPANEVY
E6WW24_PSEUU          DGAE--GLRPGQAHRRVVRLEDGSLLNRYWDDRDTPRPESYIQDRETA-AASNRPAAEVY
TREA_PSEAE            EGSA--GLRPNEARLHVVKLADGSLLNRYWDNRDTPRQESFLEDRATAARAPQRPAGEVY
TREA_XANCP            QGGD--DLQPGQAARHVVRLADGSVLNRYWDERDTPRPEAWLHDTRTAAEAHDRPAADVY
A1TIN8_ACIAC          EGAE--TLAPGSAHAHVVRLADGSLLNRYWDARDTPRPEAWLHDVRTAAEAKDRPAAEVY
D2UGD8_XANAP          DGAQ--ALAPGNAQAHVVRLTDGSLLNRYWDARDTPRPEAWLHDVRTAAAAKRRPAAEVY
                       .        .    .   : .  .******   .** *::  *  **          ::

Q2NRR4_SODGM          RDLRAGAASGWDFSSRWFDNPLELSSIRTTSILPVDLNALMYHLEHTLANASHMA-GDNE
W0HQK1_9GAMM          RDLRAGAASGWDFSSRWFDNPLELSSIRTTSILPVDLNALIYHLEHTLANACHMT-GDNE
G7LVI6_9GAMM          RHLRAGAASGWDFSSRWLRDPRDLSTIHTTDIIPVDLNSLLFHLEQTLARGAEAA-GNQG
I2B8P0_SHIBC          RDLRAAAASGWDFSSRWMDDPHKLGSIRTTRIVPVDLNALLYQMEKTLAAASQAA-GDNA
A0A0J5M769_PLUGE      RDLRAAAASGWDFSSRWMDDPHKLSTIRTTSIVPVDLNALMFRMEKIVARASSAA-GDND
A6TAV8_KLEP7          RDLRSAAASGWDFSSRWMDNPQQLATIRTTSIVPVDLNALMFHLEKTLARASKAS-GDSA
E3G4E8_ENTLS          RDLRAAAASGWDFSSRWMDDPQKLSTLRTTSIVPVDLNALMYKMEKTIASASRAS-GDAD
A7MKC8_CROS8          RDLRAGAASGWDFSSRWMDNPQQLGSIRTTSIVPVDLNALLFQMEKTLARASKAA-GDSA
TREA_SHIDS            RDLRSAAASGWDFSSRWMDNPQQLNTLRTTSIVPVDLNSLMFKMEKILARASKAA-GDNA
TREA_ECOLI            RDLRSAAASGWDFSSRWMDNPQQLNTLRTTSIVPVDLNSLMFKMEKILARASKAA-GDNA
D2TLZ9_CITRI          RDLRSAAASGWDFSSRWMDDPQQLGTIRTTSIVPVDLNALLYKMEKILARASKVA-GDDA
TREA_SALTY            RDLRSAAASGWDFSSRWMDNPQQLSTIRTTTIAPVDLNALLYQLEKTLARASAAA-GDRA
TREA_CITK8            RDLRSAAASGWDFSSRWMDDPNQLSTIRTTSIVPVDLNALLYKLEKMLARASKAA-GDDA
R9VFY2_9ENTR          RDLRSAAASGWDFSSRWMDDPNQLGTIRTTSIVPVDLNALMFKMEKMLARGYQAA-GDSA
A0A0H3CHG0_ENTCC      RDLRSAAASGWDFSSRWMDDPQKLGTIRTTSIVPVDLNALMFKMEKLLARASQES-GDAA
A4WBE4_ENT38          RDLRSAAASGWDFSSRWMDDPQKLGTIRTTSIVPVDLNALMFKMEKLLAKASQES-GDAA
B2VDT8_ERWT9          RDLRAGAASGWDFSSRWFDKPDDLSTIRTTQILPADLNALMFHLEKTLARAYKTE-NNAA
D8MQZ3_ERWBE          RDLRAGAASGWDFSSRWFDKPGDLSTIHTTRIVPVDLNALMFHLEQTLARANKVT-KNDD
E1SAD0_PANVC          RDLRSGAASGWDFSSRWFTDAHNLSTIRTTQLAPVDLNSLLFHLEQTLSKGYQMN-KQSD
E6WBA5_PANSA          RDLRAGAASGWDFSSRWFSDAHNLATIRTTQLAPVDLNSLLFHLEQTLAKAEKLA-HHDQ
U3U2B6_9ENTR          RDLRAGAASGWDFSSRWFTDAHNLASIRTTQLAPVDLNSLLFHLEQTLAKTAKLA-KQND
TREA_RALSO            RDLRAAAESGWDFSSRWFGDSATLATIRTTSILPVDLNALMFQLEKTIAKGCAVA-RDFA
Q63MI6_BURPS          RDLRAAAESGWDFSSRWFGDNRTLATIRTTAIVPVDLNSLMFNLETTIVKGCAVT-RDFA
C5AJQ3_BURGB          RDLRAGAESGWDYSSRWLGDGRTLATIRTTAIVPVDLNSLMYHLEKTIVKGCGVT-HDVA
A4JPU7_BURVG          RDLRAGAESGWDYSSRWFGDGRTLATIRTTSIVPVDLNSLMFHLETTIVKGCTVA-RDVG
B4EFD2_BURCJ          RDLRAGAESGWDYSSRWFGDGKTLATIRTTSIVPVDLNSLMFHLETTIVKGCAVT-RDIA
G8MN45_9BURK          RDLRAAAESGWDFSSRWFGDNMTLATIRTTSIIPVDLNSLMFHLETTIAIGCGEA-RDFR
B2JMW7_PARP8          RDLRATAESGWDFSSRWFGDNANLTTVRTTSIIPVDLNSLMFHLETTIARGCSEA-RDFS
B2TBQ7_PARPJ          RELRATAESGWDFSSRWFGDNMTLATVRTTSIIPVDLNSLMFHLEITIAKGCGET-RDFR
D5WLI8_BURSC          RDLRATAESGWDFSSRWFGDNQTLATVRTTSIIPVDLNSLLFHLETTIARGCSAT-RDFH
E6WW24_PSEUU          RELRAGAESGWDFSSRWLDDPMRLDTIHVTSRVPVDLNSLLHHLETTIAGACEQA-GDAA
TREA_PSEAE            RDLRAGAESGWDFSSRWLDDGRELASIRTTAIVPVDLNALLYHLERIIAKACASS-ALKA
TREA_XANCP            RDLRAGAESGWDYTSRWLADGKTLSTIRTTAIVPIDLNSLLYHLERTLAQACAHT-GTA-
A1TIN8_ACIAC          RDLRAGAESGWDYSSRWLGDRKTLASIRTTAIVPVDLNSLLYHLETTLALACAKNPDVAG
D2UGD8_XANAP          RDLRAGAESGWDYSSRWLGDRKTLASIRTTAIVPVDLNSLLYHLESTLALACAKNPGAAG
                      * **: * ****::***: .   * ::..*   * ***:*:..:*  :            

Q2NRR4_SODGM          AAGRYSLAAQSRKAAINQHLWNEAEGYYADYDWLLGRLRDQLTAATVFPLYNKIAPPDYA
W0HQK1_9GAMM          AAGRYSLAAQARKAAINHHLWNEAEGYYADYDWLLGKLREQLTAATVFPLYNKIAPPDYA
G7LVI6_9GAMM          EAAHFLRVADERRQAVNRYLWNQQDGYYSDYDWRRKAITQPITAAAVFPLYVNIAPRDRA
I2B8P0_SHIBC          AAGRYETLARDRQLAMEKYLWNDKRGWYGDYDLQKQHVRDQLTAAALFPLYVKAAASDRA
A0A0J5M769_PLUGE      SAQRYEGYAAARQKAMEKYLWNEKAGWYADYDLKNHRVRGQLTAAALFPLYVNAASSARA
A6TAV8_KLEP7          GATQYDALANARQQAIEKYLWNDKEGWYADYDLKSHKVRNQLTAAALFPLYVNAASRERA
E3G4E8_ENTLS          NAARYDQLATARQKAMEKYLWNDKEGWYADYDLKTRKVRSPLTAAALFPLFVNAAPKDRA
A7MKC8_CROS8          GAARYESLASQRQQAIETHLWNAKHGWYADYDLKTNKVRDQLTAAALFPLYVKAAAQDRA
TREA_SHIDS            MANQYETLANARQKGIEKYLWNDQQGWYADYDLKSHKVRNQLTAAALFPLYVNAAAKDRA
TREA_ECOLI            MANQYETLANARQKGIEKYLWNDQQGWYADYDLKSHKVRNQLTAAALFPLYVNAAAKDRA
D2TLZ9_CITRI          NATRYDRLANERQQAIERYLWNDKEGWYADYDLKSKQVRNQLTAAALFPLYVNAAAKDRA
TREA_SALTY            KASHYDALANARQKAIEMHLWNNKEGWYADYDLKNNKIRDQLTAAALFPLYVNAAAKDRA
TREA_CITK8            NANQYEALASARQKGIETHLWNNQEGWYADYDLKSKKVRNQLTAATLFPLYVNAAAKDRA
R9VFY2_9ENTR          KASQYDALANARQKGIEANLWNEKEGWYADYDLKTKKVRNQLTAAALYPLFVNAAAKDRA
A0A0H3CHG0_ENTCC      SASKYEALATARQKAMEKYLWNDKEGWYADYDLKSKKVRNQLTAAALFPLYVKAAAQDRA
A4WBE4_ENT38          ATSKYETLATSRQKAMESHLWNEKEGWYADYDLKSKKVRNQLTAAALFPLYVNAASNDRA
B2VDT8_ERWT9          ASQRFEQLAERRKTAIGHYLWDEKQGWYADYDWQRSHVRPQLTAAALFPLYLQAATGERA
D8MQZ3_ERWBE          AVKKFDALAKKRQAAINRYLWDNKQGFYADYDWQKATIRPQLTAATLFPLYLQAATEEHA
E1SAD0_PANVC          LAKQYADRAEKRQAAINRYLWDSKQNWYADYDWQKKQVHPQLTAAALFPLYLQVASDKQA
E6WBA5_PANSA          QAQQWAAKAETRQAAINRYLWNAQQGWYADYNWQKKQVQPQLTAAALFPLYMQLASDKQA
U3U2B6_9ENTR          KAQQFAADAEKRQAAINRYLWDDKQGWYADYDFQKKQVHNQLTAATLFPLYMQLAGDKQA
TREA_RALSO            CTVEFGNHARKRAVAVERYLWH-PAGYYADYDWKLGKVRDNLSAAATYPLFVQMAPWGRA
Q63MI6_BURPS          CVAEFAGRAGKRAVAINRYLWN-RNGYYGDYDWKLGKPRDNLSAAALYPLFAGVAWPERA
C5AJQ3_BURGB          CVADFSARAARRDAAINRYLWN-PAGYYGDYDWQLGKPRDGLSAAALYPLYAGAATPEHA
A4JPU7_BURVG          CVVDFSARAARRAAAINRYLWN-RRGYYGDYDWQLRKPRDGVTAAALYPLFAGVAWPERA
B4EFD2_BURCJ          CVADFSARAGKRAAAINHYLWN-RRGYYGDYDWQLRKPRDGVTAAALYPLFAGVAWPERA
G8MN45_9BURK          CVGEYVGRAAKRAIGINRYLWN-KNGYYGDYDWKLGQPRNNPSAAMLYPLFANVAWPERA
B2JMW7_PARP8          CVVQFIGKAGKRAEGINRYLWN-SKGYYGDYDWKLAKPRDNQTPAMLYPLFAGAAWPDRA
B2TBQ7_PARPJ          CVGEFAQRAAKRALGINRYLWN-PNGYYGDYDWQLARPRDNKTAAMVFPLFVGAAWPDRA
D5WLI8_BURSC          CVAQFIGHAARRAEGINRYLWN-SNGYYGDYDWQLRKSRDNQTPAMLYPLMAGVAWPDRA
E6WW24_PSEUU          CARDYTARAQARAAAIERHLWS-EDGYYGDLDLRDGKVRAQLTAATLFPLHAGIASPERA
TREA_PSEAE            CEQGYGARAEKRRQAIEDHLWH-PAGYYADYDWQRRRPIERINAASLFPLFTGLASAERA
TREA_XANCP            CSQDYAALAQQRKQAIDAHLWN-AAGYYADYDWQTRTLSNQVTAAALYPLFAGLASDDHA
A1TIN8_ACIAC          CNTDYAALASARKTAIDKHLWS-DAGYYADYDWQQRRLRGQVTAAALFPLFVGAASPARA
D2UGD8_XANAP          CDTDYAALASARKTAIDKHLWS-SAGYYADYDWQKRQLREQVTAAALYPLFVGLASQDRA
                          :   *  *  .:   **    .:*.* :          ..*  :**    *    *

Q2NRR4_SODGM          RCTAVVIRQQLLKQGGMITTTNVSGQQWDAPNGWAPLQWVAVEGLRHYGEEALAEQIATR
W0HQK1_9GAMM          RRTAEVIRLQLLKQGGMITTTNVSGQQWDAPNGWAPLQWVAVEGLRHYGEEALAEEIATR
G7LVI6_9GAMM          AATGEAVRKQLLKEGGLTTTTVNTGQQWDAPNGWAPLQWVAVEGFSRYGQDALAQAIGTR
I2B8P0_SHIBC          AKTGIAVKAHLLQPGGLATTLVASGQQWDAPNGWAPLQWVAIEGLNNYQQQPLAREVALR
A0A0J5M769_PLUGE      AKMAAVTESQLLKAGGIATTTVSSGQQWDLPNGWAPLQWVAAEGLQNYGNQKVAMEVTWR
A6TAV8_KLEP7          TKVAAAAESRLLKPGGLTTTTVNSGQQWDAPNGWAPLQWVAVEGLQNYGQQKIAMEVTWR
E3G4E8_ENTLS          DKVAAATQAHLLKPGGIATTTVSSGQQWDAPNGWAPLQWVAVEGLQNYGEDKVAMDISWS
A7MKC8_CROS8          EKVAAATRAQLLKPGGIVTTTVKTGQQWDAPNGWAPLQWVATEGLMNYGQKDLAMDVTWR
TREA_SHIDS            NKMATATKTHLLQPGGLNTTSVKSGQQWDAPNGWAPLQWVATEGLQNYGQKEVAMDISWH
TREA_ECOLI            NKMATATKTHLLQPGGLNTTSVKSGQQWDAPNGWAPLQWVATEGLQNYGQKEVAMDISWH
D2TLZ9_CITRI          AKMAAATESHLLQPGGLATTSVKSGQQWDAPNGWAPLQWVATEGLQNYGQDKVAMEVTWR
TREA_SALTY            AKVAAAAQAHLLQPGGLATTSVKSGQQWDAPNGWAPLQWVAAEGLQNYGQDDVAMEVTWR
TREA_CITK8            SKVAAATQAHLLQPGGLSTTSVKSGQQWDAPNGWAPLQWVATEGLQNYGQDNVAMDVTWR
R9VFY2_9ENTR          DKVASAAKERLLKPGGIATTTVKSGQQWDAPNGWAPLQWVATAGLQNYDQQKLAMEVSWR
A0A0H3CHG0_ENTCC      DKVAVATSSRLLKPGGITTTTVNSGQQWDAPNGWAPLQWVATEGLQNYGQDKVAMDVTWR
A4WBE4_ENT38          AKVASATASRLLKPGGISTTTINSGQQWDAPNGWAPLQWVATEGLQNYGHEKVAMDVTWR
B2VDT8_ERWT9          TRTASAVKKHLLAEGGLLTTTVTSGQQWDAPNGWAPLQWVAVVGLNHYGQEPLAKEIGLR
D8MQZ3_ERWBE          TRTADAVKSQLLKEGGLATTNVNNGQQWDAPNGWAPLQWAAVQGLNNYGKQALAKDVGMR
E1SAD0_PANVC          ESTASAVEKQLLKPGGLVTTTVNNGQQWDAPNGWAPLQWVAVEGLEHYNQPKLAKEVGLR
E6WBA5_PANSA          ERTAAAVEKQLLKPGGLVTTTVNNGQQWDAPNGWAPLQWVAVTGLEHYKQPQLAQQIGQR
U3U2B6_9ENTR          ERTAAAVEKQLLKPGGLVTTTVNNGQQWDAPNGWAPLQWVAVEGLEHYKQNQLAQQIGQR
TREA_RALSO            RQTLRQTQTALLQVGGLSTTTLHTQQQWDAPNGWAPLQWIALQASQHYGQALLAQTIGER
Q63MI6_BURPS          KQTAKNVQKALLKPGGLATTTYDTAQQWDAPNGWAPLHWIALVGLRHYGEKSLADDIGTR
C5AJQ3_BURGB          ISTAQHVRDTLLQPGGLATTTRNTGQQWDAPNGWAPLQWIAIQGLTRYGERPLADEIGKR
A4JPU7_BURVG          KATAREVRKTLLQPGGLATTTQNTGQQWDAPNGWAPLQWIAIEGLRRYGEPALAKDIGTR
B4EFD2_BURCJ          KATAREVRKTLLQPGGLATTTENTGQQWDAPNGWAPLQWIAIDGLRRYGEPALAKDIGTR
G8MN45_9BURK          HKTAETVEALLLKPGGLTTTTYNTTQQWDAPNGWAPLHWIAVQGLRRYGRGDLAQQIGTR
B2JMW7_PARP8          HKTANVVAAVLLEPGGLTTSTYDTTQQWDAPNGWAPLHWVAIEGLRRYGRSDLAQQIGTR
B2TBQ7_PARPJ          LKTAKQVQSTLLQPGGLVTTTYNTTQQWDAPNGWAPLHWAAIQGLKRYGQDALAQQIGTR
D5WLI8_BURSC          WKTAQTVQSVLLKQGGLATSIYNTTQQWDAPNGWAPLHWIAIQGLKRYGRAELAQSIGTR
E6WW24_PSEUU          SRTAAAVRAQLLKPGGLLTTAIDSGQQWDAPNVWAPLQWIAVDGLRRYGDDALAREIAAA
TREA_PSEAE            GRTADSVAAQLLRPGGLATTTRASGQQWDEPNGWAPLQWVAVQGLRAYGRDALAEDIGRR
TREA_XANCP            KRTATSVRARLLRPGGLATTALKTGQQWDEPNGWAPLQWVAVDGLRRYGEDGLARTIGER
A1TIN8_ACIAC          KRSADTVQAQLLRPGGLATTSLHTGQQWDEPNGWAPLQWIAVDGLRRYGQDALAQCIGTR
D2UGD8_XANAP          KRSADTVQAQLLRPGGLATTRLHTGQQWDEPNGWAPLQWIAVDGLRRYGQDAIAQRIGSR
                                **  **: *:   . **** ** ****:* *  .   *    :*  :   

Q2NRR4_SODGM          FLGNVQRLYNNQHKLVEKYVVEGSGL--GGGGGEYPLQDGFGWTNGVTLKLMVMYCGKSQ
W0HQK1_9GAMM          FLGNVQRLYNNQHKLVEKYVVEGSGLG-GGGGGEYPLQDGFGWTNGVTLKLMVMYCGQSQ
G7LVI6_9GAMM          FLVNVQKLYDAEHKLVEKYVVEGAGFGSGGGGGEYTLQDGFGWSNGVTLKLMARYCDAVP
I2B8P0_SHIBC          FVTNVQHTFDRQQKLVEKYDVSSTGT--GGGGGEYPLQDGFGWSNGVTLKILDLLCGREK
A0A0J5M769_PLUGE      FLTNVQHTYDREKKLVEKYDITRTGT--GGGGGEYPLQDGFGWSNGVTLMMLDKVCPKAK
A6TAV8_KLEP7          FLTNVQHTYDSKQKLVEKYDVSSTGT--GGGGGEYPLQDGFGWTNGVTLKMLDLICPQEK
E3G4E8_ENTLS          FLTNVQHTYDREKKLVEKYDVNTTGT--GGGGGEYPLQDGFGWTNGVTLKMLDLICPKEK
A7MKC8_CROS8          FLTNVQHTYNREQKLVEKYDVSSTGT--GGGGGEYPLQDGFGWTNGVTLKMLDLLCGTEK
TREA_SHIDS            FLTNVQHTYDREKKLVEKYDVSTTGT--GGGGGEYPLQDGFGWTNGVTLKMLDLICPKEQ
TREA_ECOLI            FLTNVQHTYDREKKLVEKYDVSTTGT--GGGGGEYPLQDGFGWTNGVTLKMLDLICPKEQ
D2TLZ9_CITRI          FLTNVQHTYDREQKLVEKYDVSSTGT--GGGGGEYPLQDGFGWSNGVTLKMLDLICPQEK
TREA_SALTY            FLTNVQHTYDREKKLVEKNDVSSTGT--GGGGGEYPLQDGFGWTNGVTLKMLDLICPQEK
TREA_CITK8            FLTNVQHTYDREQKLVEKYDVSSTGT--GGGGGEYPLQDGFGWTNGVTLKMLDLICPKEK
R9VFY2_9ENTR          FLTNVQHTYDREKKLVEKYDVSTTGT--GGGGGEYPLQDGFGWTNGVTLKMLDLICPKEK
A0A0H3CHG0_ENTCC      FLKNVQHTYDREQKLVEKYDVSSTGT--GGGGGEYPLQDGFGWSNGVTLKMLDLVCPKEK
A4WBE4_ENT38          FLTNVQHTYDREQKLVEKYDVSTTGT--GGGGGEYPLQDGFGWTNGVTLKMLDLVCPKEK
B2VDT8_ERWT9          FLNSVQTTYEKDHKLVEKYVVKGVSL---THGGEYPLQDGFGWTNAVTLKLMDLYCPKGT
D8MQZ3_ERWBE          FLQNVQATYDKEHKLVEKYVVEGKGLG-GGGGGEYPLQDGFGWTNGVTLKLMDLYCPKNS
E1SAD0_PANVC          FLQNVQTTYDREHKLVEKYVVDGKNLG-GGGGGEYPLQDGFGWTNGVTLKLLDKYCPKDK
E6WBA5_PANSA          FLQNVQMTYDKEHKLVEKYVVEGAKLG-GGGGGEYPLQDGFGWTNGVTLMLLDKYCPKEK
U3U2B6_9ENTR          FLQNVQQTYDREHKLVEKYVVDGAQLG-GGGGGEYPLQDGFGWTNGVTLKLLDKYCPKNK
TREA_RALSO            FLGSVERLYAAEQKLVEKYIVDGSGT--GGGGGEYPLQDGFGWTNGVTLRLLDAYGRGQ-
Q63MI6_BURPS          FLADVKGVYAAQGKLVEKYIVEGVGT--GGGGGEYPLQDGFGWTNGVTLKLLDLYGG---
C5AJQ3_BURGB          FLADVKGVYAREGKLVEKYVVEGAGV--GGGGGEYPLQDGFGWTNGVTAKLLDRYGQ---
A4JPU7_BURVG          FLADVKHVYATEGKLVEKYVVEGAGEG-GGGGGEYPLQDGFGWTNGVTLKLLGLYGE---
B4EFD2_BURCJ          FLSDVKHVYATEGKLVEKYVVEGTGTG-GGGGGEYPLQDGFGWTNGVTLKLLGLYGE---
G8MN45_9BURK          FLADVNNVYKTQQKLVEKYIVEGEGTG-GGGGGEYPLQDGFGWTNGVTLKLLDLYAPGQ-
B2JMW7_PARP8          FLADVKNVYAKEQKLVEKYVVEGSGTG-GGGGGEYPLQDGFGWTNGVTLKLLDLYAPGE-
B2TBQ7_PARPJ          FLSDVKGVYASDQKLVEKYVVEGSGTG-GGGGGEYPLQDGFGWTNGVTLKLLDLYSPGD-
D5WLI8_BURSC          FLADVQNVYNTQQKLVEKYVVEGAGEG-GGGGGEYPLQDGFGWTNGVTLMLLDLYGNGQ-
E6WW24_PSEUU          FVGNVRTLFEREHKLVEKYDADGALQ--GGGGGEYPLQDGFGWSNGVALALMALY-PGLG
TREA_PSEAE            FLAQVQQVYDREGKLVEKYDISGNQG--GGGGGEYPLQDGFGWSNGVTLQLLRLYGPGAG
TREA_XANCP            FLTQVQALFAREHKLVEKYGLDADAA--GGGGGEYALQDGFGWTNGVTLMLLNLYPSQGA
A1TIN8_ACIAC          FLTRVQALFAQQHKLVEKYAVDGQAK--GGGGGEYALQDGFGWTNGVTLLLMDLYAAPAA
D2UGD8_XANAP          FLARVQALFAQRHTLVEKYAVDGQTN--GGGGGEYPLQDGFGWTNGVTLLLLDLYAPGST
                      *:  *   :    .****             ****.*******:*.*:  ::        

Q2NRR4_SODGM          --DNVENVEALLAEADTSQRALVTS-----------------------------------
W0HQK1_9GAMM          --DNVENVEELLAEADSRQRALAAS-----------------------------------
G7LVI6_9GAMM          ACRREERSASGRDAAQ--------------------------------------------
I2B8P0_SHIBC          PCDNAPRPATASSQ----------------------------------------------
A0A0J5M769_PLUGE      PCDDVPKNRPTEPAAAANGAARS-------------------------------------
A6TAV8_KLEP7          PCDALPATRPATTPSPQDKPVAAPA---ANDPAPAEPQKTGS------------------
E3G4E8_ENTLS          PCDNVPASRPAPTATPAPAPAAEKTS----------------------------------
A7MKC8_CROS8          PCDDVPQTRPGSDSDHAPQPKQEGKMLSKPAQSSGPAKAETSAPAKTETSAPATTQTPAP
TREA_SHIDS            PCDNVPATRPLSESTTQPVKPKEAEPTL--------------------------------
TREA_ECOLI            PCDNVPATRPTVKSATTQPSTKEAQPTP--------------------------------
D2TLZ9_CITRI          PCDSVPATRPTASQTTAQPASKQATP----------------------------------
TREA_SALTY            PCDSVPSTRPASLSATPTKTPSAATQ----------------------------------
TREA_CITK8            PCDSVPATRPAAPGASQPAPQKQVETTP--------------------------------
R9VFY2_9ENTR          PCDSVPQTQPAQQAAAKVEPTTQPQKQQQAVAQ---------------------------
A0A0H3CHG0_ENTCC      PCDSVPQNQPAANDEAAPVKSTAQ------------------------------------
A4WBE4_ENT38          PCDSVPASQPAANDDVAPQSSTEKSAAQ--------------------------------
B2VDT8_ERWT9          ICNNVGDLNSKKEP----------------------------------------------
D8MQZ3_ERWBE          TCNNVSDITKTQ------------------------------------------------
E1SAD0_PANVC          TCNSAHDIPQASASQP--------------------------------------------
E6WBA5_PANSA          TCASAHDIPNMPTLTAAQP-----------------------------------------
U3U2B6_9ENTR          TCNSTRDIPSMPTLNAAK------------------------------------------
TREA_RALSO            ------------------------------------------------------------
Q63MI6_BURPS          ------------------------------------------------------------
C5AJQ3_BURGB          ------------------------------------------------------------
A4JPU7_BURVG          ------------------------------------------------------------
B4EFD2_BURCJ          ------------------------------------------------------------
G8MN45_9BURK          ------------------------------------------------------------
B2JMW7_PARP8          ------------------------------------------------------------
B2TBQ7_PARPJ          ------------------------------------------------------------
D5WLI8_BURSC          ------------------------------------------------------------
E6WW24_PSEUU          ETPVSIHEGPARRTEDTPAQ----------------------------------------
TREA_PSEAE            R-----------------------------------------------------------
TREA_XANCP            TQAPAKTKRKPEPAAP--------------------------------------------
A1TIN8_ACIAC          ARAASHAQAQTEAVAP--------------------------------------------
D2UGD8_XANAP          TSPQSQHQPVSEAMLEPAML----------------------------------------
                                                                                  

Q2NRR4_SODGM          --------------------------------------
W0HQK1_9GAMM          --------------------------------------
G7LVI6_9GAMM          --------------------------------------
I2B8P0_SHIBC          --------------------------------------
A0A0J5M769_PLUGE      --------------------------------------
A6TAV8_KLEP7          --------------------------------------
E3G4E8_ENTLS          --------------------------------------
A7MKC8_CROS8          AKTDTAAPASNSAPAENAPAAPNSNAQDNAAAQPAPAQ
TREA_SHIDS            --------------------------------------
TREA_ECOLI            --------------------------------------
D2TLZ9_CITRI          --------------------------------------
TREA_SALTY            --------------------------------------
TREA_CITK8            --------------------------------------
R9VFY2_9ENTR          --------------------------------------
A0A0H3CHG0_ENTCC      --------------------------------------
A4WBE4_ENT38          --------------------------------------
B2VDT8_ERWT9          --------------------------------------
D8MQZ3_ERWBE          --------------------------------------
E1SAD0_PANVC          --------------------------------------
E6WBA5_PANSA          --------------------------------------
U3U2B6_9ENTR          --------------------------------------
TREA_RALSO            --------------------------------------
Q63MI6_BURPS          --------------------------------------
C5AJQ3_BURGB          --------------------------------------
A4JPU7_BURVG          --------------------------------------
B4EFD2_BURCJ          --------------------------------------
G8MN45_9BURK          --------------------------------------
B2JMW7_PARP8          --------------------------------------
B2TBQ7_PARPJ          --------------------------------------
D5WLI8_BURSC          --------------------------------------
E6WW24_PSEUU          --------------------------------------
TREA_PSEAE            --------------------------------------
TREA_XANCP            --------------------------------------
A1TIN8_ACIAC          --------------------------------------
D2UGD8_XANAP          --------------------------------------