CLUSTAL format seed alignment for MF_01062

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PSRP_DESPS        ----------------------------MKNIRH------IYYVSENTGLLAKDSGKSLL
E8REH6_DESPD      ----------------------------MATTQD------VYYVSGSTAILAEDMGKALL
D6Z2G1_DESAT      ----------------------------MWNSKD------IYFVSDSTGILATNLGHAMI
D3SE90_THISK      --------------------------MADPRCPQ------VYLISDGTGITAETLARSLF
F9ZS74_ACICS      -------------------------MSESERERS------VFFVSDRTGLTASSYGKSLL
PSRP_THIDA        -----------------------------MNGYS------VFCVSDHTGLTIEAVAKSVL
PSRP_DEIRA        -------------------------MSGWGMPRP------VFIVSDHTGLTAENIARALL
PSRP_DEIGD        ---------------------------MTPPSRT------VLIVSDHTGLTAETTARALL
G0HCX4_CORVD      --------------------------MVDTTGRP------VYFVSDSTGITADTLGNALL
B8H8F1_PSECP      ---------------MPDTPWRDTVGTGSTSVPT------VFFLSDSTGITAETLGNTLL
F0M692_PSEPM      ----------------------------------------MFFLSDSTGITAETLGNTLL
E6SFI1_INTC7      -----------------------MSAPDSVTETP------VFFLAGGTGISAETLGNLML
F5XSM2_MICPN      -----------------MGFSTSERTAGSPSTVP------VFFLSDSTGISAETMGNALL
D2S7N8_GEOOG      ----------------MPWSPSPGSDPASHPDRHAQAVVPVFFLSDSTGISAETMGNALL
PSRP_NITEU        -----------------------------MLQRS------VFFLSDRTGITAETLGHSLL
PSRP_NITEC        -----------------------------MLQRS------VFFLSDRTGITAETLGHSLL
PSRP_THIRO        ------------------------------MNRT------VFFVSESTGITAETLGHSLL
PSRP_CHRVO        ----------------------------MSHHRS------AFFISDRTGITAESLGHTLL
PSRP_LARHH        ----------------------------MPHRRS------AYFVSDRTGITAESLGNALL
PSRP_DICNV        -----------------------------MPRRT------AFFISDRTGITVESMGDALL
PSRP_NEIG1        ----------------------------MSSPRQ------VFYISDRTGLTAENIGEALL
PSRP_NEIG2        ----------------------------MSSPRQ------VFYISDRTGLTAENIGEALL
PSRP_NEIMB        ----------------------------MSSPRH------VFYISDRTGLTAENIGEALL
PSRP_NEIMF        ----------------------------MSSPRH------VFYISDRTGLTAENIGEALL
PSRP_NEIM0        ----------------------------MSSPRH------VFYISDRTGLTAENIGEALL
PSRP_NEIMA        ----------------------------MSSPRH------VFYISDRTGLTAENIGEALL
PSRP_LEGPA        ------------------------------MKRY------VFMLSDGTGITAETLGNSLI
PSRP_LEGPH        ------------------------------MKRY------VFMLSDGTGITAETLGNSLI
PSRP_LEGPC        ------------------------------MKRY------VFMLSDGTGITAETLGNSLI
PSRP_LEGPL        ------------------------------MKRY------VFMLSDGTGITAETLGNSLI
PSRP_CHRSD        ------------------------------MSRT------AFFISDGTGITAETLGRSLL
PSRP_PSEU5        ------------------------------MKRT------AFFISDGTGITAETLGQSLL
PSRP_AZOVD        ------------------------------MKRT------AFFISDGTGITAETLGQSLL
PSRP_PSEAE        ----------------------------MQMKRT------AFFISDGTGITAETLGQSLL
PSRP_PSEA8        ----------------------------MQMKRT------AFFISDGTGITAETLGQSLL
PSRP_PSEAB        ----------------------------MQMKRT------AFFISDGTGITAETLGQSLL
PSRP_PSEMY        ------------------------------MKRT------AFFISDGTGITAETLGQSLL
PSRP_PSEE4        ------------------------------MKRT------AFFISDGTGITAETLGQSLL
PSRP_PSEPW        ------------------------------MKRT------AFFISDGTGITAETLGQSLL
PSRP_PSEPG        ------------------------------MKRT------AFFISDGTGITAETLGQSLL
PSRP_PSEP1        ------------------------------MKRT------AFFISDGTGITAETLGQSLL
PSRP_PSEPK        ------------------------------MKRT------AFFISDGTGITAETLGQSLL
PSRP_PSE14        ------------------------------MKRS------AFFISDGTGITAETLGQSLL
PSRP_PSEU2        ------------------------------MKRS------AFFISDGTGITAETLGQSLL
PSRP_PSESM        ------------------------------MKRS------AFFISDGTGITAETLGQSLL
PSRP_PSEFS        ------------------------------MKRS------AFFISDGTGITAETLGQSLL
PSRP_PSEPF        ------------------------------MKRS------AFFISDGTGITAETLGQSLL
PSRP_PSEF5        ------------------------------MKRS------AFFISDGTGITAETLGQSLL
PSRP_MARHV        ------------------------------MKRT------AFFISDGTGLTAEALGHALL
PSRP_HAHCH        ------------------------------MKRT------AFFISDGTGITAEALGQSLL
PSRP_ALCBS        ------------------------------MKRT------AFYLSDGTGITAETLGHSML
PSRP_PSYCK        --------------------MKALEVDNAQNIRT------AFFISDGTAITAETLGRAIL
PSRP_PSYA2        --------------------MKALEVDNAQNIRT------AFFISDGTAITAETLGRAIL
PSRP_ACIB3        ------------------------MSESKQFKRS------VFFISDGTAITAETLGHSLL
PSRP_ACIBY        ------------------------MSESKQFKRS------VFFISDGTAITAETLGHSLL
PSRP_ACIBS        ------------------------MSESKQFKRS------VFFISDGTAITAETLGHSLL
PSRP_ACIBT        ------------------------MSESKQFKRS------VFFISDGTAITAETLGHSLL
PSRP_ACIB5        ------------------------MSESKQFKRS------VFFISDGTAITAETLGHSLL
PSRP_ACIAD        ------------------------MSEGKLIKRS------VFFISDGTAITAETLGHSLL
PSRP_PHOPR        -------------------------MQRKSNFRD------VFYVSDGTAITSETLGHAVL
PSRP_VIBVU        -------------------------MQTEKQSRD------VFYVSDGTAITCETLGHVVL
PSRP_VIBVY        -------------------------MQTEKQSRD------VFYVSDGTAITCETLGHVVL
PSRP_VIBC3        -------------------------MQMESQRRD------VFYVSDGTAITCETLGHVVL
PSRP_VIBCM        -------------------------MQMESQRRD------VFYVSDGTAITCETLGHVVL
PSRP_VIBCH        -------------------------MQMESQRRD------VFYVSDGTAITCETLGHVVL
PSRP_VIBA3        -------------------------MQIDIQSRD------VFYVSDGTAITCETLGHVVL
PSRP_VIBCB        -------------------------MQINSQSRD------VFYVSDGTAITCETLGHVVL
PSRP_VIBPA        -------------------------MQINNQSRD------VFYVSDGTAITCETLGHVVL
PSRP_IDILO        -------------------------------MRY------AFYISDGTALTAEAFGHALL
PSRP_ALTMD        -------------------------------MRT------AFYISDGTAITAEVFGHALL
PSRP_PSEA6        -------------------------------MRT------AYYISDGTAITSEVFGHALL
PSRP_COLP3        -------------------------------MRS------AFYISDGTAITSEVFGHALL
PSRP_PSET1        -------------------------------MRT------AFYISDGTAITSEVFGHATL
PSRP_AERS4        -------------------------------MHT------VFYVSDGTAITAEVFGHAVL
PSRP_AERHH        -------------------------------MHT------VFYVSDGTAITAEVFGHAVL
PSRP_SHEPW        ------------------------------MLRK------VFYISDGTAITAEVFGHAVL
PSRP_SHEPA        ------------------------------MLRK------VFYISDGTAITAEVFGHAVL
PSRP_SHEHH        ------------------------------MLRK------VFYISDGTAITAEVFGHAVL
PSRP_SHELP        ------------------------------MSRK------VFYISDGTAITAEVFGHAVL
PSRP_SHESH        ------------------------------MLRK------VFYISDGTAITAEVFGHAVL
PSRP_SHEWM        ------------------------------MLRK------VFYISDGTAITAEVFGHAVL
PSRP_SHEAM        ------------------------------MARK------VFYISDGTAITAEVFGHAVL
PSRP_SHEB2        ------------------------------MAPK------VFYISDGTAITAEVFGHAVL
PSRP_SHEB8        ------------------------------MAPK------VFYISDGTAITAEVFGHAVL
PSRP_SHEB5        ------------------------------MAPK------VFYISDGTAITAEVFGHAVL
PSRP_SHEB9        ------------------------------MAPK------VFYISDGTAITAEVFGHAVL
PSRP_SHESW        ------------------------------MAPK------VFYISDGTAITAEVFGHAVL
PSRP_SHEPC        ------------------------------MAPK------VFYISDGTAITAEVFGHAVL
PSRP_SHEON        ------------------------------MAPK------VFYISDGTAITAEVFGHAVL
PSRP_SHESM        ------------------------------MAPK------VFYISDGTAITAEVFGHAVL
PSRP_SHESR        ------------------------------MAPK------VFYISDGTAITAEVFGHAVL
PSRP_SHESA        ------------------------------MAPK------VFYISDGTAITAEVFGHAVL
PSRP_SHEDO        ------------------------------MAPR------VFYISDGTAITAEVFGHAVL
PSRP_SHEFN        ------------------------------MTPK------VFYISDGTAITAEVFGHAVL
PSRP_ENTAG        -------------MAHAECSLLSEADFVMTTDRS------VFYISDGTAITAEVLGHAVL
PSRP_ERWT9        --------------------------MDVNTERS------VFYISDGTAITAEVLGHAVM
PSRP_KLEP3        --------------------------MESAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_KLEP7        --------------------------MESAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ENT38        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_CITK8        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALG2        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALA4        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALCH        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALDC        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALEP        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALHS        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALNS        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALPA        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALPB        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALPC        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALPK        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALSV        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALTI        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SALTY        --------------------------MDNVVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ESCF3        --------------------------MDSAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECO7I        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SHIB3        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SHIBS        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECOL5        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECOLI        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECO24        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECO27        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECO45        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECO55        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECO57        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECO5E        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECO81        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECO8A        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECOBW        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECODH        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECOHS        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECOK1        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECOL6        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECOLC        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECOSE        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECOSM        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECOUT        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SHIDS        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SHIF8        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SHIFL        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_SHISS        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_ECOLU        --------------------------MDNAVDRH------VFYISDGTAITAEVLGHAVM
PSRP_PHOLL        ----------MAKFRLETSAERNGRNSVEGVERT------VFFISDGTAITAEVLGHAVL
PSRP_SODGM        ------------------------------MERS------VFFISDGTAITAEVVGHSVL
PSRP_PECAS        ------------------------------MERS------VFYVSDGTAITAEVLGHAVL
PSRP_YERE8        ------------------------------MERS------VFYISDGTAITAEVLGHAVL
PSRP_YERP3        ------------------------------MERC------VFYISDGTAITAEVLGHAVL
PSRP_YERPA        ------------------------------MERC------VFYISDGTAITAEVLGHAVL
PSRP_YERPY        ------------------------------MERC------VFYISDGTAITAEVLGHAVL
PSRP_YERPN        ------------------------------MERC------VFYISDGTAITAEVLGHAVL
PSRP_YERPS        ------------------------------MERC------VFYISDGTAITAEVLGHAVL
PSRP_YERPB        ------------------------------MERC------VFYISDGTAITAEVLGHAVL
PSRP_YERPE        ------------------------------MERC------VFYISDGTAITAEVLGHAVL
PSRP_YERPP        ------------------------------MERC------VFYISDGTAITAEVLGHAVL
PSRP_NITMU        --------------------MPIMPITPKPIRRT------AFFLSDRTGITVEMLGHSLL
PSRP_METFK        -----------------------------MQKRS------VFFISDGTGITAESVGH-LL
PSRP_DECAR        --------------------------MPTTIKRT------VFFVSDGTGLTVEALGHSLM
PSRP_AROAE        --------------------------MSDTPIRT------VFFISDGTGITAETLGHSLL
PSRP_AZOSB        --------------------------MSTLPIRT------VFFISDGTGITAETLGHSLL
PSRP_BORA1        -------------------------MSASSIART------VYIVSDSTGITAETFSQSVL
PSRP_BORPE        -------------------------MTSTPIERA------VYIVSDSTGITAETFSHSVL
PSRP_BORPA        -------------------------MTSTPIERA------VYIVSDSTGITAETFSHSVL
PSRP_BORBR        -------------------------MTSTPIERA------VYIVSDSTGITAETFSHSVL
PSRP_JANMA        --------------------MSQPVERSPASTRT------VFFVSDGTGITAETFGHSVL
PSRP_HERAR        --------------------MSTSANRSTPSART------VFFISDGTGITAETFGHSVL
PSRP_PARXL        ------------------------------MPPT------VFIVSDGTGITAETFAHSIL
PSRP_PARPJ        ------------------------------MPPT------VFIVSDGTGITAETFAHSIL
PSRP_BURMA        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURPS        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURP6        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURP0        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURP1        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURM7        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURMS        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURM9        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURTA        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURVG        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURL3        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURCJ        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURCH        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURCC        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURCA        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURM1        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURA4        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_BURCM        ------------------------------MLPT------VFIVSDGTGITAETFAHSIL
PSRP_RALSO        ----------------------MTDLAAKPGIRT------VFIVSDGTGITAETFSHSIL
PSRP_CUPMC        -------------------------------MRT------VFIVSDGTGITAETFSHSIL
PSRP_CUPPJ        MSEPVAPDGAQPAPAGATPQPLQPIAGDRPATRT------VFIVSDGTGITAETFSHSIL
PSRP_CUPNH        ----------------------------------------MFIVSDGTGITAETFSHSIL
PSRP_METPP        -----------------------------MPNRT------VFFVSDGTGITAETFGNSIL
PSRP_LEPCP        -----------------------------MPNRT------VFFVSDGTGITAETFGNSIL
PSRP_DELAS        -----------------------------MHTHT------IFVISDGTGITAETFGTAIM
PSRP_RHOFT        -----------------------------MSQRT------VFFISDGTGITAETFGNAIL
PSRP_POLSJ        -----------------------------MSQRT------VFFISDGTGITAETFGNAIL
PSRP_POLNA        -----------------------------MSNRT------VFFISDGTGITAETFGNAIL
PSRP_VARPS        -----------------------------MHTRT------VFFISDGTGITAETFGNAVL
PSRP_VEREI        -----------------------------MHSRT------VFFVSDGTGITAETFGNAIL
PSRP_ACIET        --------------------------MLATHTRT------VFYISDGTGITAETFGNAIL
PSRP_ACISJ        --------------------------MLATHTRT------VFYISDGTGITAETFGNAIL
PSRP_ACIAC        -----------------------------MHTRT------VFFISDGTGITAETFGNAIL
PSRP_XYLFT        ----------------------------MSTIRP------VFYVSDGTGITAETIGHSLL
PSRP_XYLF2        ----------------------------MSTIRP------VFYVSDGTGITAETIGHSLL
PSRP_XYLFA        ----------------------------MSTIRP------VFYVSDGTGITAETIGHSLL
PSRP_XYLFM        ----------------------------MSTIRP------VFYVSDGTGITAETIGHSLL
PSRP_XANC8        ----------------------------MSTIRP------VFYVSDGTGITAETIGHSLL
PSRP_XANCB        ----------------------------MSTIRP------VFYVSDGTGITAETIGHSLL
PSRP_XANCP        ----------------------------MSTIRP------VFYVSDGTGITAETIGHSLL
PSRP_XANOM        ----------------------------MSTIRP------VFYVSDGTGITAETIGHSLL
PSRP_XANOR        ----------------------------MSTIRP------VFYVSDGTGITAETIGHSLL
PSRP_XANAC        ----------------------------MSTIRP------VFYVSDGTGITAETIGHSLL
PSRP_XANC5        ----------------------------MSTIRP------VFYVSDGTGITAETIGHSLL
PSRP_STRMK        ----------------------------MSTIRP------VFYVSDGTGITAETIGHSLL
PSRP_STRM5        ----------------------------MSTIRP------VFYVSDGTGITAETIGHSLL
PSRP_ALKEH        ---------------------------MTEARRS------VYFISDRTGITAEALGHSLL
PSRP_HALHL        ----------------------------MTDVRR------VFFVSDRTGITAEALGHSLM
                                                             ::  *.:     .   :

PSRP_DESPS        CQFPGVEFQEELLPFIRTKDDAQRTINAIREKCGEE----KPIIFSTIFDPEINKILQH-
E8REH6_DESPD      AQFQDIRFREEKIPFIHTPDDARKALAHI--LQQSEGG--QPLVFCTIMDQETRDVFNC-
D6Z2G1_DESAT      RQFPEVSFHEERFPFILSREEAEKTLAYI--LQHSGGR--RPIIFSTIMDREIRRIFDH-
D3SE90_THISK      TQFPDLDPAWHRLPFVQTPGRLSSVFARIEAGPQ------PAVAVATLANVDLRQELRH-
F9ZS74_ACICS      AQFRGIRFTTRAVPFVDCLERAQAAAREIEECQARTGQ--RAIVFSTLVDEAAQRVIVR-
PSRP_THIDA        AQFPRIEFSLITLPFIDDAAKARAAAGRVAVTA-------RALVFSSLTDPALRAHFKD-
PSRP_DEIRA        THFPGQPLRYLRRPFTSDAQAAQAVVSEVEALA-ASGE--RPLIFTTTTQPDVLEALQT-
PSRP_DEIGD        AHFPSQSLKYLQRPFVASVEVARGVAREVAALAER-GE--RPLIFTTITEPAVMRELEA-
G0HCX4_CORVD      AQFPDLDWQRHHLPFIESVETARRAVDQITTKS-ADVPGHTPLIFVTVRDTAVAAELSK-
B8H8F1_PSECP      TQFPAQHLERRSIPFITTVEQAQEVVAVIDRVA-AAGP--RPIVFSTTVSLDVRAVLAR-
F0M692_PSEPM      TQFPARHLERRTIPFITTVEQAQEVVEVIDKLAD-TGP--RPIIFSTTVGSDIRAVLSR-
E6SFI1_INTC7      NQFPSVRFRRRKIPFITTPEIARQVVAEMDEAM-TDAV--TPLVFSTVADEEVRTELVK-
F5XSM2_MICPN      IQFPDLRFERRLIPFITTVEEARKVVATLDAAMDGPVT---PIAFSTTAVTEIRDVLHE-
D2S7N8_GEOOG      IQFPDVRFERTLIPFISTVEQAREVVAQLDAAM-AGPV--PPLVFTTAAVDEVREELLK-
PSRP_NITEU        TQFDGIEWKKHYASFLDSAAKAQAVIEQINTIAEQEGQ--PALVFSTLLDPVMLASIRR-
PSRP_NITEC        TQFDGIEWKKHYASFLDSAAKVQEIIDRINTIAKQEGQ--PSLVFSTLLDPVILASVRQ-
PSRP_THIRO        SQFDTIDFEQVYMPYINTDLRAKALTQRMQEAADRDGV--RPIVFATMLNNEIREILES-
PSRP_CHRVO        TQFDALDFQRETVPFVDTVEKARALAERISEIAERDHL--RPLVFTSIVNPEVREALRL-
PSRP_LARHH        TQFDMLEFKRETIPFIDTADKAMAVAEQIRQRAQSDHF--RPLVFVSIVNPFVREAIQV-
PSRP_DICNV        NQFE-VNLKRENHPFIDSPEKAHQLVNIINATAEKSAL--RPLVFSSIVDEEIRNIVKS-
PSRP_NEIG1        NQFGNLSFKRHTHPFVDTPEKARAVVEKVNRSRQENGQ--RPIAFVSVVDDEIRRIIKG-
PSRP_NEIG2        NQFGNLSFKRHTHPFVDTPEKARAVVEKVNRSRQENGQ--RPIAFVSVVDDEIRRIIKG-
PSRP_NEIMB        NQFGNLSFKRHTHPFVDTPEKARAVVEKVNRSRQENGQ--RPIAFVSVVDDEIRRIIKG-
PSRP_NEIMF        NQFGNLSFKRHTHPFVDTPEKARAVVEKVNRSRQENGQ--RPIAFVSVVDDEIRRIIKG-
PSRP_NEIM0        NQFGNLSFKRHTHPFVDTPEKARAVVEKVNRSRQENGQ--RPIAFVSVVDDEIRRIIKG-
PSRP_NEIMA        NQFGNLSFKRHTHPFVDTPEKARAVVEKVNRSRQENGQ--RPIAFVSVVDDEIRRIIKG-
PSRP_LEGPA        TQFENIQFEKITIPYIDSTHRAESVVLRINQCFSEQGT--KPLVFMTLVDPEIRQAIKK-
PSRP_LEGPH        TQFENIQFEKITIPYIDSTHRAESVVLRINQCFSEQGT--KPLVFMTLVDPEIRQAIKK-
PSRP_LEGPC        TQFENIQFEKITIPYIDSTHRAESVVLRINQCFSEQGT--KPLVFMTLVDPEIRQAIKK-
PSRP_LEGPL        TQFENIQFEKITIPYIDSTHRAESVVLRINQCFSEQGT--KPLVFMTLVDPEIRQAIKK-
PSRP_CHRSD        AQFEGVDLTLVVKPYIDTLEKAHDLAAIIAQTADRDGE--RPIVIDTIVDQSIRDIIAA-
PSRP_PSEU5        AQFENITFTKLTRPYIDTAEKARAMVQQINNAAEKDGG--RPIIFDTLVNQEIRDILAE-
PSRP_AZOVD        AQFENISFTKLTRPYIDTAEKARGMVQQINAAAERDGA--RPIIFDTVVNQEIRDILAK-
PSRP_PSEAE        AQFENISFVKLTRPYIDTEEKARAMVQQINNAAESDGA--RPIIFDTIVNRDIRAVLAQ-
PSRP_PSEA8        AQFENISFVKLTRPYIDTEEKARAMVQQINNAAESDGA--RPIIFDTIVNRDIRAVLAQ-
PSRP_PSEAB        AQFENISFVKLTRPYIDTEEKARAMVQQINNAAESDGA--RPIIFDTIVNRDIRAVLAQ-
PSRP_PSEMY        AQFENIQFTKLTRPYIDSIDKARAMVQQIDAAAERDGA--RPIIFDTIVNRDIRAILDT-
PSRP_PSEE4        AQFESIPFNKFTRPYIDTLDKARAMVQQINAAAERDGV--RPIIFDTIVNQDIREVMAT-
PSRP_PSEPW        AQFDSIPFNKFTRPYIDTPDKARTMVQQINAAAERDGM--RPIIFDTIVNQDIREILAT-
PSRP_PSEPG        AQFESIPFNKFTRPYIDSPDKARTMVQQINAAAERDGV--RPIIFDTIVNQDIREILAT-
PSRP_PSEP1        AQFESIPFNKFTRPYIDSPDKARAMVQQINAAAERDGV--RPIIFDTIVNQDIREILAT-
PSRP_PSEPK        AQFESIPFNKFTRPYIDSPDKARVMVQQINAAAERDGV--RPIIFDTIVNQDIREILAT-
PSRP_PSE14        AQFENITFNKFTRPYIDSVEKARAMVQQINNAADKDDV--RPIIFDTIVNQDIREILAT-
PSRP_PSEU2        AQFENITFNKFTRPYIDSVEKARAMVQQINNAADKDDV--RPIIFDTIVNQDIREILAT-
PSRP_PSESM        AQFENITFNKFTRPYIDSVEKARAMVQQINNAADKDDV--RPIIFDTIVNQDIREILAT-
PSRP_PSEFS        AQFENITFAKFTRPYIDSVDKARAMVQQINLAAEKDGF--RPIIFDTIVNQDIREILAT-
PSRP_PSEPF        AQFENITFSKFTRPYIDSVEKARAMVQQINKAAETDGF--RPIIFDTIVNQDIREILAT-
PSRP_PSEF5        AQFENVTFSKFTRPYIDSMEKARAMVQQINIAAEKDGH--RPIIFDTIVNQDIREILAT-
PSRP_MARHV        AQFEKIEFERVTVPYIDDEEKARDLVSRINKASEIDGE--RPLVFDTIVNGGIREIISR-
PSRP_HAHCH        AQFEFIEFEKITLPYIDSLEKARKAVARIDKASEIDGN--KPVIFDTIVNSEIRAEIRK-
PSRP_ALCBS        SQFGSIEFIQVTLPFVQSDEQTREAVARINKAAKEDGA--KPVVFSTLVNTDHRAILHG-
PSRP_PSYCK        SQFASVPFETRVLPYVDNLERAEDAVVQINTAYQRDGL--LPLVFDTIVSPEIREKINS-
PSRP_PSYA2        SQFASVPFETRVLPYVDNLERAEDAVVQINTAYQRDGL--LPLVFDTIVSPEIREKINS-
PSRP_ACIB3        AQFPNVDFDIHIMPYITTEEAAMAVVVEINKCQTRDGC--LPLVFDTLVDPHVREIINT-
PSRP_ACIBY        AQFPNVDFDIHIMPYITTEEAAMAVVVEINKCQTRDGC--LPLVFDTLVDPHVREIINT-
PSRP_ACIBS        AQFPNVDFDIHIMPYITTEEAAMAVVVEINKCQTRDGC--LPLVFDTLVDPHVREIINT-
PSRP_ACIBT        AQFPNVDFDIHIMPYITTEEAAMAVVVEINKCQTRDGC--LPLVFDTLVDPHVREIINT-
PSRP_ACIB5        AQFPNVDFDIHIMPYITTEEAAMAVVVEINKCQTRDGC--LPLVFDTLVDPHVREIINT-
PSRP_ACIAD        AQFPNVDFDIHIMPYITTEEAAMNIVEEINQCQSRDGT--LPLVFDTLVDPNVREIINT-
PSRP_PHOPR        GQFP-IEIHQTTHPFIETNERAKQVKTLVNQSHEKTGI--KPLVFYSIVIPDVKVIIEQ-
PSRP_VIBVU        GQFP-FVANEKTFPFVESEEKLTELIKHIEISFQTNGI--KPLVFFSLVLPDLKARLME-
PSRP_VIBVY        GQFP-FVANEKTFPFVESEEKLTELIKHIEISFQTNGI--KPLVFFSLVLPDLKARLME-
PSRP_VIBC3        GQFA-VQPNEKTFPFVESDEKLSELLKQIQRSYQLHGV--KPLVFFSMVIPEMRTRLLQ-
PSRP_VIBCM        GQFA-VQPNEKTFPFVESDEKLSELLKQIQRSYQLHGV--KPLVFFSMVIPEMRTRLLQ-
PSRP_VIBCH        GQFA-VQPNEKTFPFVESDEKLSELLKQIQRSYQLHGV--KPLVFFSMVIPEMRTRLLQ-
PSRP_VIBA3        GQFP-FEANEKTFPFVESEDKLSDLLKEIEISYRATGH--EPLVFFSIVIPEIKLKLLD-
PSRP_VIBCB        GQFS-LIPNEKTFPFVESEDKVADVIKEIEISYQRDGV--KPLVFFSIVVPEIREMLLK-
PSRP_VIBPA        GQFP-FIPNEKTFPFVESQDKVADVVKEIETSYQRNGV--KPLVFFSIVVPGVREMLLE-
PSRP_IDILO        SMFP-VNFEHKTLPFIDNQEKANEVCKTIKKAVSDSGE--PPLIFHTFVNEKLKAKITD-
PSRP_ALTMD        SLFP-VSFNHNTIPFVETEEQAHKVLQQISESFQDTGE--RPLVFYTIVNVDVRKIISK-
PSRP_PSEA6        SLFT-IEFEHITVPFVETEEQAKQVVKKISESFQDDGQ--RPLVFYTIVNTEVRKIISK-
PSRP_COLP3        SLFP-TEFEHHTISFIETTEKALAAKERINKATSRGGK--PALVFHTFVNNENREIIES-
PSRP_PSET1        SLFP-VEFNHKTIPFVETEEKAHQIKELINATAKRDGE--KPLIFFTFVNYNLTEIISS-
PSRP_AERS4        SQFP-LVFEQVTIPFVETLEKARQVRARIDEQFRQTGL--RPILFHTIVDPLVREEVLK-
PSRP_AERHH        SQFP-LAFEQITIPFVETLEKARQVRMRIDEQFRQTGV--RPILFHTIVDHQVREEVLK-
PSRP_SHEPW        SQFP-LEFDALTIPFVETEKKAEAVKAQINDCFITTGE--RPLVFHSIVKAEIRDIIYS-
PSRP_SHEPA        SQFP-LEFDALTIPFVETQEKAEAVKAQINDCFITTGE--RPLVFHSIVKAEIRDIIYS-
PSRP_SHEHH        SQFP-LEFDALTIPFVETEAKAEAVKAQINDCFITTGE--RPLVFHSIVKPEIRDVIYS-
PSRP_SHELP        SQFP-VEFEALTIPFVETTQKAEAVKAQINDCFITTGE--RPLVFHSIVKAEIRDIIYS-
PSRP_SHESH        SQFP-VEFDALTIPFVETEAKAHDVKLQINDCFITTGE--RPLVFHSIVKAEIRDIIYS-
PSRP_SHEWM        SQFP-VEFEALTIPFVETESKANEVKAQINDCFITTGE--RPLVFHSIVKAEIRDIIYS-
PSRP_SHEAM        SQFP-MEFEAITIPFVETNAKAEAVKKQINDSFITTGE--RPLVFHSIVKPEIRDVIYS-
PSRP_SHEB2        SQFP-LEFESLTIPFVETLTKAEQVKRQINDCFITTGE--RPLVFHSIVKAEIRDIIYS-
PSRP_SHEB8        SQFP-LEFESLTIPFVETLTKAEQVKRQINDCFITTGE--RPLVFHSIVKAEIRDIIYS-
PSRP_SHEB5        SQFP-LEFESLTIPFVETLTKAEQVKRQINDCFITTGE--RPLVFHSIVKAEIRDIIYS-
PSRP_SHEB9        SQFP-LEFESLTIPFVETLTKAEQVKRQINDCFITTGE--RPLVFHSIVKAEIRDIIYS-
PSRP_SHESW        SQFP-LEFESLTIPFVETLAKAEQVKRQINDCFITTGE--RPLVFHSIVKAEIRDIIYS-
PSRP_SHEPC        SQFP-LEFESLTIPFVETLAKAEQVKRQINDCFITTGE--RPLVFHSIVKAEIRDIIYS-
PSRP_SHEON        SQFP-LEFESLTIPFVETLAKAENVKRQINDCFITTGE--RPLVFHSIVKPEIRDIIYS-
PSRP_SHESM        SQFP-LEFESLTIPFVETLAKAENVKRQINDCFITTGE--RPLVFHSIVKPEIRDIIYS-
PSRP_SHESR        SQFP-LEFESLTIPFVETLAKAENVKRQINDCFITTGE--RPLVFHSIVKPEIRDIIYS-
PSRP_SHESA        SQFP-LEFESLTIPFVETLAKAENVKRQINDCFITTGE--RPLVFHSIVKPEIRDIIYS-
PSRP_SHEDO        SQFP-IEFEALTIPFVETLVKAEKVKLQINDCFITTGE--RPLVFHSIVNPDIRNVIYS-
PSRP_SHEFN        SQFP-IEFEALTIPFVETIQKAQKVKQQINDCFITTGE--RPLVFHSIINPEIRNVIFS-
PSRP_ENTAG        SQFP-VNITSLTLPFVENVQRALAVKAQINALYQQSGV--RPLVFFSIVTPEVRDIIVQ-
PSRP_ERWT9        SQFP-VATHGVTLPFVETVQRAQAVKAQINALYQQSGL--RPLVFISIVTPVIRDIILQ-
PSRP_KLEP3        SQFP-VAISSVTLPFVENISRARAVKEQIDAIYQQTGI--RPLVFYSIVIPEIRDIILQ-
PSRP_KLEP7        SQFP-VAISSVTLPFVENISRARAVKEQIDAICQQTGI--RPLVFYSIVIPEIRDIILQ-
PSRP_ENT38        SQFP-VAINSITLPFVENESRAKAVKEQIDAIFQQTGT--RPLVFYSIVIPEIRDIILQ-
PSRP_CITK8        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALG2        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALA4        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALCH        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALDC        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALEP        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALHS        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALNS        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALPA        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALPB        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALPC        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALPK        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALSV        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALTI        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SALTY        SQFP-VTISSITLPFVENESRARAVKDQIDAIYQQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ESCF3        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECO7I        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SHIB3        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SHIBS        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECOL5        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILR-
PSRP_ECOLI        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECO24        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECO27        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECO45        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECO55        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECO57        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECO5E        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECO81        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECO8A        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECOBW        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECODH        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECOHS        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECOK1        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECOL6        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECOLC        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECOSE        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECOSM        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECOUT        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SHIDS        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SHIF8        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SHIFL        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_SHISS        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILQ-
PSRP_ECOLU        SQFP-VTISSITLPFVENESRARAVKDQIDAIYHQTGV--RPLVFYSIVLPEIRAIILE-
PSRP_PHOLL        SQFP-IKITSYTLPFVASETRAEEIKQQINQIYQDTRI--RPLVFYSIISSGVKNIITS-
PSRP_SODGM        SQFP-LTTALYTLPFVESETRARAVREQINALYQQSGV--RPLVFYSIVTPAVRHIIEE-
PSRP_PECAS        SQFP-VNTVSYTLPFVESEVRAKAVCEQINTLYQQTGV--RPLVFYSIVTPTVRNIITS-
PSRP_YERE8        SQFP-VKATTFTLPFVESATRAQEVCEKINEIYRETGV--RPLVFYSIISPEVRELIQH-
PSRP_YERP3        SQFP-INVTTFTLPFVENAARAQSVCKQINEIYQDTGV--RPLVFYSIISLEVREIIQR-
PSRP_YERPA        SQFP-INVTTFTLPFVENAARAQSVCKQINEIYQDTGV--RPLVFYSIISLEVREIIQR-
PSRP_YERPY        SQFP-INVTTFTLPFVENAARAQSVCKQINEIYQDTGV--RPLVFYSIISLEVREIIQR-
PSRP_YERPN        SQFP-INVTTFTLPFVENAARAQSVCKQINEIYQDTGV--RPLVFYSIISLEVREIIQR-
PSRP_YERPS        SQFP-INVTTFTLPFVENAARAQSVCKQINEIYQDTGV--RPLVFYSIISLEVREIIQR-
PSRP_YERPB        SQFP-INVTTFTLPFVENAARAQSVCKQINEIYQDTGV--RPLVFYSIISLEVREIIQR-
PSRP_YERPE        SQFP-INVTTFTLPFVENAARAQSVCKQINEIYQDTGV--RPLVFYSIISLEVREIIQR-
PSRP_YERPP        SQFP-INVTTFTLPFVENAARAQSVCKQINEIYQDTGV--RPLVFYSIISLEVREIIQR-
PSRP_NITMU        SQFENIPLDEITLPYIDSKAKATSAVRTINERYIADEA--RPLVFSTLVNPEIRLIINS-
PSRP_METFK        AHFPTVSFKHIRLPFTDSEQKVQEALLKIAETEKADGA--RPIVVMTLVNTDLRDMLKQ-
PSRP_DECAR        TQFEDIEFKQIRIPFLTSVEQAQEAVARINGQGESDGM--RPIVFTTLVNPELSSIVHQ-
PSRP_AROAE        AQFPGARFRQVRVPFVDDLDKALDCARQIRETAVTDGV--RPIVFSTLVNPDPLSGLRE-
PSRP_AZOSB        AQFPEARIRQVRAPFIDDLDKAIDCANQIREAARNDGV--RPIVFSTLVSPETVEALHK-
PSRP_BORA1        SQFDQVDFKPIRLPFIDTLQKAEETAERINKNAADTGV--PPIVFSTLVNPEILARVRQ-
PSRP_BORPE        SQFDEVNFKPVRLPFIDTLDKAREVVARINRNALEAGV--PPIVFSTLVNPEILALVRQ-
PSRP_BORPA        SQFDEVNFKPVRLPFIDTLDKAREVVARINRNALEAGV--PPIVFSTLVNPEILALVRQ-
PSRP_BORBR        SQFDEVNFKPVRLPFIDTLDKAREVVARINRNALEAGV--PPIVFSTLVNPEILALVRQ-
PSRP_JANMA        TQFE-LRFKQVRLPFIDTPDKAYDALRKINETFAADGQ--RPIIFSTLVKADLSSIVRQ-
PSRP_HERAR        TQFD-LRFKQIRLPFIDTLDKAHDALRKINDAYELDGQ--RPIIFSTLVKANLSKVVRQ-
PSRP_PARXL        SQFD-QKFRLVRVPFVDSTEKAYATLEKINEAILQDGR--RPIVFTTLVDSASNQIVKG-
PSRP_PARPJ        SQFD-QKFRLVRVPFVDSTEKAYATLEKINEAIVQDGR--RPIVFTTLVDSASNQIVKG-
PSRP_BURMA        SQFD-QKFRLVRVPFIDSIEKAYDTVRKINDAAQHDGR--RPIVFTTLVDGESNEIVKR-
PSRP_BURPS        SQFD-QKFRLVRVPFIDSIEKAYDTVRKINDAAQHDGR--RPIVFTTLVDGESNEIVKR-
PSRP_BURP6        SQFD-QKFRLVRVPFIDSIEKAYDTVRKINDAAQHDGR--RPIVFTTLVDGESNEIVKR-
PSRP_BURP0        SQFD-QKFRLVRVPFIDSIEKAYDTVRKINDAAQHDGR--RPIVFTTLVDGESNEIVKR-
PSRP_BURP1        SQFD-QKFRLVRVPFIDSIEKAYDTVRKINDAAQHDGR--RPIVFTTLVDGESNEIVKR-
PSRP_BURM7        SQFD-QKFRLVRVPFIDSIEKAYDTVRKINDAAQHDGR--RPIVFTTLVDGESNEIVKR-
PSRP_BURMS        SQFD-QKFRLVRVPFIDSIEKAYDTVRKINDAAQHDGR--RPIVFTTLVDGESNEIVKR-
PSRP_BURM9        SQFD-QKFRLVRVPFIDSIEKAYDTVRKINDAAQHDGR--RPIVFTTLVDGESNEIVKR-
PSRP_BURTA        SQFD-QKFRLVRVPFIDSIEKAYGTVQKIDDAAQHDGR--RPIVFTTLVDGESNEIVKR-
PSRP_BURVG        SQFD-QKFRLVRVPFVDSLEKAYSTVEKINEAAVHDGR--RAIVFTTLVDSVSNDIVKR-
PSRP_BURL3        SQFD-QKFRLVRVPFVDSLDKAYATVEKINEAAVHDGR--RAIVFTTLVDSESNDIVKR-
PSRP_BURCJ        SQFD-QKFRLVRVPFVDSLDKAYATVEKINEAAVHDGR--RAIVFTTLVDSESNDIVKR-
PSRP_BURCH        SQFD-QKFRLVRVPFVDSLDKAYATVEKINEAAVHDGR--RAIVFTTLVDSESNDIVKR-
PSRP_BURCC        SQFD-QKFRLVRVPFVDSLDKAYATVEKINEAAVHDGR--RAIVFTTLVDSESNDIVKR-
PSRP_BURCA        SQFD-QKFRLVRVPFVDSLDKAYATVEKINEAAVHDGR--RAIVFTTLVDSESNDIVKR-
PSRP_BURM1        SQFD-QKFRLVRVPFVDSLEKAYATVEKINEAAVHDGR--RSIVFTTLVDSESNEIVKR-
PSRP_BURA4        SQFD-QKFRLVRLPFVDSLEKAYATVEKINDAAVHDGR--RAIVFTTLVDSESNDIVKR-
PSRP_BURCM        SQFD-QKFRLVRLPFVDSLEKAYATVEKINDAAVHDGR--RAIVFTTLVDSESNDIVKR-
PSRP_RALSO        AQFE-MKFRQVRIPFVDTVDKAHVAVSKINEAFHVEGM--KPIVFTTLVDAEANRIVHQ-
PSRP_CUPMC        AQFE-MRFRKVRMPFVDTPDKAHVAVGKINEAFYNEGV--PPIVFTTLVNAESNKAIRR-
PSRP_CUPPJ        AQFE-MRFRKVRMPFVDTPEKAHIAVGKINEAFHTEGV--PPIVFTTLVNQEANKALRR-
PSRP_CUPNH        AQFE-MRFRKVRMPFVDTPEKAHIAVGKINEAFHNEGV--PPIVFTTLVNQEANKALRR-
PSRP_METPP        AQFS-AKPRHVRRPFIDTPDKAYQVVREINDTAGREGK--RPIVFITLIDTEVRGIIRS-
PSRP_LEPCP        AQFA-IKPRHVRRPFIDNAEKADQVITEINGAALAEGK--RPIVFITIVNDTVREKIGSH
PSRP_DELAS        AQFD-TKSRLVRIPFVDTMDKVHQAVRQINHVAESESH--KPIVFTTLVNQDMLDLIESQ
PSRP_RHOFT        AQFE-TNFRHVRLPFTDSVDKAHQAVREINHAGIVDGN--KSIVFTTLVDMEVLKVITDN
PSRP_POLSJ        AQFE-FKPRHVRLPFIDSVDKAHQAIRQINHAAEVEGK--RPIVFTTLVNMEILAVIKTH
PSRP_POLNA        AQFE-ISPRHVRLPFIDTVDKAHQAIRHINHTGELEGK--RPIVFTTLVNMDILAVLKAQ
PSRP_VARPS        AQFE-MKPRHVRLPFTDTVDKAHQAVRQINHTAELEGV--RPIVFTTLANMEVLEVIETG
PSRP_VEREI        AQFE-MKPRHVRLPFVDTVDKAHQAVRQINHCGEVEGK--KPIVFTTLVNMEVLKTLQDG
PSRP_ACIET        AQFD-IRPRHVRLPFIDTEDKAHQVVRQINHTAELEGK--KPIVFTTLVNMSVLKIIEDG
PSRP_ACISJ        AQFD-IRPRHVRLPFIDTEDKAHQVVRQINHTAELEGK--KPIVFTTLVNMSVLKIIEDG
PSRP_ACIAC        AQFD-IKPRHVRLPFIDTEDKAHQAVRRINHTAELEGK--KPIVFTTLVNMSVLRIIQEN
PSRP_XYLFT        TQFSGFTFVAERMVFIDDAEKARDASQRILAASERYRV--RPIVVNSCVNPYLSVILAE-
PSRP_XYLF2        TQFSGFTFVAERMVFIDDAEKARDASQRILAASERYRV--RPIVVNSCVNPYLSVILAE-
PSRP_XYLFA        TQFSGFTFVTERMVFIDDAEKARDASQRILAASQRYRV--RPIVVNSCVNPYLSVILAE-
PSRP_XYLFM        TQFSGFTFVTERMVFIDDAEKARDASQRILAASERYRV--RPIVVNSCVNPYLSVILAE-
PSRP_XANC8        TQFSGFNFVTDRMSFIDDADKARDAALRVRAAGERYQV--RPVVVNSCVDPQLSMILAE-
PSRP_XANCB        TQFSGFNFVTDRMSFIDDADKARDAALRVRAAGERYQV--RPVVVNSCVDPQLSMILAE-
PSRP_XANCP        TQFSGFNFVTDRMSFIDDADKARDAALRARAAGERYQV--RPVVVNSCVDPQLSMILAE-
PSRP_XANOM        TQFSGFNFVTDRMSFIDDAEKARDAAMRVRAAGERYQV--RPVVVNSCVDPQLSMILAE-
PSRP_XANOR        TQFSGFNFVTDRMSFIDDAEKARDAAMRVRAAGERYQV--RPVVVNSCVDPQLSMILAE-
PSRP_XANAC        TQFSGFNFVTDRMSFIDDADKARDAAMRVRAAGERYQV--RPVVVNSCVDPQLSMILAE-
PSRP_XANC5        TQFSGFNFVTDRMSFIDDADKARDAAMRVRAAGERYQV--RPVVVNSCVDPQLSMILAE-
PSRP_STRMK        TQFSGFSFITDRMSFVDDPEKAREACARIQAAGERYQV--RPIVVNSCVDQSLSLILAD-
PSRP_STRM5        TQFSGFSFITDRMSFVDDPEKAREACSRIQAAGERYQV--RPIVVNSCVDQSLSLILAE-
PSRP_ALKEH        TQFS-IDFEQRTIPFVDTEEKAAQVVEQLNVASQRSGL--RPIVFSTVVDAEVRRVLQT-
PSRP_HALHL        TQFS-VTTEQATIPFVDTAERARAALRRITAASAEDDH--PPIVFSTIIDPEVLAVLRE-
                    *           :                          .: . :         .   

PSRP_DESPS        EDVIL-LNICEPFLTQLEGMLGKNALRASGHSRNVDQQI---MSNRVDAIHYTISHDDG-
E8REH6_DESPD      PEVKF-FDIFLNTLELLEQALGVKALREPGYSRHFTISK---MNKRVDAIHFSLEHDDG-
D6Z2G1_DESAT      PEVEL-FDVFEAFLKRLEDSLETKALRVPGFSRQIDNIT---MAKRVEAIHFSLEHDDG-
D3SE90_THISK      SPVPV-IDVFGEQVGRLEEVLGVSAQSVSGRAHGMGDVT--RYDRRIEALNYTLSHDDG-
F9ZS74_ACICS      TGAFV-LNLFEAFIGPLEEELAQPSVHTLGRAFRPPGEG--VHQRWLDAMEFALAHDDG-
PSRP_THIDA        AGLHV-FDLFEHVSPAVERVLGEPATPSGGHTHGMAS----DYEARMDAVNFALRLDDG-
PSRP_DEIRA        APAQV-FDLLTENLRLLEGEFAEPPQLGAGGHHDMQDSE--AYLSRMEALDFALATDDG-
PSRP_DEIGD        APARV-FDLLGPGLIALEHEFGEKAARSVGRYHDMHDQT--SYLARMDALDFALATDDG-
G0HCX4_CORVD      APGEV-IDLLGTHLARLEDILGTERSGRATAYHRVGNME--RYHDRIDAVEFSIAHDDA-
B8H8F1_PSECP      SRGHF-FDLIGTHLGQLEQALHASASGQPGQAHGLGDAV--RYQSRMAAVEYAIEHDDG-
F0M692_PSEPM      SRGHF-FDLIGAHIGQLEQALHASASGQPGQAHGVGDAV--RYQSRMAAVEYAIEHDDG-
E6SFI1_INTC7      TKCAF-IDLFGSHLDAIERVLHVNASHNRAGLHGLGDPR--RYEQRMKAIEYAMEHDDG-
F5XSM2_MICPN      SRCPL-IDFFELHMSRVEEILGHPGQRVAARLHGLGDVK--RYNARMAAVEYAIEHDDG-
D2S7N8_GEOOG      TKAPI-IDFFGLHMSRVEEQLGARGLREARRLHGVGDVR--RYNDRMAAIEFAIEHDDG-
PSRP_NITEU        ADCVL-FDFFETCLGTLEAVLQQPPARIPGRSHVLRQDA--SYFRRIAAIQYALNSDDG-
PSRP_NITEC        ADCYL-IDFFESCLGVLETALQQSPVRIPGRSHILGQDA--SYFRRIAAIQYALNSDDG-
PSRP_THIRO        GNCYY-VELFEGFVEPLSRELGVPPSRKSGRSHAITKPS--YYTKRIEAINFAMANDDG-
PSRP_CHRVO        NNVVL-IDFFESFIGHLEIELGQKATLTVGKAHGMVNEE--KYDHRIEAVNFSLNHDDG-
PSRP_LARHH        DDCAMVIDFFHAFVGQLENELEQKATLTVGKSHGIISEE--KYDTRIEAVNFSLNHDDG-
PSRP_DICNV        SAGLH-LSFFDAFLGTLEKELGVSALQFSPRINSIINTE--RYDARMESLNFTLNHDDG-
PSRP_NEIG1        ADAFQ-INFFETFLGLLEKELNTEATVSGQGHHSIGNTK--RYDARMEAVNFSLNHDDG-
PSRP_NEIG2        ADAFQ-INFFETFLGLLEKELNTEATVSGQGHHSIGNTK--RYDARMEAVNFSLNHDDG-
PSRP_NEIMB        ADAFQ-INFFETFLGLLEKELNTEATASGQGHHSIGNTK--RYDARMEAVNFSLNHDDG-
PSRP_NEIMF        ADAFQ-INFFETFLGLLEKELNTEATASEQGHHSIGNTK--RYDARMEAVNFSLNHDDG-
PSRP_NEIM0        ADAFQ-INFFETFLGLLEKELNTEATASEQGHHSIGNTK--RYDARMEAVNFSLNHDDG-
PSRP_NEIMA        ADAFQ-INFFETFLGLLEKELNTEATASEQGHHSIGNTK--RYDARMEAVNFSLNHDDG-
PSRP_LEGPA        AHACV-FDLFSIFIGPLENELEEKSSYTVGRTHGVANVK--SYSHRIEAIDFALSHDDG-
PSRP_LEGPH        AHACV-FDLFSIFIGPLENELEEKSSYTVGRTHGVANVK--SYSHRIEAIDFALSHDDG-
PSRP_LEGPC        AHACV-FDLFSIFIGPLENELEEKSSYTVGRTHGVANVK--SYSHRIEAIDFALSHDDG-
PSRP_LEGPL        AHACV-FDLFSIFIGPLENELEEKSSYTVGRTHGVANVK--SYSHRIEAIDFALSHDDG-
PSRP_CHRSD        APGFK-VDIFSTFLAPLEEELATHSTYTVGRTHAIGRDD--VYMHRIDAVHFALDNDDG-
PSRP_PSEU5        SNGFM-IDIFSSFLAPLEHELMSRSSYSVGKSHSISHNT--NYMERIEAVNFALDNDDG-
PSRP_AZOVD        SNGFM-IDIFSTFLAPLEHELISHSSYSVGKSHSISHNA--HYMERIEAVNFALDNDDG-
PSRP_PSEAE        SNGFM-IDIFATFLSPLEQELSADSSYSVGKSHSIGHNS--NYMDRIEAVNFALDNDDG-
PSRP_PSEA8        SNGFM-IDIFATFLSPLEQELSADSSYSVGKSHSIGHNS--NYMDRIEAVNFALDNDDG-
PSRP_PSEAB        SNGFM-IDIFATFLSPLEQELSADSSYSVGKSHSIGHNS--NYMDRIEAVNFALDNDDG-
PSRP_PSEMY        ANGFM-IDIFSTFLSPLEQELSSHSSYSVGKSHSIGQHS--NYMERIEAVNFALDNDDG-
PSRP_PSEE4        SNGFM-IDIFSTFLSPLEQELTAHSSYSVGKSHSIGGNS--NYMERIEAVNFALDNDDG-
PSRP_PSEPW        SNGFM-IDIFSTFLSPLEQELTAHSSYSVGKSHSIGGNS--NYMERIEAVNFALDNDDG-
PSRP_PSEPG        SNGFM-IDIFSSFLSPLEQELTAHSSYSVGKSHSIGGNS--NYMERIEAVNFALDNDDG-
PSRP_PSEP1        SNGFM-IDIFSSFLSPLEQELIAHSSYSVGKSHSIGGNS--NYMERIEAVNFALDNDDG-
PSRP_PSEPK        SNGFM-IDIFSSFLSPLEQELIAHSSYSVGKSHSIGGNS--NYMERIEAVNFALDNDDG-
PSRP_PSE14        SNGFM-IDIFSTFLAPLEQELSSHSSYSVGKSHSIGHNS--NYMERIEAVNFALDNDDG-
PSRP_PSEU2        SNGFM-IDIFSTFLAPLEQELSSHSSYSVGKSHSIGHNS--NYMERIEAVNFALDNDDG-
PSRP_PSESM        SNGFM-IDIFSTFLAPLEQELSSHSSYSVGKSHSIGHNS--NYMERIEAVNFALDNDDG-
PSRP_PSEFS        SNGFM-IDIFSTFLAPLEQELSEHSSYSVGKSHSIGHNS--NYMERIEAVNFALDNDDG-
PSRP_PSEPF        SNGFM-IDIFSTFLAPLEQELTEHSSYTVGKSHSIGHNS--NYMERIEAVNFALDNDDG-
PSRP_PSEF5        SNGFM-IDIFSTFLAPLEQELSEHSSYSVGKSHSIGHNS--NYMERIEAVNFALDNDDG-
PSRP_MARHV        ADGFM-VDIFGTFLNPLEQELNSSSSYSVGKSHSINNAG--SYERRIHAVNFALDNDDG-
PSRP_HAHCH        SQGYM-IDIFGTFLEPLEQELGSKSTYTVGKSHSIVSNS--SYNRRIDAMNYALENDDG-
PSRP_ALCBS        CDALI-LDLFGAFLRPLEDELGVRSSHKINQSHAIRDAE--SYRIRINAVHFALDNDDG-
PSRP_PSYCK        AHSCN-LDMYEGLIGRVAEETGVEPDGHSGHAHDNVDSE--TYKERIDAVHFALDNDDG-
PSRP_PSYA2        AHSCN-LDMYEGLIGRVAEETGVEPDGHSGHAHDNVDSE--TYKERIDAVHFALDNDDG-
PSRP_ACIB3        AKAVN-LDVFEGLISKLEQELGTPPTTLVGQTHAVTDSE--YYKARIDAVHFALDNDDG-
PSRP_ACIBY        AKAVN-LDVFEGLISKLEQELGTPPTTLVGQTHAVTDSE--YYKARIDAVHFALDNDDG-
PSRP_ACIBS        AKAVN-LDVFEGLISKLEQELGTPPTTLVGQTHAVTDSE--YYKARIDAVHFALDNDDG-
PSRP_ACIBT        AKAVN-LDVFEGLISKLEQELGTPPTTLVGQTHAVTDSE--YYKARIDAVHFALDNDDG-
PSRP_ACIB5        AKAVN-LDVFEGLISKLEQELGTPPTTLVGQTHAVTDSE--YYKARIDAVHFALDNDDG-
PSRP_ACIAD        SKAVN-LDVFEGLISKLEQVLGTPPTTLVGQTHAVTDSE--YYKARIDAVHFALDNDDG-
PSRP_PHOPR        SNAHF-YDVLNVLVEPLKHDLQLEPEPQLQRSHSINKDA-ASYQDRIAAIEYTLAHDDG-
PSRP_VIBVU        SPAYC-YDVLESIVQRVKDDIQMEPTPKLQRSRSVGKDT-DTYFDRIAAIEYTLAHDDG-
PSRP_VIBVY        SPAYC-YDVLESIVQRVKDDIQMEPTPKLQRSRSVGKDT-DTYFDRIAAIEYTLAHDDG-
PSRP_VIBC3        APAHF-YDVLESIVQRVSLDIEMEPAPKLQRSRSVGKDS-DTYFDRIAAIEYTLAHDDG-
PSRP_VIBCM        APAHF-YDVLESIVQRVSLDIEMEPAPKLQRSRSVGKDS-DTYFDRIAAIEYTLAHDDG-
PSRP_VIBCH        APAHF-YDVLESIVQRVSLDIEMEPAPKLQRSRSVGKDS-DTYFDRIAAIEYTLAHDDG-
PSRP_VIBA3        APAHC-YDVLESIVQKVQDDTKMAPKPKLQRSRSVNKDS-DKYFDRIAAIEYTLAHDDG-
PSRP_VIBCB        APAHG-YDVLESIVQKVQDDIQMEPQPKMQRSRSVSKDS-DTYFDRIAAIEYTLAHDDG-
PSRP_VIBPA        APAYS-YDVLESIVQKVQDDIQMAPAPKLQRSRSVGKDS-DTYFDRIAAIEYTLAHDDG-
PSRP_IDILO        CGGIC-YDFLDHFIAPVEKELGVKAEPKTHRTHGVHKN----YNFRIDAINYALDNDDG-
PSRP_ALTMD        SVGIN-YNFLDQFVAPLEKVLGVPSKPEKHRTHSIHETT---YDIRIEAVNYALANDDG-
PSRP_PSEA6        SVGIN-YNFLDQFVAPLEIVLGVPSKPEKHRTHSIHEKT---YDIRIEAVNYALANDDG-
PSRP_COLP3        CDAVL-YNFLEPFVAPLEKELAIKAKPTTHRTHSIHEKS---YDYRIEAVNYALTNDDG-
PSRP_PSET1        ANAVC-YDFLTTYSEKIEKELNVAPVPKIHRTHSIHEKS---YDFRIDAVNYALMNDDG-
PSRP_AERS4        AQASG-HDFLNTFVSPLEQELGVKAEPRLHRTHGMENRK--LYDDRIEAVNFALANDDG-
PSRP_AERHH        AQASS-HDFLNTFVSPLEHELGVKAEPRLHRTHGMENRK--LYDDRIEAVNFALANDDG-
PSRP_SHEPW        SEGLD-YDFLNTFVAPLEKQLGMPATPALHRTHGKTNDS---YEARIEAINYAMENDDG-
PSRP_SHEPA        SEGLD-YDFLNTFVAPLEKQLGVAAAPALHRTHGKANES---YEARIDAINYAMENDDG-
PSRP_SHEHH        SEGLD-YDFLNTFVAPLEKQLGIAATPAMHRTHGKANEG---YEARIDAINYAMENDDG-
PSRP_SHELP        SECID-YDFLNTFVAPLEDQLGVKAVPVTHRTHGKANHS---YEARIDAINYAMENDDG-
PSRP_SHESH        SEGLD-YDFLNTFVAPLELQLGMKASPVVHRTHGKANEG---YEARIDAINYTMDNDDG-
PSRP_SHEWM        SEGLD-YDFLNTFVAPLEQQLGISATPVVHRTHGNMNES---YEARIDAINYAMDNDDG-
PSRP_SHEAM        SEGLD-YDFLNTFVAPLEQQLGVSAAPVLHRTHGKANHS---YEARIDAINFAMENDDG-
PSRP_SHEB2        SEGLD-YDFLNTFVAPLEQHLGVSASPVLHRTHGKANHG---YEARIDAINFAMDNDDG-
PSRP_SHEB8        SEGLD-YDFLNTFVAPLEQHLGVSASPVLHRTHGKANHG---YEARIDAINFAMDNDDG-
PSRP_SHEB5        SEGLD-YDFLNTFVAPLEQHLGVSASPVLHRTHGKANHG---YEARIDAINFAMDNDDG-
PSRP_SHEB9        SEGLD-YDFLNTFVAPLEQHLGVSASPVLHRTHGKANHG---YEARIDAINFAMDNDDG-
PSRP_SHESW        SEGVD-YDFLNTFVAPLEQHLGVSASPVVHRTHGKANHG---YEARIDAINFAMDNDDG-
PSRP_SHEPC        SEGVD-YDFLNTFVAPLEQHLGVSASPVVHRTHGKANHG---YEARIDAINFAMDNDDG-
PSRP_SHEON        SEGLD-YDFLNTFVAPLEQHLGVSASPVLHRTHGKANQG---YEARIDAINFAMDNDDG-
PSRP_SHESM        SEGLD-YDFLNTFVAPLEQHLGVSASPVLHRTHGKANHG---YEARIDAINFAMDNDDG-
PSRP_SHESR        SEGLD-YDFLNTFVAPLEQHLGVSASPVLHRTHGKANHG---YEARIDAINFAMDNDDG-
PSRP_SHESA        SEGLD-YDFLNTFVAPLEQHLGVSASPVLHRTHGKANHG---YEARIDAINFAMDNDDG-
PSRP_SHEDO        SEGMD-YDFLNTFVAPLEQHLGIQACPVLHRTHGKGNHS---YEARIDAINFSMENDDG-
PSRP_SHEFN        SECVD-YDFLNTFVAPLEQHLGVQAKPLLHRTHGKSNHG---YETRIDAINYTMENDDG-
PSRP_ENTAG        SDGFC-QDIVQALVAPLQQELGLSPAPVAHRTHGLDASNLGKYDARIAAIDYTLAHDDG-
PSRP_ERWT9        SDGFC-QDIVQSLVGPLQQELGLLPAPVANRTHGLTAGNLSKYDARIAAIDYTLAHDDG-
PSRP_KLEP3        SEGFC-QDIVQALVAPLQQELNLDPTPVAHRTHGLNPGNLIKYDARIAAIDYTLAHDDG-
PSRP_KLEP7        SEGFC-QDIVQALVAPLQQELNLDPTPVAHRTHGLNPGNLIKYDARIAAIDYTLAHDDG-
PSRP_ENT38        SEGFC-QDIVQALVAPLQGELKLDPTPIAHRTHGLNPGNLIKYDARIAAIDYTLAHDDG-
PSRP_CITK8        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALG2        SEGFC-QDIVQALVAPLQQEMKQDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALA4        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALCH        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALDC        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALEP        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALHS        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALNS        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALPA        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALPB        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALPC        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALPK        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALSV        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALTI        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_SALTY        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPGNLNKYDARIAAIDYTLAHDDG-
PSRP_ESCF3        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLTPGNLNKYDARIAAIDYTLAHDDG-
PSRP_ECO7I        SEGFC-QDIVQALVAPLQQEMQLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_SHIB3        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_SHIBS        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECOL5        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECOLI        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECO24        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECO27        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECO45        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECO55        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECO57        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECO5E        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECO81        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECO8A        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECOBW        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECODH        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECOHS        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECOK1        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECOL6        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECOLC        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECOSE        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECOSM        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECOUT        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_SHIDS        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_SHIF8        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_SHIFL        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_SHISS        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_ECOLU        SEGFC-QDIVQALVAPLQQEMKLDPTPIAHRTHGLNPNNLNKYDARIAAIDYTLAHDDG-
PSRP_PHOLL        SEGFC-QDIVQTLVAPLQQETGLEPKPELNRTHGLTEKNLSQYDARIAAIDYALAHDDG-
PSRP_SODGM        SAGFC-QDVVQALVGPLQQELGIAPDPVAHRTHGLTATNLSKYDARITAIDYTLAHDDG-
PSRP_PECAS        SDGFC-QDIVQALVAPLQEELNIPPTPVANRTHGLTANNLGKYDARIAAIDYTLAHDDG-
PSRP_YERE8        SEGFC-QDIVQALVAPLQGELGVSPQPVLNRTHGLTESNLGKYDARIAAIDYALAHDDG-
PSRP_YERP3        SEGFC-QDIVQALVAPLQGELGVPPQPVLNRTHGLTESNLDKYDARIAAIDYALAHDDG-
PSRP_YERPA        SEGFC-QDIVQALVAPLQGELGVPPQPVLNRTHGLTESNLDKYDARIAAIDYALAHDDG-
PSRP_YERPY        SEGFC-QDIVQALVAPLQGELGVPPQPVLNRTHGLTESNLDKYDARIAAIDYALAHDDG-
PSRP_YERPN        SEGFC-QDIVQALVAPLQGELGVPPQPVLNRTHGLTESNLDKYDARIAAIDYALAHDDG-
PSRP_YERPS        SEGFC-QDIVQALVAPLQGELGVPPQPVLNRTHGLTESNLDKYDARIAAIDYALAHDDG-
PSRP_YERPB        SEGFC-QDIVQALVAPLQGELGVPPQPVLNRTHGLTESNLDKYDARIAAIDYALAHDDG-
PSRP_YERPE        SEGFC-QDIVQALVAPLQGELGVPPQPVLNRTHGLTESNLDKYDARIAAIDYALAHDDG-
PSRP_YERPP        SEGFC-QDIVQALVAPLQGELGVPPQPVLNRTHGLTESNLDKYDARIAAIDYALAHDDG-
PSRP_NITMU        ADALH-LDCFSIFIAPLEAELGARSSENMGRSHRVSDPT--GYWKRINAINYALEHDDG-
PSRP_METFK        SNAVH-LDVFGSFVDPLAEELQEQPSRTSGIAHSVLGNS---YYERIDAINFTLNHDDG-
PSRP_DECAR        ADAFC-LSYFDTFLAPLEAELGIKSNHTVGRSHGSAESS--EYKKRIESINYTLAHDDG-
PSRP_AROAE        IDALF-VDLFEQFINPLEAELGQRSTHTVGRFHGIAESS--DYKARIEAINFAMAHDDGV
PSRP_AZOSB        ADALF-LDLFDRFIGPLETELGQRSTHTVGRFHGIADSL--DYKNRIEAINFAMAHDDGV
PSRP_BORA1        ANGVF-LDLFGTFVSHIEQALGLKSSPSIGRSHMQADSE--KYRNRIDAINFSLAHDDG-
PSRP_BORPE        SNGVF-LDLFGTFVSHIEQALGLKSSHSIGRSHMAANSE--KYRNRIDAINFSLAHDDG-
PSRP_BORPA        SNGVF-LDLFGTFVSHIEQALGLKSSHSIGRSHMAANSE--KYRNRIDAINFSLAHDDG-
PSRP_BORBR        SNGVF-LDLFGTFVSHIEQALGLKSSHSIGRSHMAANSE--KYRNRIDAINFSLAHDDG-
PSRP_JANMA        SQGMH-MDLIQTFVEPLEQELGVKSTHTIGRSHTSTDSE--EYKNRIEAINFSLAHDDG-
PSRP_HERAR        SKGMH-MDLIQTFVEPLEQELGVKSTHTIGRSHTSTDSE--EYKNRIEAINFSLAHDDG-
PSRP_PARXL        SNALV-LDMFQTFVEPLEQELELKSSHAMGRGHQNADTE--EYKNRIEAINFSLAHDDG-
PSRP_PARPJ        SNALV-LDMFQTFVEPLEQELELKSSHAMGRGHQNADTE--EYKNRIEAINFSLAHDDG-
PSRP_BURMA        SNALV-LDMFQRFVEPLEQELQLKSSHAMGRVHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURPS        SNALV-LDMFQRFVEPLEQELQLKSSHAMGRVHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURP6        SNALV-LDMFQRFVEPLEQELQLKSSHAMGRVHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURP0        SNALV-LDMFQRFVEPLEQELQLKSSHAMGRVHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURP1        SNALV-LDMFQRFVEPLEQELQLKSSHAMGRVHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURM7        SNALV-LDMFQRFVEPLEQELQLKSSHAMGRVHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURMS        SNALV-LDMFQRFVEPLEQELQLKSSHAMGRVHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURM9        SNALV-LDMFQRFVEPLEQELQLKSSHAMGRVHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURTA        SNALV-LDMFQRFVEPLEQELQLKSSHAMGRVHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURVG        SNALV-LDMFQRFVEPLEQELELKSSHAMGRGHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURL3        SNALV-LDMFQRFVEPLEQELELKSSHAMGRGHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURCJ        SNALV-LDMFQRFVEPLEQELELKSSHAMGRGHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURCH        SNALV-LDMFQRFVEPLEQELELKSSHAMGRGHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURCC        SNALV-LDMFQRFVEPLEQELELKSSHAMGRGHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURCA        SNALV-LDMFQRFVEPLEQELELKSSHAMGRGHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURM1        SNALV-LDMFQRFVEPLEQELQLKSSHAMGRGHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURA4        SNALV-LDMFQRFVEPLEQELELKSSHAMGRGHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_BURCM        SNALV-LDMFQRFVEPLEQELELKSSHAMGRGHQNADTE--EYKTRIEAINFSLAHDDG-
PSRP_RALSO        ARATI-LDMFQTFIEPLERELGLKSSHAIGRFHQNADTE--AYKNRIEAINFSLAHDDG-
PSRP_CUPMC        AKAMI-LDMFQTFIEPLEKELGLKSTHAIGRFHQNADTE--AYKNRIEAINFSLAHDDG-
PSRP_CUPPJ        AKAMI-LDMFQTFIEPLEKELGLKSTHAIGRFHQNADTE--AYKNRIEAINFSLAHDDG-
PSRP_CUPNH        AKAMI-LDMFQTFIEPLEKELGLKSTHAIGRFHQNADTE--AYKNRIEAINFSLAHDDG-
PSRP_METPP        AHCLV-LDMLGTFVEPLEAEFGIKSNHRVGRFDDISKSQ--EYTDRIEAINFSLAHDDG-
PSRP_LEPCP        SNALV-LDMFRTFVEPLEAELQLTSNHRVGRFSDVAKSQ--EYHDRIEAINFSLAHDDG-
PSRP_DELAS        CKGKV-FDMFGTFVRPLELELGQKSLHRVGRFADISESK--EYLERMEAINYTLAHDDG-
PSRP_RHOFT        CHGMV-LDMFSTFVHPLESELNLKSSHRIGRFTDASKSS--AYQSRIEAINFSLAHDDG-
PSRP_POLSJ        CNGML-LDMFGMFVAPLESELGIKSNHRVGRFSDASKSK--EYDDRIEAINFSLAHDDG-
PSRP_POLNA        CNGML-LDMFGIFVAPLESELGIKSNHRVGRFSDASKSK--AYDERIEAINFSLAHDDG-
PSRP_VARPS        CKGML-LDMFGTFVRPLEIELAVKSNHRIGRFSDVSKSK--EYDARIAAIDFSLAHDDG-
PSRP_VEREI        CQGML-LDMFGTFVHPLEQELGIKSHHRVGRFSDASHSK--EYSDRIAAINFSLAHDDG-
PSRP_ACIET        CRGML-LDMFGTFIRPLESELGVKSHHRVGRFSDISVSK--EYSDRIEAINFSLDHDDG-
PSRP_ACISJ        CRGML-LDMFGTFIRPLESELGVKSHHRVGRFSDISVSK--EYSDRIEAINFSLDHDDG-
PSRP_ACIAC        CQGML-LDMFGTFIRPLEGELGIKSLHRVGRFADVSLSK--EYTDRIEAINFSLDHDDG-
PSRP_XYLFT        SGALM-LDVFAPFIGLLEHELNTSRHSCVGRAHGMVDFE--TYHRRINAMNFALAHDDG-
PSRP_XYLF2        SGALM-LDVFAPFIGLLEHELNTSRHSCVGRAHGMVDFE--TYHRRINAMNFALAHDDG-
PSRP_XYLFA        SGALM-LDVFAPFIGLLEHELNTSRHSRIGRAHGMVDFE--TYHRRINAMNFALAHDDG-
PSRP_XYLFM        SGALM-LDVFAPFIGLLEHELNTSRHSRVGRAHGMVDFE--TYHRRINAMNFALAHDDG-
PSRP_XANC8        SGALM-LDVFAPFIEPLERELNAPRHSRVGRAHGMVDFE--TYHRRINAMNFALSHDDG-
PSRP_XANCB        SGALM-LDVFAPFIEPLERELNAPRHSRVGRAHGMVDFE--TYHRRINAMNFALSHDDG-
PSRP_XANCP        SGALM-LDVFAPFIEPLERELNAPRHSRVGRAHGMVDFE--TYHRRINAMNFALSHDDG-
PSRP_XANOM        SGALM-LDVFAPFIEPLERELNAPRHSRVGRAHGMVDFE--TYHRRINAMNFALSHDDG-
PSRP_XANOR        SGALM-LDVFAPFIEPLERELNAPRHSRVGRAHGMVDFE--TYHRRINAMNFALSHDDG-
PSRP_XANAC        SGALM-LDVFAPFIEPLERELNAPRHSRVGRAHGMVDFE--TYHRRINAMNFALSHDDG-
PSRP_XANC5        SGALM-LDVFAPFIEPLERELNAPRHSRVGRAHGMVDFE--TYHRRINAMNFALSHDDG-
PSRP_STRMK        SGALM-LDVFAPFIEPLERELASPRLARVGQAHGMVDFD--TYHRRINAMNFALTHDDG-
PSRP_STRM5        SGALM-LDVFAPFIEPLERELSSSRVNRVGQAHGMVDFD--TYHRRINAMNFALTHDDG-
PSRP_ALKEH        TDAVL-FDFFDTFIAPLEQELRMPSSHVIGRSHGVVDNN--MYDVRIDAMNYALNHDDG-
PSRP_HALHL        SEHIVLFDFFDTFIAPLERELEVPSNHVIGRSHGIADDS--TYDVRIDAMNFALHHDDG-
                         .        :                            .: :: :::  **. 

PSRP_DESPS        TAIMDYEEADLIIVGVSRSGKTPISVFLATQMGIKTANYPLVEQDL-TF---CQLPEDII
E8REH6_DESPD      TRPAEYDEAEIILVGVSRSGKTPVSIYLATHMELKAANFPLTADHL-DK---HELPKEIV
D6Z2G1_DESAT      VRSNEADEAEAILLGVSRTGKTPVCVYLATQMGLKAANFPLTAEYL-RE---YKLPEPLR
D3SE90_THISK      LSTQDLSVADVVLLGASRSGKTPTSLYLAMNYGLFAANYPLVPEDL-GQDDTPHMPRSLR
F9ZS74_ACICS      IHPEHYSDADLILVGVSRSGKTPTALFLAMNFSLKVGNYPLTDADL-EH---DDLPAPLV
PSRP_THIDA        LSPEHLGQADLILVGVSRVGKTPTALYLALHYGLRAANYPLTPDDL-AN---DGLPRALQ
PSRP_DEIRA        IGDKQYGLSDVILVGVSRAGKTPTSLFLALQHGIRASNYPLAEDDF-ER---EGLPAPLE
PSRP_DEIGD        LGDRQYGLADVILVGVSRAGKTPTSLFLALQHSVRASNYPLAEDDF-ER---ESLPIPLE
G0HCX4_CORVD      ADLRHLEVADLILLAPSRCGKTPTAMYLALQHGLRVANYPLTEDD--RP---GELPPALV
B8H8F1_PSECP      QSLRALERAELILIAPSRCGKTPTTMYLALQHGILAANFPLVEEDF-ES---LSLPKPLL
F0M692_PSEPM      QSLRALERAELILIAPSRCGKTPTTMYLALQHGILAANFPLVEEDF-AT---LSLPKPLL
E6SFI1_INTC7      QSLRNLAQAELILVAPSRCGKTPTSMYLALQHGIRVANYPLVEEDL-HS---THLPRPIR
F5XSM2_MICPN      QSLRALDKADVILLAPSRCGKTPTTMYLALQHGVFVANYPLVEEDF-DT---NDLPRPVR
D2S7N8_GEOOG      LGSRGLDRADVVLLAPSRCGKTPTAMYLALQHGLFVANYPLVDEDL-ET---TDLPRPVR
PSRP_NITEU        ANAKILADADVIVVGVSRTGKTPVCVYLALQYGVLAANYPFTPEDM-GA---IQLPPLLQ
PSRP_NITEC        SNSKILADADVILVGVSRSGKTPVCVYLALQYGVLAANYPFTPEDM-GV---VRLPSLLQ
PSRP_THIRO        IRPDNFHRADVVLIGVSRSGKTPTCLYLAMHYGLRSANYPVTEEDF-ER---GDVPQLVW
PSRP_CHRVO        VKLKDLHEADVILVGVSRSGKTPTCLYLALQYGIRAANYPLTPEDL-GS---PTLPKMLL
PSRP_LARHH        VKLKDLAEADVILVGVSRSGKTPTCLYLALQYGIKAANYPLTPEDL-DS---PTLPKMLL
PSRP_DICNV        SSDRNLQHAEVILIGVSRSGKTPTCLYLALQYGIRAANYPLTPEDL-QS---PNLPNMVK
PSRP_NEIG1        VSDKNLQEADVILMGVSRSGKTPTCLYLALQYGIRAANYPLIPDDL-ES---ADLPRMVK
PSRP_NEIG2        VSDKNLQEADVILMGVSRSGKTPTCLYLALQYGIRAANYPLIPDDL-ES---ADLPRMVK
PSRP_NEIMB        VSDKNLQEADVILMGVSRSGKTPTCLYLALQYGIRAANYPLIPDDL-ES---ADLPRMVK
PSRP_NEIMF        VSDKNLQEADVILMGVSRSGKTPTCLYLALQYGIRAANYPLIPDDL-ES---ADLPRMVK
PSRP_NEIM0        VSDKNLQEADVILMGVSRSGKTPTCLYLALQYGIRAANYPLIPDDL-ES---ADLPRMVK
PSRP_NEIMA        VSDKNLQEADVILMGVSRSGKTPTCLYLALQYGIRAANYPLIPDDL-ES---ADLPRMVK
PSRP_LEGPA        IKTRGYDKADIILIGVSRCGKTPSCLYMALQYGILAANYPFTEEDL-VG---FRLPEVLR
PSRP_LEGPH        IKTRGYDKADIILIGVSRCGKTPSCLYMALQYGILAANYPFTEEDL-VG---FRLPEVLR
PSRP_LEGPC        IKTRGYDKADIILIGVSRCGKTPSCLYMALQYGILAANYPFTEEDL-VG---FRLPEVLR
PSRP_LEGPL        IKTRGYDKADIILIGVSRCGKTPSCLYMALQYGILAANYPFTEEDL-VG---FRLPDVLR
PSRP_CHRSD        ARTHQYDQADVILVGVSRCGKTPTSLYLALQFGIRAANYPLTEDDL-DEDGVLNMPKALA
PSRP_PSEU5        ARTRYYDKADLILVGVSRCGKTPTCLYMAMQYGIRAANYPLTEDDM-ER---LQLPSALK
PSRP_AZOVD        ARTHYYDKADLILVGVSRSGKTPTCLYMAMQYGIRAANYPLTEEDM-ER---LQLPTALK
PSRP_PSEAE        ARTHYYDKADLILVGVSRCGKTPTCLYMALQYGIRAANYPLTEEDM-ER---LQLPNALK
PSRP_PSEA8        ARTHYYDKADLILVGVSRCGKTPTCLYMALQYGIRAANYPLTEEDM-ER---LQLPNALK
PSRP_PSEAB        ARTHYYDKADLILVGVSRCGKTPTCLYMALQYGIRAANYPLTEEDM-ER---LQLPNALK
PSRP_PSEMY        ARTHYYDKADLILVGVSRCGKTPTCLYMAMQYGIRAANYPLTEDDM-ER---LQLPDSLK
PSRP_PSEE4        ARTHYYDKADLILVGVSRCGKTPTCLYMAMQFGIRAANYPLTEDDM-ER---LQLPAVLK
PSRP_PSEPW        ARTHYYDKADLILVGVSRCGKTPTCLYMAMQFGIRAANYPLTEDDM-ER---LQLPAVLK
PSRP_PSEPG        ARTHYYDKADLILVGVSRCGKTPTCLYMAMQFGIRAANYPLTEDDM-ER---LQLPAVLK
PSRP_PSEP1        ARTHYYDKADLILVGVSRCGKTPTCLYMAMQFGIRAANYPLTEDDM-ER---LQLPAVLK
PSRP_PSEPK        ARTHYYDKADLILVGVSRCGKTPTCLYMAMQFGIRAANYPLTEDDM-ER---LQLPAVLK
PSRP_PSE14        ARTHYYDKADIILVGVSRCGKTPTCLYMAMQFGIRAANYPLTEDDM-ER---LQLPAALK
PSRP_PSEU2        ARTHYYDKADIILVGVSRCGKTPTCLYMAMQFGIRAANYPLTEDDM-ER---LQLPAALK
PSRP_PSESM        ARTHYYDKADIILVGVSRCGKTPTCLYMAMQFGIRAANYPLTEDDM-ER---LQLPPALK
PSRP_PSEFS        ARTHYYDKADLILVGVSRCGKTPTCLYMAMQFGIRAANYPLTEDDM-EH---LTLPAALR
PSRP_PSEPF        ARTHYYDKADLILVGVSRCGKTPTCLYMAMQFGIRAANYPLTEDDM-ER---LQLPAALR
PSRP_PSEF5        ARTHYYDKADLILVGVSRCGKTPTCLYMAMQFGIRAANYPLTEEDM-ER---LQLPNALR
PSRP_MARHV        ARTRHYDEADLILIGASRSGKTPTCLYLALQYGIKAANYPITEEDL-DD---QKMPAALR
PSRP_HAHCH        ARVRYYNEADIILVGVSRSGKTPTCIYLALQYGIKAANFPLTEDDI-LD---QRLPESLR
PSRP_ALCBS        ARTRHYDQADIILIGVSRSGKTPTCLYLALQFGLFTANYPLTEDDF-DD---LRLPKALM
PSRP_PSYCK        ARTRHYHAADIILIGVSRSGKTPTSLYLALQFGIRAANYPLTEEDL-ND---NQLPKALR
PSRP_PSYA2        ARTRHYHAADIILIGVSRSGKTPTSLYLALQFGIRAANYPLTEEDL-ND---NQLPKALR
PSRP_ACIB3        ARTRHYDKADLILIGVSRSGKTPTSIYLSLQFGIRVANYPLTEEDL-DD---NRLPAVLR
PSRP_ACIBY        ARTRHYDKADLILIGVSRSGKTPTSIYLSLQFGIRVANYPLTEEDL-DD---NRLPAVLR
PSRP_ACIBS        ARTRHYDKADLILIGVSRSGKTPTSIYLSLQFGIRVANYPLTEEDL-DD---NRLPAVLR
PSRP_ACIBT        ARTRHYDKADLILIGVSRSGKTPTSIYLSLQFGIRVANYPLTEEDL-DD---NRLPAVLR
PSRP_ACIB5        ARTRHYDKADLILIGVSRSGKTPTSIYLSLQFGIRVANYPLTEEDL-DD---NRLPAVLR
PSRP_ACIAD        ALTRHYDKADIILIGVSRSGKTPTSIYLSLQFGIRVANYPLTEEDL-DD---NRLPKVLK
PSRP_PHOPR        ISLNNLDQADVILLGVSRCGKTPTSLYLAMQFGIRAVNYPFIAEDM-AS---LKLPAAIE
PSRP_VIBVU        ISLKGLELADIILLGVSRSGKTPTSLYMAMQFGLRVVNYPYIDDDI-KG---LKLLPEFE
PSRP_VIBVY        ISLKGLELADIILLGVSRSGKTPTSLYMAMQFGLRVVNYPYIDDDI-KG---LKLLPEFE
PSRP_VIBC3        VSLKDLDRADIILLGVSRSGKTPTSLYMAMQFGLRVVNYPFIAEDM-HA---MRLLPEFE
PSRP_VIBCM        VSLKDLDRADIILLGVSRSGKTPTSLYMAMQFGLRVVNYPFIAEDM-HA---MRLLPEFE
PSRP_VIBCH        VSLKDLDRADIILLGVSRSGKTPTSLYMAMQFGLRVVNYPFIAEDM-HA---MRLLPEFE
PSRP_VIBA3        ITLKGLEEADIILLGVSRSGKTPTSLYMAMQFGLRVANYPFIHDDI-AR---LRLLPEFE
PSRP_VIBCB        ITLKGLDEANIILLGVSRSGKTPTSLYMAMQFGLRVVNYPFIAEDV-KM---MRLLPEFE
PSRP_VIBPA        ITLKGLEQADIILLGVSRSGKTPTSLYMAMQFGLRVVNYPFIAEDV-KM---MRLLPEFE
PSRP_IDILO        KRLNQLDKADLILIGVSRTGKTPTSLYLAMQYGIKVANYPLTDDDDFER---LQLPKELK
PSRP_ALTMD        SNLKDYDEADIILTGVSRSGKTPTSLYLALQYGIKAANYPFTEEDMGDM---LKLPPTLR
PSRP_PSEA6        SNLQEYDEADIILVGVSRSGKTPTSLYLALQYGIKAANYPFTEEDMGDI---LKMPPALK
PSRP_COLP3        SNVTNYEEADVILVGVSRSGKTPSSLYLALQYGIKAANYPFTDDDM-EE---LKIPSFLK
PSRP_PSET1        GNIKNYGEADIILIGVSRSGKTPTSLYLALQYGIKAANYPITEDDL-ET---EGLPKCLI
PSRP_AERS4        ITTKEYEEADIILIGVSRCGKTPTSLYLALQFGIRAANYPFIEQDM-GA---LVLPTALK
PSRP_AERHH        ITTKEYDEADIILIGVSRCGKTPTSLYLALQFGIRAANYPFIEQDM-GV---LDLPAALK
PSRP_SHEPW        QTMKHMDKADLILLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPDALK
PSRP_SHEPA        QTMKHMDKADLILLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPEALK
PSRP_SHEHH        QTMKHMDKADLILLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPDALK
PSRP_SHELP        QTLKHIDKADIVLLGVSRCGKTPSSLYLSMQFGIKAANYPFIEDDM-DN---LKLPEVLK
PSRP_SHESH        QTLKNIDKADLVLLGVSRCGKTPSSLYLSMQFGIKAANYPFVEDDM-DN---LKLPTALK
PSRP_SHEWM        QTLKHIDKADLVLLGVSRCGKTPSSLYLSMQFGIKAANYPFVEDDM-DN---LKLPDALK
PSRP_SHEAM        QTLKHMDKADIILLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DS---LKLPEALK
PSRP_SHEB2        QTMKHMDQADLVLLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPDALK
PSRP_SHEB8        QTMKHMDQADLVLLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPDALK
PSRP_SHEB5        QTMKHMDQADLVLLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPDALK
PSRP_SHEB9        QTMKHMDQADLVLLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPDALK
PSRP_SHESW        QTMKHMDQADLILLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPEALK
PSRP_SHEPC        QTMKHMDQADLILLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPEALK
PSRP_SHEON        QTMKHMDQADLILLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPEALK
PSRP_SHESM        QTMKHMDQADLILLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPEALK
PSRP_SHESR        QTMKHMDQADLILLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPEALK
PSRP_SHESA        QTMKHMDQADLILLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPEALK
PSRP_SHEDO        QTMKHMDKADIILLGVSRCGKTPSSLYLSMQFGIKAANYPFTEDDM-DN---LKLPDALK
PSRP_SHEFN        QTMKHMDKADIILLGVSRCGKTPSSLYLSMQFGIKAANYPFTEEDM-DN---LKLPEALK
PSRP_ENTAG        ISLRGLEDAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LKLPPALR
PSRP_ERWT9        ISLRGLEDAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LKLPAALK
PSRP_KLEP3        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQYGIRAANYPFIADDM-DN---LVLPASLK
PSRP_KLEP7        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQYGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ENT38        ISMRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPPALK
PSRP_CITK8        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPTSLK
PSRP_SALG2        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_SALA4        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_SALCH        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_SALDC        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_SALEP        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_SALHS        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_SALNS        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_SALPA        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_SALPB        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_SALPC        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_SALPK        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_SALSV        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_SALTI        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_SALTY        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LTLPTSLK
PSRP_ESCF3        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECO7I        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_SHIB3        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRTANYPFIADDM-DN---LVLPASLK
PSRP_SHIBS        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRTANYPFIADDM-DN---LVLPASLK
PSRP_ECOL5        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECOLI        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECO24        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECO27        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECO45        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECO55        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECO57        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECO5E        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECO81        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECO8A        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECOBW        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECODH        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECOHS        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECOK1        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECOL6        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECOLC        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECOSE        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECOSM        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECOUT        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_SHIDS        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_SHIF8        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_SHIFL        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_SHISS        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_ECOLU        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LVLPASLK
PSRP_PHOLL        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIQAANYPFTADDM-DN---LQLPATLK
PSRP_SODGM        ISLRNLDQAQIILLGVSRCGKTPTSLYLAMQYGIRAANYPFIADDM-DN---LSLPAALK
PSRP_PECAS        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LRLPDALK
PSRP_YERE8        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LQLPAALK
PSRP_YERP3        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LQLPAALK
PSRP_YERPA        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LQLPAALK
PSRP_YERPY        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LQLPAALK
PSRP_YERPN        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LQLPAALK
PSRP_YERPS        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LQLPAALK
PSRP_YERPB        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LQLPAALK
PSRP_YERPE        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LQLPAALK
PSRP_YERPP        ISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAANYPFIADDM-DN---LQLPAALK
PSRP_NITMU        LSQKNWNRADVTLVGASRTGKTPTCLYLALQYGIYAANYPLIPEDF-QR---EELPAQIR
PSRP_METFK        MTDFGLSEAQVILVGVSRCGKTPTSLYLAMQFGIKAANYPLIPEDL-ER---GSLPEALK
PSRP_DECAR        ITDRDLEEADVILVAVSRCGKTPTSLYLAMQFGLKAANFPLIPEDF-DR---GRLPGTLE
PSRP_AROAE        STDGELADADVILVGVSRSGKTPTSLYLAVQFGVKAANYPLIPEDF-ER---NKLPGELH
PSRP_AZOSB        SSDGELAEADVILVGVSRSGKTPTSLYLAMQFGVKAANYPLIPEDF-ER---NKLPGELH
PSRP_BORA1        QFVNQLDQADVILVGVSRCGKTPTSLYLAMQYAIKAANFPLTPDDF-ER---SSLPKTIA
PSRP_BORPE        QFVNQLDQADVILLGVSRCGKTPTSLYLAMQYAVKAANFPLTPDDF-ER---GALPKTIA
PSRP_BORPA        QFVNQLDQADVILVGVSRCGKTPTSLYLAMQYAVKAANFPLTPDDF-ER---GALPKTIA
PSRP_BORBR        QFVNQLDQADVILVGVSRCGKTPTSLYLAMQYAVKAANFPLTPDDF-ER---GALPKTIA
PSRP_JANMA        QSHKNLSAADVILVGVSRSGKTPTSLFLAMQYGIKAANYPLIPDDF-ER---EKLPGGLQ
PSRP_HERAR        QSNKNLAEADVILVGVSRSGKTPTSLFLAMQYGIKAANYPLIPDDF-AR---EKLPGGLL
PSRP_PARXL        QSNRNLADADVILVGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPTPLL
PSRP_PARPJ        QSNRNLADADVILVGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPTPLL
PSRP_BURMA        QSNRNLADADVILIGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPTPLH
PSRP_BURPS        QSNRNLADADVILIGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPTPLH
PSRP_BURP6        QSNRNLADADVILIGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPTPLH
PSRP_BURP0        QSNRNLADADVILIGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPTPLH
PSRP_BURP1        QSNRNLADADVILIGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPTPLH
PSRP_BURM7        QSNRNLADADVILIGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPTPLH
PSRP_BURMS        QSNRNLADADVILIGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPTPLH
PSRP_BURM9        QSNRNLADADVILIGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPTPLH
PSRP_BURTA        QSNRNLADADVILIGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPTPLH
PSRP_BURVG        QSNRNLSEADVILVGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPSALT
PSRP_BURL3        QSNRNLSEADVILVGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPSALA
PSRP_BURCJ        QSNRNLSEADVILVGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPSALS
PSRP_BURCH        QSNRNLSEADVILVGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPSALA
PSRP_BURCC        QSNRNLSEADVILVGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPSALA
PSRP_BURCA        QSNRNLSEADVILVGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPSALA
PSRP_BURM1        QSNRNLSEADVILVGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPSALA
PSRP_BURA4        QSNRNLSEADVILVGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPSALT
PSRP_BURCM        QSNRNLSEADVILVGVSRSGKTPTSLYLAMQYGVKAANYPLIPEDF-ER---GKLPSALT
PSRP_RALSO        QSHKNLAEADVILVGVSRSGKTPTSLYLAMQYGVKSANYPLIPDDF-ER---GKLPTVLY
PSRP_CUPMC        QSHKNLEDADVILVGVSRSGKTPTSLYLAMQYGLKAANYPLIPDDF-ER---GRLPSALY
PSRP_CUPPJ        QSHKNLQEADVILVGVSRSGKTPTSLYLAMQYGLKAANYPLIPDDF-ER---GKLPKALY
PSRP_CUPNH        QSHKNLEEADVILVGVSRSGKTPTSLYLAMQYGLKAANYPLIPDDF-ER---GRLPSALY
PSRP_METPP        QSSKNLDIADVILVGVSRSGKTPTSLYLAMQHGIKAANYPLIPEDF-DR---GALPSALV
PSRP_LEPCP        QSSRNLAEADVILVGVSRSGKTPTSLYLAMQHGIKAANYPLIPEDF-ER---DSIPSSLA
PSRP_DELAS        QTHQDLTGADVILVGVSRSGKTPTSLYLAMQFGLKVANYPLIPEDF-ER---KQLPPALV
PSRP_RHOFT        QSNTDLEHSDIILVGVSRSGKTPTSLYLAMQYGLKASNYPLIPDDF-ER---QQLPPALK
PSRP_POLSJ        QSNKDLAGSDVILVGVSRSGKTPTSLYLAMQYGLKASNYPLIPEDF-ER---RQLPPALV
PSRP_POLNA        QSHRDLAGSDVILVGVSRSGKTPTTLYLAMQYGLKASNYPLIPEDF-ER---RQLPPALV
PSRP_VARPS        QSNRDLEGADVILVGVSRSGKTPTSLYLAMQHGLKAANYPLIPEDF-ER---KQLPPALM
PSRP_VEREI        QSHHDLAGADVILVGVSRSGKTPTSLYLAMQCGLKTANYPLIPEDF-ER---RQLPPALE
PSRP_ACIET        QSHRDLSGADVILIGVSRSGKTPTSLYLAMQCGLKVANYPLIPEDF-ER---RQLPPALV
PSRP_ACISJ        QSHRDLSGADVILIGVSRSGKTPTSLYLAMQCGLKVANYPLIPEDF-ER---RQLPPALV
PSRP_ACIAC        QSHRDLSGADVILVGVSRSGKTPTSLYLAMQCGLKVANYPLIPEDF-ER---KQLPPALE
PSRP_XYLFT        -VAASYDEAEVILVAVSRAGKTPTCIYLALHYGIRAANYPLIDEDL-NS---DQLPLRLR
PSRP_XYLF2        -VAASYDEAEVILVAVSRAGKTPTCIYLALHYGIRAANYPLIDEDL-NS---DQLPLRLR
PSRP_XYLFA        -VAASYDEAEVILVAVSRAGKTPTCIYLALHYGIRAANYPLIDEDL-NS---DQLPLRLR
PSRP_XYLFM        -VAASYDEAEVVLVAVSRAGKTPTCIYLALHYGIRAANYPLIDEDL-NS---DQLPLRLR
PSRP_XANC8        IAL-NYDEADVILVAVSRAGKTPTCIYLALHYGIRAANYPLTEEDL-ES---ERLPPRLR
PSRP_XANCB        IAL-NYDEADVILVAVSRAGKTPTCIYLALHYGIRAANYPLTEEDL-ES---ERLPPRLR
PSRP_XANCP        IAL-NYDEADVILVAVSRAGKTPTCIYLALHYGIRAANYPLTEEDL-ES---ERLPPRLR
PSRP_XANOM        IAL-NYDEADVILVAVSRAGKTPTCIYLALHYGIRAANYPLTDEDL-EN---ERLPPRLR
PSRP_XANOR        IAL-NYDEADVILVAVSRAGKTPTCIYLALHYGIRAANYPLTDEDL-EN---ERLPPRLR
PSRP_XANAC        IAL-NYDEADVILVAVSRAGKTPTCIYLALHYGIRAANYPLTDEDL-EN---EQLPPRLR
PSRP_XANC5        IAL-NYDEADVILVAVSRAGKTPTCIYLALHYGIRAANYPLTDEDL-EN---EQLPPRLR
PSRP_STRMK        -IAVNYDDADVILVAVSRAGKTPTCIYLALHYGVRAANYPLTDEDL-ES---DRLPPRLR
PSRP_STRM5        -IAVNYDDADVILVAVSRAGKTPTCIYLALHYGVRAANYPLTDEDL-ES---DRLPPRLR
PSRP_ALKEH        AVTHHYSRADVILTAVSRSGKTPTCIYLALQYGIYAANYPLTQDDL-NR---GKLPRKLV
PSRP_HALHL        ATHQHYGRADVILVGVSRSGKTPASLYLALQFGVYAANYPLTDDDL-IA---TRLPRALV
                          ::  : . ** ****  :::: :  :   *:*              :   . 

PSRP_DESPS        KNKHKVVGLSISPDVLHTFREQRYKGSHYAQMSTCKRETLQSKRIFEKYDLPVVFSDARS
E8REH6_DESPD      RNSKRAVGLTCSPLYLHTIREKRYAGSTYASLANCTRELQQAKQLYQRHNLKVLNVEGRS
D6Z2G1_DESAT      RNARRSVGLTTTPELLHNVREKRYPNSSYAKLATCRKEIKQAEQIFHTYNIPVISTAGRS
D3SE90_THISK      GLGQRMVGLTITPQRLSQIREGRRPGSQYASLNQCRAECAAIQEFLETWNIPHLDVTELS
F9ZS74_ACICS      AWRDKLVALTIEPETLHTIREKRRASPHYAALSVCRREVRAAERIFRKARIPVFDSTNTS
PSRP_THIDA        PHLPRLRGLTLAPERLAAIREARLPGSRYASVAQCRSELDAAERLLAAHAIPLIDTSRMS
PSRP_DEIRA        QYRSKLFGLTIDPRRLHAIRTQRKPGSKYASIEQCEYEVRRASALFARLGLPVKDTTSAS
PSRP_DEIGD        PHRAKLHGLTIDPRRLHAIRTQRKPGSRYASLEQCEYEVRQAERLFGRAGIPVRDTTSAS
G0HCX4_CORVD      DHKDRLFGLTTTAQRLSEVRGERRPGSSYASPARCRAELRQAEQLYRTHRIPYIDSHAMS
B8H8F1_PSECP      PFARKCFGLTSLPVRLSQIRQERRPGSNYASLNQCTFELRNAEDMYRVNSIPFVNSASMS
F0M692_PSEPM      PFADKCFGLTSLPVRLSQIRQERRPGSDYASLGQCTFELRNAEDMYRVNQVPYVNSASMS
E6SFI1_INTC7      DYADRCFGLVSTPARLSQVRSERRPGSTYASLAQCSYELRRAEALYRAHRIPSINSASMS
F5XSM2_MICPN      HLRSRCFGITTTPARLSQVRNERRPNSRYASLEQCTYELRRAEALYRIHKIPSINSSAKS
D2S7N8_GEOOG      DLADRCFGLTTTVVRLSRVRQERRPDSRYASEEQCRFELRRATAIYDRHQLPTVDTSAAS
PSRP_NITEU        PLRKKLFGLTLNTSRLQSIREERYPGSHYASFAECQRELQWQNELYRQFDIPSINTTDVS
PSRP_NITEC        PLREKLFGLTLSTSRLQAVRVERYPGSHYASFVECQRELQWQNELYQQFNIPFIDTTGVS
PSRP_THIRO        DCRHKLFALTIDPQRLQLIREERRPGSSYASLARCQDDIRMAAQIYKRLQIPVLNTTSQS
PSRP_CHRVO        PFKDKMFGLTIDPNRLHHIRSERRPDSKYASMDNCRREVNEAESMFRHHGVPFISTTHKS
PSRP_LARHH        PYRKKIFGLTIEPQRLHHIRNERKPDSRYASIDNCRREVNEAESLFRHHGVPFISTTHKS
PSRP_DICNV        PFRNKLFGLTIDPERLSKIRQERRPNSEYADILTCKREVSDAKAMFYRFNLPYANTTHKS
PSRP_NEIG1        PYKDKLFGLTIQPERLQAIRQERRPNSAYARIDTCRSEVADAQSMFRRHGIPFANTTDKS
PSRP_NEIG2        PYKDKLFGLTIQPERLQAIRQERRPNSAYARIDTCRSEVADAQSMFRRHGIPFANTTDKS
PSRP_NEIMB        PYRDKLFGLTIQPERLQAIRQERRPNSTYAKIDTCRSEVADAQSMFRRHGIPFANTTDKS
PSRP_NEIMF        PYRDKLFGLTIQPERLQAIRQERRPNSTYAKIDTCRSEVADAQSMFRRHGIPFANTTDKS
PSRP_NEIM0        PYRDKLFGLTIQPERLQAIRQERRPNSTYAKIDTCRSEVADAQSMFRRHGIPFANTTDKS
PSRP_NEIMA        PYRDKLFGLTIQPERLQAIRQERRPNSTYAKIDTCRSEVADAQSMFRRHGIPFANTTDKS
PSRP_LEGPA        PYKPKLFGLTIDAQRLQQIRSERRPNSKYASAEQCRLEVTEVEAMYQRENIPYINSTKYS
PSRP_LEGPH        PYKQKLFGLTIDAQRLQQIRSERRPNSKYASAEQCRLEVTEVEAMYQRENIPYINSTKYS
PSRP_LEGPC        PYKQKLFGLTIDAQRLQQIRSERRPNSKYASAEQCRLEVTEVEAMYQRENIPYINSTKYS
PSRP_LEGPL        PYKQKLFGLTIDAQRLQQIRSERRPNSKYASAEQCRLEVTEVEAMYQRENIPYINSTKYS
PSRP_CHRSD        PYRHKLFALTIDPRRLAAIRSERRPNSRYCSMDQCMQELQQAEALFRRYHIPYIDTTRFS
PSRP_PSEU5        EYKDKLFGLTIDPDRLAAIRNERKPNSRYASFAQCEFEVREVENLFRRENINFINSTHFS
PSRP_AZOVD        PYREKLFGLTIDSERLAAIRHERKPNSRYSSFSQCEFEVRETEKLLRREKIPFINSTHFS
PSRP_PSEAE        QYKHKLFGLTIDPDRLTAIRNERKPNSRYASFAQCEFEVREVESLFRRENIAYINSTHFS
PSRP_PSEA8        QYKHKLFGLTIDPDRLTAIRNERKPNSRYASFAQCEFEVREVESLFRRENIAYINSTHFS
PSRP_PSEAB        QYKHKLFGLTIDPDRLTAIRNERKPNSRYASFAQCEFEVREVESLFRRENIAYINSTHFS
PSRP_PSEMY        KHRDKLFGLTIDPDRLTAIRHERKPNSRYASFAQCEFEVREVENLFRRENIAFINSTHFS
PSRP_PSEE4        KHHSKLFGLTIDPDRLTAIRHERKPNSRYSSFAQCEFEVREVENLFRKENIPNINSTHFS
PSRP_PSEPW        KHHNKLFGLTIDPDRLTAIRHERKPNSRYSSFAQCEFEVREVESLFRRENIPNINSTHFS
PSRP_PSEPG        KHHNKLFGLTIDPDRLTAIRHERKPNSRYSSFAQCEFEVREVESLFRRENIPNINSTHFS
PSRP_PSEP1        KHHSKLFGLTIDPDRLTAIRHERKPNSRYSSFAQCEFEVREVESLFRRENIPNINSTHFS
PSRP_PSEPK        KHHSKLFGLTIDPDRLTAIRHERKPNSRYSSFAQCEFEVREVESLFRRENIPNINSTHFS
PSRP_PSE14        EHRSKLFGLTIDPDRLTAIRHERKPNSRYSSYAQCEFEVREVESLFRRENIPNINSTHFS
PSRP_PSEU2        QHREKLFGLTIDPDRLTAIRHERKPNSRYSSYAQCEFEVREVESLFRRENIAHINSTHFS
PSRP_PSESM        QHREKLFGLTIDPDRLTAIRHERKPNSRYSSYAQCEFEVREVESLFRRENIPNINSTHFS
PSRP_PSEFS        AHSHKLFGLTIDPDRLTAIRNERKPNSRYSSYAQCEFEVREVENLFRRENIAHINSTHFS
PSRP_PSEPF        AHQHKLFGLTIDPDRLTAIRNERKPNSRYSSYAQCEFEVREVENLFRRENIPHINSTHFS
PSRP_PSEF5        AHKHKLFGLTIDPDRLTAIRNERKPNSRYSSYAQCEFEVREVENLFRRENIPHINSTHFS
PSRP_MARHV        PHKEKLFGLTIEPERLATIRNERRPNSRYSSLQQCMHEIEEIELMYKRERIPYLNTTAYS
PSRP_HAHCH        SYREKIFGLTIDPERLAVIRNERKPNSKYASIKQCNYEVEEVELMYRRERIPYLNSTDYS
PSRP_ALCBS        EHKHKLFGLTIDADRLSAIRSERKAGSKYASPRQCDMELRALEAMYNKHNIPYLDATELS
PSRP_PSYCK        EHKHKLFGLIIDTDRLVKIRQERRAGSRYSSYQQCQQEQRAIQGIYTSQGIPSLDVSEMS
PSRP_PSYA2        EHKHKLFGLIIDTDRLVKIRQERRAGSRYSSYQQCQQEQRAIQGIYTSQGIPSLDVSEMS
PSRP_ACIB3        EHRSKLFGLMIDAERLVAIRSERKANSRYASFSQCQMELRAIEGIYISEGIKYLNVTEMS
PSRP_ACIBY        EHRSKLFGLMIDAERLVAIRSERKANSRYASFSQCQMELRAIEGIYISEGIKYLNVTEMS
PSRP_ACIBS        EHRSKLFGLMIDAERLVAIRSERKANSRYASFSQCQMELRAIEGIYISEGIKYLNVTEMS
PSRP_ACIBT        EHRSKLFGLMIDAERLVAIRSERKANSRYASFSQCQMELRAIEGIYISEGIKYLNVTEMS
PSRP_ACIB5        EHRSKLFGLMIDAERLVAIRSERKANSRYASFSQCQMELRAIEGIYISEGIKYLNVTEMS
PSRP_ACIAD        EHKNKLFGLMIDAERLVAIRTERKANSRYASYSQCQMELRAVEGIFISEGIPYLNVSEMS
PSRP_PHOPR        PYRFKTYGLTIDIERLVAIRNERYANSDYASLEQCEKELHKVEGMFRREAIPYLNTSSLS
PSRP_VIBVU        IHRHKLFGLTIDPERLTEIRENRLAGSDYASTEQCQHELANVEALFRREAIPYINTTSLS
PSRP_VIBVY        IHRHKLFGLTIDPERLTEIRENRLAGSDYASTEQCQHELANVEALFRREAIPYINTTSLS
PSRP_VIBC3        FHRHKLFGLTINAERLTEIRENRLAGSEYASNQQCQQELATVEALFRREAISYINTSSLS
PSRP_VIBCM        FHRHKLFGLTINAERLTEIRENRLAGSEYASNQQCQQELATVEALFRREAISYINTSSLS
PSRP_VIBCH        FHRHKLFGLTINAERLTEIRENRLAGSEYASNQQCQQELATVEALFRREAISYINTSSLS
PSRP_VIBA3        IYRHKLFGLTIDAERLTEIRENRLAGSEYASDSQCLYELQTVEGLFRREAIPYINTSSLS
PSRP_VIBCB        IHRHKLFGLTINPERLNEIRENRLSGSEYASTEQCKLELDTVEALFRREAIPYINTSSLS
PSRP_VIBPA        VHRHKLFGLTITPERLNEIRENRLSGSDYASEEQCKLELDTVEALFRREAIPYINTSSLS
PSRP_IDILO        QYRHKLFGLTLSSQRLHEIRSQRREGSQYASMAQCRFELAEVERLYSREAVPFINSTHYS
PSRP_ALTMD        RYKHKLFGLTIAADRLHQIRSERRANSKYASIQQCRMELREVENLYRKEKIPFLNSTKYS
PSRP_PSEA6        RYKDKMFGLTIEAQRLHQIRSERRANSRYASLQQCRMELREVENLYRKEKIPFLNSTRYS
PSRP_COLP3        PFHKKLFGLTIDAQRLIDIRDGRMANSKYSSARQCRMEVREVEKLYKNEQIPFINTTKLS
PSRP_PSET1        PFKHKLFGLTIDPERLAAIRDRRMANSKYASIRQCRIEVREVEMLYKRNRIPFLNSTHHS
PSRP_AERS4        ANRHKLFGLTITPQRLHEIRNQRRANSRYSSLEQCEQELASVERLFRQEAIRFLDTSSHS
PSRP_AERHH        ANRHKLFGLTIAPQRLHEIRNQRRANSRYSSLEQCEQELACVERLFRQEAIRFLDTSSHS
PSRP_SHEPW        RNKDKLFGLTIDPVRLHEIRQSRMSNSRYSSMRQCRMEVKEVEMMYKRERIPFVNTTNHS
PSRP_SHEPA        RNKHKLFGLTIDPERLHEIRHSRMSNSRYSSLRQCRVEVKEVEMLYKKERIPYVNTTNHS
PSRP_SHEHH        RNKGKLFGLTIDPERLHEIRHSRMSNSRYSSLRQCRMEVKEVEMMYQKERIPFVNTTNHS
PSRP_SHELP        KNKHKLFGLTIDPVRLHEIRQSRMENSRYSSLRQCRIEVKEVEMMYKRERIPFVNTTNHS
PSRP_SHESH        ENKSKLFGLTIDPVRLHEIRKSRMDNSRYSSLRQCRIEVKEVEMMYKRERIPFVNTTNHS
PSRP_SHEWM        KNKSKLFGLTIDPVRLHEIRQSRMENSRYSSLRQCRIEVKEVEMMYKRERIPFVNTTNHS
PSRP_SHEAM        RNKHKLFGLTIDPVRLQEIRQSRMENSRYSSLRQCRMEVKEVEMMFKKERIPYIDTTNHS
PSRP_SHEB2        RNKKKLFGLTIDPVRLHEIRQSRMENSRYSSLKQCRLEVKEVEMLFKRERIPYIDTTNHS
PSRP_SHEB8        RNKKKLFGLTIDPVRLHEIRQSRMENSRYSSLKQCRLEVKEVEMLFKRERIPYIDTTNHS
PSRP_SHEB5        RNKKKLFGLTIDPVRLHEIRQSRMENSRYSSLKQCRLEVKEVEMLFKRERIPYIDTTNHS
PSRP_SHEB9        RNKKKLFGLTIDPVRLHEIRQSRMENSRYSSLKQCRLEVKEVEMLFKRERIPYIDTTNHS
PSRP_SHESW        RNKKKLFGLTIDPVRLHEIRQSRMENSRYSSLKQCRLEVKEVEMMFKRERIPYIDTTNHS
PSRP_SHEPC        RNKKKLFGLTIDPVRLHEIRQSRMENSRYSSLKQCRLEVKEVEMMFKRERIPYIDTTNHS
PSRP_SHEON        RNKKKLFGLTIDPVRLHEIRQSRMENSRYSSLKQCRLEVKEVEMMFKRERIPYIDTTNHS
PSRP_SHESM        RNKKKLFGLTIDPVRLHEIRQSRMENSRYSSLKQCRLEVKEVEMMFKRERIPYIDTTNHS
PSRP_SHESR        RNKKKLFGLTIDPVRLHEIRQSRMENSRYSSLKQCRLEVKEVEMMFKRERIPYIDTTNHS
PSRP_SHESA        RNKKKLFGLTIDPVRLHEIRQSRMENSRYSSLKQCRLEVKEVEMMFKRERIPYIDTTNHS
PSRP_SHEDO        RNKNKLFGLTIDPNRLHEIRQSRMENSRYSSLRQCRLEVKEVEMMYKRERIPFVDTTNHS
PSRP_SHEFN        RNKSKLFGLTIDPHRLHEIRQSRMENSRYSSLRQCRLEVKEVEMLYKKERIPFVNTTNHS
PSRP_ENTAG        AHQNKLFGLTIDPERLAAIRQERAENTRYASMRQCRLEVGEVEALFRTHQIRYLNSTNYS
PSRP_ERWT9        PFQHKLFGLTIEPERLAAIRQERAENTRYASLRQCRLEVGEVEALFRTQQIRYLNSTNYS
PSRP_KLEP3        PLQHKMFGLTINPERLAAIREERRENSRYASLRQCRMEVTEVEALYRKNKIPCLNSTNYS
PSRP_KLEP7        PLQHKMFGLTINPERLAAIREERRENSRYASLRQCRMEVTEVEALYRKNKIPCLNSTNYS
PSRP_ENT38        PLQHKLFGLTINPERLAAIREERRENSRYASMRQCRMEVSEVEALYRKNQIPWLNSTNYS
PSRP_CITK8        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALG2        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALA4        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALCH        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALDC        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALEP        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALHS        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALNS        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALPA        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALPB        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALPC        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALPK        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALSV        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALTI        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_SALTY        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPCLNSTNYS
PSRP_ESCF3        PLQHKLFGLTINPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECO7I        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_SHIB3        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_SHIBS        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECOL5        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECOLI        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECO24        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECO27        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECO45        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECO55        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECO57        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECO5E        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECO81        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECO8A        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECOBW        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECODH        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECOHS        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECOK1        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECOL6        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECOLC        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECOSE        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECOSM        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECOUT        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_SHIDS        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_SHIF8        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_SHIFL        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_SHISS        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_ECOLU        PLQHKLFGLTIDPERLAAIREERRENSRYASLRQCRMEVAEVEALYRKNQIPWINSTNYS
PSRP_PHOLL        QFQHKLFGLTISPERLAAIREERRENSRYASLRQCRIEISEVEALFRKNKINYLNTTNYS
PSRP_SODGM        AHQPKLFGLTIDPERLAAIRDERLSDSRYASLRQCRMEINEVESLFRNNNIRYLNSTNHS
PSRP_PECAS        PFQHKLFGLTIDAERLAAIREERRGNSRYASLRQCRMELNEVEALFRKHQIKYLNTTNYS
PSRP_YERE8        PFQHKLFGLTINPERLAAIREERRENSRYASLRQCRMEVGEVEALFRKNQIRYLNSTNYS
PSRP_YERP3        PFQHKLFGLTINPERLAAIREERRENSRYASLRQCRMEVGEVEALFRKNQIRYLNSTNYS
PSRP_YERPA        PFQHKLFGLTINPERLAAIREERRENSRYASLRQCRMEVGEVEALFRKNQIRYLNSTNYS
PSRP_YERPY        PFQHKLFGLTINPERLAAIREERRENSRYASLRQCRMEVGEVEALFRKNQIRYLNSTNYS
PSRP_YERPN        PFQHKLFGLTINPERLAAIREERRENSRYASLRQCRMEVGEVEALFRKNQIRYLNSTNYS
PSRP_YERPS        PFQHKLFGLTINPERLAAIREERRENSRYASLRQCRMEVGEVEALFRKNQIRYLNSTNYS
PSRP_YERPB        PFQHKLFGLTINPERLAAIREERRENSRYASLRQCRMEVGEVEALFRKNQIRYLNSTNYS
PSRP_YERPE        PFQHKLFGLTINPERLAAIREERRENSRYASLRQCRMEVGEVEALFRKNQIRYLNSTNYS
PSRP_YERPP        PFQHKLFGLTINPERLAAIREERRENSRYASLRQCRMEVGEVEALFRKNQIRYLNSTNYS
PSRP_NITMU        NIRSKLFGFTIHPERLHEIRSERKPESVYASLKNCEYEVQSAEKLMRRAGIPYLDATSKS
PSRP_METFK        KYPEKLYGLSINPERLHSVRSERRPDSHYASLDNCRREIRLAEDLMHREGISWIDSTSRS
PSRP_DECAR        KHRSKLFGLTIQPERLHQIREERRAASNYASLANCRFEIAEAEKMMRREGIRWLDSSTKS
PSRP_AROAE        RHRSKLFGLTIAPERLSQIRQERRPNSRYASIENCRFEIDAAQKLMRRENIQWLDSTSKS
PSRP_AZOSB        NYRGKLFGLTIAPERLSQIRQERRPNSRYASLDNCKYEIDAAQKLMRRENIRWLDSTTKS
PSRP_BORA1        PYRDKLFGLSIQPERLSEVRNERRPNSRYATIEQCRYEVAEAERMMRRAGISWLSTTTKS
PSRP_BORPE        PYRGKLFGLSIQPERLAEVRNERRPNSHYARLEQCRYEVAEAERMMRREGISWLSTTTKS
PSRP_BORPA        PYRGKLFGLSIQPERLAEVRNERRPNSHYARLEQCRYEVAEAERMMRREGISWLSTTTKS
PSRP_BORBR        PYRGKLFGLSIQPERLAEVRNERRPNSHYARLEQCRYEVAEAERMMRREGISWLSTTTKS
PSRP_JANMA        AYKHKIFGLSIAADRLAEIRNERLPGSKYAALENCRYEVNEAERMMRREGIRWMSSTTKS
PSRP_HERAR        EYKSKIFGLSIAPDRLAEIRNERLPGSKYAALANCRYEVNEAEKMMRREGIRWMSSTTKS
PSRP_PARXL        AHRQKMFGLSIDPQRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGIKWLSSTHKS
PSRP_PARPJ        AHRQKMFGLSIDPQRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGIKWLSSTHKS
PSRP_BURMA        PHRDKLFGLSIDPMRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGVKWLSSTHKS
PSRP_BURPS        PHRDKLFGLSIDPMRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGVKWLSSTHKS
PSRP_BURP6        PHRDKLFGLSIDPMRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGVKWLSSTHKS
PSRP_BURP0        PHRDKLFGLSIDPMRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGVKWLSSTHKS
PSRP_BURP1        PHRDKLFGLSIDPMRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGVKWLSSTHKS
PSRP_BURM7        PHRDKLFGLSIDPMRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGVKWLSSTHKS
PSRP_BURMS        PHRDKLFGLSIDPMRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGVKWLSSTHKS
PSRP_BURM9        PHRDKLFGLSIDPMRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGVKWLSSTHKS
PSRP_BURTA        PHRDKLFGLSIDPMRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGVKWLSSTHKS
PSRP_BURVG        QHREKLFGLSIDPQRLSEIRNERRPGSKYAAPENCRYEINESEAMMRREGIKWLSSTHKS
PSRP_BURL3        AYSEKLFGLSIDPQRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGIKWLSSTHKS
PSRP_BURCJ        PYSEKLFGLSIDPQRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGIKWLSSTHKS
PSRP_BURCH        PYSEKLFGLSIDPQRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGIKWLSSTHKS
PSRP_BURCC        PYSEKLFGLSIDPQRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGIKWLSSTHKS
PSRP_BURCA        PYSEKLFGLSIDPQRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGIKWLSSTHKS
PSRP_BURM1        PHRDKLFGLSIDPQRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGIKWLSSTHKS
PSRP_BURA4        PHRDKLFGLSIDPQRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGIKWLSSTHKS
PSRP_BURCM        PHRDKLFGLSIDPQRLSEIRNERRPGSKYAAPENCRYEINEAEAMMRREGIKWLSSTHKS
PSRP_RALSO        EYKSKIFGLTIDPQRLSEIRNERRPGSKYAALENCRYEVNEAETLMRRESIKWLSSTHKS
PSRP_CUPMC        AYKQKIFGLSIDPQRLTEIRNERRPGSKYAAVENCRYEVNEAESMMRREGIKWLSSTHKS
PSRP_CUPPJ        DYKPKIFGLSIDPQRLTEIRNERRPGSKYAAIENCRYEVNEAEAMMRREGIKWLSSTHKS
PSRP_CUPNH        AFKPKIFGLSIDPQRLTEIRNERRPGSKYAALENCRYEVNEAEAMMRREGIKWLSSTHKS
PSRP_METPP        PHKKKCFGLTIAPERLREIRHERRPNSKYASLENCRLEVSAAESMMGREGIAWLSSTHKS
PSRP_LEPCP        PYKRKCFGLTIDADRLSQIRNERRPGSKYAALANCRYEINEAERMMKREGISWLSSTHKS
PSRP_DELAS        PSRKKLFGLTIDPQRLSSIRNERRPDSKYASLVNCRYEVAEAESMMRRSGIPWLSSTTKS
PSRP_RHOFT        AHKSKLFGLTIQPERLSEIRNERRPNSKYASLENCRMEVSEAEAMMRRSGIRWLSTTTKS
PSRP_POLSJ        PHRKKIFGLTIAPERLSQIRNERRPHSTYASLANCRHEIHEAEAMMRREGIRWLSTTTKS
PSRP_POLNA        PHRKKIFGLTIAPERLSQIRNERRPNSTYSSLANCRNEIHEAEAMMRREGIRWLSTTTKS
PSRP_VARPS        PHRKKIFGLTIQPERLSQIRNERRPDSRYASLENCRNEVSEAEAMMRRAGIRWLSTTTKS
PSRP_VEREI        PHRKKIFGLTIQAERLAEIRNERRPNSRYASLDNCRAEIAGAEAMMRRSSIRWLSTTTKS
PSRP_ACIET        PHRKKIFGLTIDPQRLSQIRNERRPGSRYADLVNCRNEVAEAEAMMRRSGIRWLSTTTKS
PSRP_ACISJ        PHRKKIFGLTIDPQRLSQIRNERRPGSRYADLVNCRNEVAEAEAMMRRSGIRWLSTTTKS
PSRP_ACIAC        PHRKKIFGLTILPERLSQIRNERRPGSKYADLANCRHEVAEAEAMMRRSGIRWLSTTTKS
PSRP_XYLFT        PYRKKLFGLTINPERLQQIRQERRPNSRYAALDTCKREVAAAEQMFSAERITTLSTTHTS
PSRP_XYLF2        PYRKKLFGLTINPERLQQIRQERRPNSRYAALDTCKREVAAAEQMFSAERITTLSTTHTS
PSRP_XYLFA        PYRKKLFGLTINPERLQQIRQERRPNSRYAALDTCKREVAAAERMFSAERITTLSTTHTS
PSRP_XYLFM        PYRKKLFGLTINPERLQQIRQERRPNSRYAALDTCKREVAAAERMFSAERITTLSTTHTS
PSRP_XANC8        NYRSKLFGLTIDPERLQQIRQERRANSRYSAAETCRREVATAERMFQMERIPTLSTTNTS
PSRP_XANCB        NYRSKLFGLTIDPERLQQIRQERRANSRYSAAETCRREVATAERMFQMERIPTLSTTNTS
PSRP_XANCP        NYRSKLFGLTIDPERLQQIRQERRANSRYSAAETCRREVATAERMFQMERIPTLSTTNTS
PSRP_XANOM        NYRSKLFGLTIDPERLQQIRQERRANSRYSAAETCRREVAIAERMFQMERIPSLSTTNTS
PSRP_XANOR        NYRSKLFGLTIDPERLQQIRQERRANSRYSAAETCRREVAIAERMFQMERIPSLSTTNTS
PSRP_XANAC        NYRSKLFGLTIDPERLQQIRQERRANSRYSAAETCRREVAIAERMFQMERIPSLSTTNTS
PSRP_XANC5        NYRSKLFGLTIDPERLQQIRQERRANSRYSAAETCRREVAIAERMFQMERIPSLSTTNTS
PSRP_STRMK        NYRRKLFGLTIDPDRLQQIRQERRPNSRYANLETCKREVAAAEVMFQMERIPTLSTTHTS
PSRP_STRM5        NYRRKLFGLTIDPDRLQQIRQERRPNSRYANLDTCKREVAAAEVMFQMERIPTLSTTHTS
PSRP_ALKEH        EHKRKLYGLTINVDRLQTIRSGRLPNSDYASLRQCSYEVARAEALFRSEGIPYVNTTTMS
PSRP_HALHL        SHRAKLFGLTIDPDRLHQIRSERRPNSRYAELRQCEYEVARAEAMFRREGIPYLDITTMS
                      .  .:      *  .*  *   . *.    *  :      :     :        *

PSRP_DESPS        IEETATQVA---QELSKQWNPIF------------------
E8REH6_DESPD      IEEIAVQAI---QAIGLT-KKQRPRTRDISGRSL-------
D6Z2G1_DESAT      IEEIATQVT---QELGIS-RKPSDK----------------
D3SE90_THISK      IEEIATQVR---DTLDRI-QGN-------------------
F9ZS74_ACICS      VEELASSILKYHQELAAT-DARG------------------
PSRP_THIDA        VEEIAARLR-------AS-----------------------
PSRP_DEIRA        VEEIAAGVL---ALLRQS-GRLEG-----------------
PSRP_DEIGD        VEEIAAGIL-----AQLR-RG--------------------
G0HCX4_CORVD      VEEMASIIL---TTMDLR-HT--------------------
B8H8F1_PSECP      VEEISATVL---QRMELH-H---------------------
F0M692_PSEPM      VEEISATVL---QRMQLH-H---------------------
E6SFI1_INTC7      VEEMAAVIM---QTRHMS-NLA-------------------
F5XSM2_MICPN      VEEMSTVIL----QSRLP--QFA------------------
D2S7N8_GEOOG      VEEIATVVI---QTLARQ-RPRSGDRAQPGHDLRRDGTTRP
PSRP_NITEU        IEEISASIV---NRAHLE-RRQHGT----------------
PSRP_NITEC        IEEISASII---NRMRLE-RRLYGT----------------
PSRP_THIRO        IEEISSHII---KALRGS-GEH-------------------
PSRP_CHRVO        IEEIASTIM---HKAALG-RKF-------------------
PSRP_LARHH        IEEIASTIL---HHTGIS-RRF-------------------
PSRP_DICNV        VEELAVHIM---QTCHLK-RRY-------------------
PSRP_NEIG1        VEELAVHIL---QACKLK-RRF-------------------
PSRP_NEIG2        VEELAVHIL---QACKLK-RRF-------------------
PSRP_NEIMB        VEELAVHIL---QACKLK-RRF-------------------
PSRP_NEIMF        VEELAVHIL---QACKLK-RRF-------------------
PSRP_NEIM0        VEELAVHIL---QACKLK-RRF-------------------
PSRP_NEIMA        VEELAVHIL---QACKLK-RRF-------------------
PSRP_LEGPA        IEEISTKVL---AIAGLQ-RKI-------------------
PSRP_LEGPH        IEEISTKVL---AIAGLQ-RKI-------------------
PSRP_LEGPC        IEEISTKVL---AIAGLQ-RKI-------------------
PSRP_LEGPL        IEEISTKVL---AIAGLQ-RKI-------------------
PSRP_CHRSD        IEEISTRMI---AETHLT-RRFSPR----------------
PSRP_PSEU5        VEEISAKIL---VEKGVE-RRLK------------------
PSRP_AZOVD        VEEISAKIL---VEKGVE-RRLK------------------
PSRP_PSEAE        VEEISAKIL---VEKGVE-RRFK------------------
PSRP_PSEA8        VEEISAKIL---VEKGVE-RRFK------------------
PSRP_PSEAB        VEEISAKIL---VEKGVE-RRFK------------------
PSRP_PSEMY        VEEISAKIL---VEKGVE-RRLK------------------
PSRP_PSEE4        VEEISAKIL---VEKGVE-RRFK------------------
PSRP_PSEPW        VEEISAKIL---VEKGVE-RRFK------------------
PSRP_PSEPG        VEEISAKIL---VEKGVE-RRFK------------------
PSRP_PSEP1        VEEISAKIL---VEKGVE-RRFK------------------
PSRP_PSEPK        VEEISAKIL---VEKGVE-RRFK------------------
PSRP_PSE14        VEEISAKVL---VEKGVE-RRFK------------------
PSRP_PSEU2        VEEISAKVL---VEKGVE-RRFK------------------
PSRP_PSESM        VEEISAKVL---VEKGVE-RRFK------------------
PSRP_PSEFS        VEEISAKIL---VEKGVE-RRFK------------------
PSRP_PSEPF        VEEISAKIL---VEKGVE-RRFK------------------
PSRP_PSEF5        VEEISAKIL---VEKGVE-RRFK------------------
PSRP_MARHV        VEEISTRIM---VTTGLK-RHR-------------------
PSRP_HAHCH        VEEISTRIM---MMTGIE-RHIR------------------
PSRP_ALCBS        IEEISTRVL---AMKGLK-RRLQ------------------
PSRP_PSYCK        VEEIATRIL---QMTGLK-RRIG------------------
PSRP_PSYA2        VEEIATRIL---QMTGLK-RRIG------------------
PSRP_ACIB3        IEEISTRIL---QMTGLK-RRIG------------------
PSRP_ACIBY        IEEISTRIL---QMTGLK-RRIG------------------
PSRP_ACIBS        IEEISTRIL---QMTGLK-RRIG------------------
PSRP_ACIBT        IEEISTRIL---QMTGLK-RRIG------------------
PSRP_ACIB5        IEEISTRIL---QMTGLK-RRIG------------------
PSRP_ACIAD        IEEISTRIL---QMTGLK-RRIG------------------
PSRP_PHOPR        VEEIATRLL---DISGLK-RKMC------------------
PSRP_VIBVU        VEEISTRVL---EKTGLK-RRLF------------------
PSRP_VIBVY        VEEISTRVL---EKTGLK-RRLF------------------
PSRP_VIBC3        VEEISTRIL---ERTGLK-RRLF------------------
PSRP_VIBCM        VEEISTRIL---ERTGLK-RRLF------------------
PSRP_VIBCH        VEEISTRIL---ERTGLK-RRLF------------------
PSRP_VIBA3        VEEISTRIL---ERTGLR-RRLL------------------
PSRP_VIBCB        VEEITTRIL---ERAGMK-RRLFG-----------------
PSRP_VIBPA        VEEISTRIL---ERAGMK-RRLFG-----------------
PSRP_IDILO        VEEIAAKIL---AKTNLE-RHRY------------------
PSRP_ALTMD        IEEISAKIL---AETGLK-RRKY------------------
PSRP_PSEA6        IEEISAKIL---ATTGLQ-RKKY------------------
PSRP_COLP3        VEEITAKIL---TETGLQ-RYKY------------------
PSRP_PSET1        VEEISAKII---SDTDLE-RRKY------------------
PSRP_AERS4        VEEISAKIL---EATGMR-RQLY------------------
PSRP_AERHH        VEEISAKIL---EATGLR-RQLY------------------
PSRP_SHEPW        VEEIATKIL---EATSLE-RHMF------------------
PSRP_SHEPA        VEEIATKIL---EETGLK-RHMF------------------
PSRP_SHEHH        VEEIATKIL---EITGLK-RHMF------------------
PSRP_SHELP        VEEIATKIL---DVTGLE-RHMF------------------
PSRP_SHESH        VEEIATKIL---DVTGLE-RHMF------------------
PSRP_SHEWM        VEEIATKIL---AMTGLE-RHMF------------------
PSRP_SHEAM        VEEIATKIL---DMTGME-RHMF------------------
PSRP_SHEB2        VEEIATKIL---DVTGLE-RHMF------------------
PSRP_SHEB8        VEEIATKIL---DVTGLE-RHMF------------------
PSRP_SHEB5        VEEIATKIL---DVTGLE-RHMF------------------
PSRP_SHEB9        VEEIATKIL---DVTGLE-RHMF------------------
PSRP_SHESW        VEEIATKIL---DVTGLE-RHMF------------------
PSRP_SHEPC        VEEIATKIL---DVTGLE-RHMF------------------
PSRP_SHEON        VEEIATKIL---DVTGLE-RHMF------------------
PSRP_SHESM        VEEIATKIL---DVTGLE-RHMF------------------
PSRP_SHESR        VEEIATKIL---DVTGLE-RHMF------------------
PSRP_SHESA        VEEIATKIL---DVTGLE-RHMF------------------
PSRP_SHEDO        VEEIATKIL---DVTGLA-RHMF------------------
PSRP_SHEFN        VEEIATKIL---DITGLE-RHMF------------------
PSRP_ENTAG        VEEIATKIL---DIMGLT-RRMY------------------
PSRP_ERWT9        VEEIATKIL---DIMSLT-RRMY------------------
PSRP_KLEP3        VEEIATKIM---DIMGLN-RRMY------------------
PSRP_KLEP7        VEEIATKIM---DIMGLN-RRMY------------------
PSRP_ENT38        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_CITK8        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALG2        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALA4        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALCH        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALDC        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALEP        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALHS        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALNS        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALPA        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALPB        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALPC        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALPK        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALSV        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALTI        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_SALTY        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_ESCF3        VEEIATKIL---DIMGLN-RRMY------------------
PSRP_ECO7I        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_SHIB3        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_SHIBS        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECOL5        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECOLI        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECO24        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECO27        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECO45        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECO55        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECO57        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECO5E        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECO81        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECO8A        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECOBW        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECODH        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECOHS        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECOK1        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECOL6        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECOLC        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECOSE        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECOSM        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECOUT        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_SHIDS        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_SHIF8        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_SHIFL        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_SHISS        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_ECOLU        VEEIATKIL---DIMGLS-RRMY------------------
PSRP_PHOLL        VEEISTKII---DMMKLN-RRMF------------------
PSRP_SODGM        VEEIAAKIM---DVLGMS-RRMY------------------
PSRP_PECAS        VEEISAKII---DILGMS-RRMY------------------
PSRP_YERE8        VEEISTKIL---DILGMS-RRMF------------------
PSRP_YERP3        VEEISTKIL---DILGMS-RRMF------------------
PSRP_YERPA        VEEISTKIL---DILGMS-RRMF------------------
PSRP_YERPY        VEEISTKIL---DILGMS-RRMF------------------
PSRP_YERPN        VEEISTKIL---DILGMS-RRMF------------------
PSRP_YERPS        VEEISTKIL---DILGMS-RRMF------------------
PSRP_YERPB        VEEISTKIL---DILGMS-RRMF------------------
PSRP_YERPE        VEEISTKIL---DILGMS-RRMF------------------
PSRP_YERPP        VEEISTKIL---DILGMS-RRMF------------------
PSRP_NITMU        IEELATAVL---HEAKLE-RKIY------------------
PSRP_METFK        IEELSTIIL---QKIRVN-SNH-------------------
PSRP_DECAR        IEEISTTIL---QELKLR-----------------------
PSRP_AROAE        IEEISATIL---QAVRLN-RPVY------------------
PSRP_AZOSB        IEEISATIL---QSVRLN-RPGY------------------
PSRP_BORA1        IEEIATTVL---QEVGLG-R---------------------
PSRP_BORPE        IEEIATTVL---QEVGLE-RV--------------------
PSRP_BORPA        IEEIATTVL---QEVGLE-RV--------------------
PSRP_BORBR        IEEIATTVL---QEVGLE-RV--------------------
PSRP_JANMA        IEEIAATIL---QEIKLD-PPIKD-----------------
PSRP_HERAR        IEEISATIL---QEIKSE-HRTD------------------
PSRP_PARXL        IEEIATTIL---QEIKLE-RAAY------------------
PSRP_PARPJ        IEEIATTIL---QEIKLD-RPSY------------------
PSRP_BURMA        IEEIATTIL---QEIKLE-RQSY------------------
PSRP_BURPS        IEEIATTIL---QEIKLE-RQSY------------------
PSRP_BURP6        IEEIATTIL---QEIKLE-RQSY------------------
PSRP_BURP0        IEEIATTIL---QEIKLE-RQSY------------------
PSRP_BURP1        IEEIATTIL---QEIKLE-RQSY------------------
PSRP_BURM7        IEEIATTIL---QEIKLE-RQSY------------------
PSRP_BURMS        IEEIATTIL---QEIKLE-RQSY------------------
PSRP_BURM9        IEEIATTIL---QEIKLE-RQSY------------------
PSRP_BURTA        IEEIATTIL---QEIKLE-RQSY------------------
PSRP_BURVG        IEEIATTIL---QEIRLE-RQSY------------------
PSRP_BURL3        IEEIATTIL---QEIRLD-RQSY------------------
PSRP_BURCJ        IEEIATTIL---QEIRLD-RQSY------------------
PSRP_BURCH        IEEIATTIL---QEIRLD-RQSY------------------
PSRP_BURCC        IEEIATTIL---QEIRLD-RQSY------------------
PSRP_BURCA        IEEIATTIL---QEIRLD-RQSY------------------
PSRP_BURM1        IEEIATTIL---QEIRLE-RQSY------------------
PSRP_BURA4        IEEIATTIL---QEIRLD-RQSY------------------
PSRP_BURCM        IEEIATTIL---QEIRLD-RQSY------------------
PSRP_RALSO        IEEIATTIL---QDIKME-RDAY------------------
PSRP_CUPMC        IEEIATTIL---QEIKVD-RDNY------------------
PSRP_CUPPJ        IEEIATTIL---QEIKVD-RDNY------------------
PSRP_CUPNH        IEEIATTIL---QEIKVD-RDNY------------------
PSRP_METPP        IEEIATTIL---RDIRPD-RLIY------------------
PSRP_LEPCP        IEEIATTIL---RDIRPD-RLIY------------------
PSRP_DELAS        IEEIATTIL---QEVLPQ-HLGH------------------
PSRP_RHOFT        IEEISTTIL---QEIRPE-RLAY------------------
PSRP_POLSJ        IEEISTTIL---QEIRPE-RLEY------------------
PSRP_POLNA        IEEIATTIL---QEIRPE-RLEY------------------
PSRP_VARPS        IEEIATTIL---QELKPE-RLVY------------------
PSRP_VEREI        IEEIATTIL---QELRPE-RLVY------------------
PSRP_ACIET        IEEIATTIL---QEVRPE-RLQY------------------
PSRP_ACISJ        IEEIATTIL---QEVRPE-RLQY------------------
PSRP_ACIAC        IEEIATTIL---QEVRPE-RLVY------------------
PSRP_XYLFT        IEEISSKVL---VTLGLQ-REMF------------------
PSRP_XYLF2        IEEISSKVL---VTLGLQ-REMF------------------
PSRP_XYLFA        IEEISSKVL---VTLGLQ-REMF------------------
PSRP_XYLFM        IEEISSKVL---VTLGLQ-REMF------------------
PSRP_XANC8        IEEISSKVL---STLGLQ-REMF------------------
PSRP_XANCB        IEEISSKVL---STLGLQ-REMF------------------
PSRP_XANCP        IEEISSKVL---STLGLQ-REMF------------------
PSRP_XANOM        IEEISSKVL---STLGLQ-REMF------------------
PSRP_XANOR        IEEISSKVL---STLGLQ-REMF------------------
PSRP_XANAC        IEEISSKVL---STLGLQ-REMF------------------
PSRP_XANC5        IEEISSKVL---STLGLQ-REMF------------------
PSRP_STRMK        IEEISSKVL---ATLGLQ-RELY------------------
PSRP_STRM5        IEEISSKVL---ATLGLQ-RELY------------------
PSRP_ALKEH        IEEIATKII---HEAKLE-RRLY------------------
PSRP_HALHL        IEEISSTVI---HQHALT-RRV-------------------
                  :** :