CLUSTAL format seed alignment for MF_01063

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Q1ZPM9_PHOAS          --MSEP-SPENLSEKLFAPRP--TSKETSNLVKIAHVRSG---KVNNALDGESETGWYRV
D0I7J9_GRIHO          --MNAA-ESENLSIKLFKQHK--HAKETSTIVGSVNQPRN---GLHNAIDGDSHSNWYRI
F0LUG8_VIBFN          --MSEE-ISKNLSETLFQKHK--QAKETSSLIQYMPSSQQ---FLEQKKEQEDNA-WYRN
FRSA_VIBC3            --MSEA-SSKNLSETLFQNHK--QAKETSSLTQYMPSSLE---LLDTRREQSSQA-WYRN
FRSA_VIBVU            --MSEE-VSKNLSETLFVKHK--QAKETSALTQYMPTSQS---LLDEIKEKNGFS-WYRN
C9P2Z6_VIBME          --MSES-SNINLSETLFQQHK--EAKETSSLTQYMPSSSE---FFEQKMEQDPFS-WYRN
U4K2F5_9VIBR          MSISEEQTSKNLSEELFQNHR--QAKETSALVRYMPSNES---YLDKKREEQGES-WYRT
Q5E6W2_ALIF1          --MPQP-ESENLSVKLFKNHK--QALETSGLVPYLPSSLE---QLE----QSGRT-WYRE
FRSA_SALTY            --MTQA----NLSETLFKPRF--KHTETSTLVRRFNRGSQ--PPMQSALDGKNVPHWYRM
FRSA_SALTI            --MTQA----NLSETLFKPRF--KHTETSTLVRRFNRGSQ--PPMQSALDGKNVPHWYRM
FRSA_ECOLI            --MTQA----NLSETLFKPRF--KHPETSTLVRRFNHGAQ--PPVQSALDGKTIPHWYRM
V5AFM0_ENTCL          --MPQS----NLSETLFKPRF--KYPETSTLVRRFNPGVQ--PPMQSALDGKNVPQWYRM
W1EQ05_KLEPN          --MSQA----NLSETLFKPRF--KHPETSTLVRRFSAGKP--QAMQSALSGNHVDHWYRL
FRSA_PECAS            --MAQA----NLSETLFKPSF--KHRETSTLVRRTRHDQET-QGLHSTLEGEKTSSWYRM
D4GL10_PANAM          --MPGK----NLSVELFKPRF--KHPETSTLVRLRRHATH---EVHSALDGDSQRGWYRM
D3V437_XENBS          --MTKQ----NLSESLFKPQL--KQQETSTLVKYIR-PQST-AASGRMLGGERREHWYRM
D3V9T6_XENNA          --MTKK----NLSESLFKPWF--KHRETSTLVKFIR-PQSV-TASDSMLGGERREHWYRM
FRSA_PHOLL            --MANR----NLSESLFKPRQ--KHQETSTLVKHRD-PRLI-AGNYSTLDGNSHGSWYRM
K8WPM7_9GAMM          --MTQQ----NLSEKLFKPKI--KQVETSTLVSYRDMSFSI-LKDHSALSGSQHAGWYRM
J7U4M7_MORMO          --MTQQ----NLSEKLFKPKI--KHPETSALVNFTR-SGMK-EVRGSVLSGCTHPGWYRM
A0A242P7W7_9GAMM      -MVMTE----NLSEKIFKPQY--DYPETSSLINRLDSSNG---SSISPLDGEIDSKWYRI
C4LBK2_TOLAT          ---MSAPSEKNLSETLFNKVQPHKIRETSTISNSG-APFPCEPQEQYLIDGLCTASWFRI
A0KNR1_AERHH          ---MDLNDDLNLTEKLFTRVK--KVLETSEVSNSSPVAEQDDNVDETFIDGSMSSRWYRL
H2G0Q1_OCESG          ---MTSQQS-NLSERLFSPVQ--HASETSTIAFAG-RRSPGTQEPAPFVDGADLPGFYRL
R9PMH2_AGAAL          -------MKENLSEVLFKPRI--NVVETSTVSNSTAAQLSAVGQE-------EGRNWYRI
A1SYU2_PSYIN          -------MSENLSETLFVHKS--NVQETSTIVANS-ATKKNHKQNNVVMEGEEKPGWYRL
M4U9X7_9GAMM          -------MSENLSKILFTQKR--HVQETSAIIANS-STKKNLKLNDVIKEGESRDGWYRL
A0A366WDV2_9GAMM      -------MSKNLSEVLFSEKN--NVRETSSLIANS-GSKKHQRQHQSTLDGQQSVGWYRL
                                **:  :*         *** :                         ::* 

Q1ZPM9_PHOAS          LRRPQWIWQGVDPIELEAVLARIASAKAPRTSEHLLDTVIGYKPGNWTYEWSQLGANYQK
D0I7J9_GRIHO          LRRPQWIWQGVDPLEMEALLARIAGSPNNRSSEALLDTVVGYRPGNWSYEWTQAGMVHQK
F0LUG8_VIBFN          LRRLQWAWQGIDPVEQEEVLARIASSKHSRTEDRWLDTVMGYRGGNWAYEWTKLGMQHQA
FRSA_VIBC3            LRRLQWIWQGVDPVEQEEILARIASSKHSRTHDEWLDTVMGYRSGNWTYEWTRVGMLHQK
FRSA_VIBVU            LRRLQWVWQGVDPIEQEQVLARIASSKHSRTDEQWLDTVMGYHSGNWAYEWTRLGMEHQK
C9P2Z6_VIBME          LRRLQWAWLGINPIDQEEVLANMASSEHSRSHEKWLDTVIGYHSGNWTYEWTKLGGRYHK
U4K2F5_9VIBR          LRKMQWIWQGIDPLELESVLSRIASSDHSRTHDEWLDTVMGYHSGNWTYEWIHQGMINQK
Q5E6W2_ALIF1          LRRPQWIWQGVDAIELESILARIANSQKHRSRDEWLDTVSGYHSGNWAYEWIHAGMEHQK
FRSA_SALTY            INRLMWIWRGVDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWAKQAMDWQQ
FRSA_SALTI            INRLMWIWRGVDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWAKQAMDWQQ
FRSA_ECOLI            INRLMWIWRGIDPREILDVQARIVMSDAERTDDDLYDTVIGYRGGNWIYEWATQAMVWQQ
V5AFM0_ENTCL          INRLMWIWRGIDAREILEVQARIVMSQAERTDAELLDTVVGYRNGNWIYEWSAQAMSWQQ
W1EQ05_KLEPN          INRLMWIWRGVTPQEILDVQARIVMSEAERTDPELFDTVIGYRGGNWIFEWAKEAMQWQQ
FRSA_PECAS            INRLMWIWRGVNPWEIEDVLSRIAASQADRSNEQLLDTVIGYRGGNWIYEWAKQGADWQQ
D4GL10_PANAM          LNKLMWAWRGLPSQEISEVLARIAISDVEHTNSALLDTVIGYRNGNWNYEWSRQAGIWQQ
D3V437_XENBS          IDWLAWIWRGINPLEIQDVLSRIAVIDAERSDDHLLDTVIGYRKGNWAFEWTQQAMYWQR
D3V9T6_XENNA          INWLAWIWRGIDSLEIQDILSRIAVTDAERSTDHLLDTVIGYRKGNWAFEWSQLAMQWQQ
FRSA_PHOLL            INRLMWIWREIDPFEIEEVLCRIAMTNAQRSDDNLLDTVIGYRKGNWVFEWSHQAMLWQQ
K8WPM7_9GAMM          LNRLWWIWRGIDAIEIGEVLSRIAAINAARSNPNWLDTVIGNMRGNWCFEWSNQAMLWQQ
J7U4M7_MORMO          INRLMWAWRGIPPLETEEVLSRIAASDAPRSDDALLDTVIGYRRGNWAYEWSQQAMLWQR
A0A242P7W7_9GAMM      INPLLWYWRGLPKLEIEAVLSRIAISTKRHTNDKWLDSVIGYQSGNWIYEFLNQAAMWQA
C4LBK2_TOLAT          LRRAFWIWQGANPIEVEEILARIATSDGERSNPRQLDTVQGFVPGNWSYEWSQLAGEHNR
A0KNR1_AERHH          LRRPTWAWQGADPVEVEQTLACIAMGEGERTHERFLDTIKGYVPGNWVYEWSQLAGRYFN
H2G0Q1_OCESG          QKRAFWHWLGVDSIEIEATLARMAAAPGPRSVDGWLDTVAEYRPGNWVFEWSRLGAEAQQ
R9PMH2_AGAAL          LRREYWAWLGLDPIETESLFADIAMCDKPRTSE-LLDTIGGYQPGNWNYEWMQRAVKHQI
A1SYU2_PSYIN          LKFMLWSWQGLDLIECSEVLARIAVSTHPRSDQELLDSVIGFHSGNWSYEWTQKAMFYYK
M4U9X7_9GAMM          LKFLLWSWQGIEAIDCYDVLSKISSSKNPRSETDILDSVIGFRSGNWAYEWTQKGMYYQK
A0A366WDV2_9GAMM      LKLLQWSWQGIDIIDCYEVLAKISASTNPRTDSNLLDTVIGFRSGNWSYEWSKKAMTYQK
                           * *      :     . :      ::     *::     *** :*:   .     

Q1ZPM9_PHOAS          QARLLLNEGEKL----KASELLLKASTHYSIAAYPYIKGDQLADQAELQANQSYREAIEL
D0I7J9_GRIHO          CAVGCEEKGNRI----EAVEHWYRACTYFSIAAYPHLKGDPLSLQAEVLANKAFHAAIEK
F0LUG8_VIBFN          RAGSKAGE--------KAADEMFAASLCFSIAGYPHLRNDNLALQAQILANNAYMEAANL
FRSA_VIBC3            QAAERQGE--------EAADQMFAAALYYSIAGYPHLRNDNLALQAQVLANNAYQEAAKL
FRSA_VIBVU            RAGEMTNE--------AASEALFSASLCYSIAGYPHLKSDNLAIQAQVLANSAYLEAAKK
C9P2Z6_VIBME          QSEALTGE--------AAAERMFSASLCYSIAGYPHLKNDTLAIQARVLANAAYKQASEL
U4K2F5_9VIBR          KGDELKGE--------EASNAYFNASLCFSIAGYPHIKGDSLSIQAQVLVHKAYDKAMEH
Q5E6W2_ALIF1          TASELDGD--------EAAEAYFKASLYFSVAGYPHIKGDNLAIQSQVLASQAYDMAAKQ
FRSA_SALTY            KACQEQDAM-------RSGRYWLHASTLYNIAAYPHLKGDELAEQAQALANRAYEEAAQR
FRSA_SALTI            KACQEQDAM-------RSGRYWLHASTLYNIAAYPHLKGDELAEQAQALANRAYEEAAQR
FRSA_ECOLI            KACAEDDPQ-------LSGRHWLHAATLYNIAAYPHLKGDDLAEQAQALSNRAYEEAAQR
V5AFM0_ENTCL          KAMQETDSA-------LSGRHWLHASNLYSIAAYPHIKGDSLAEQAQALANRAYEEAAQR
W1EQ05_KLEPN          KAGQEADSL-------LSGRHWLHASNLYSIAAYPHIKGDELAEQAQALANRAYEEAAQR
FRSA_PECAS            RATESGDDA-------QTGQFWLNAANLYSIAAYPHIKGDELAEQAQTLANRAYEEAAKY
D4GL10_PANAM          RALDANTDEHD-----RAGHDWLHASHLYSVAAYPYIKGDELADQAQTLASRAYEEATQR
D3V437_XENBS          EALRAEQTS-------EAGTYWLKAAMLYSIAAYPHLRGDELAEQAAVLASKSYENAAHS
D3V9T6_XENNA          EALRAEEAE-------QAGACWLKASTLYSIAAYPHLRGDELADQAIVLANKAYENAARF
FRSA_PHOLL            RALQAEQIP-------EASNFWLKAANLYSIAGYPHLKGDELSQQAVILANKAYENAARC
K8WPM7_9GAMM          KALRFENGK-------DASQAWLHSANLYSIAAYPFIKGDELADQAVLLACKAYDNAAQF
J7U4M7_MORMO          KALEFESGE-------KACEAWLLAANLYSIAGYPHLKGDELADQATVLANQAYENSARF
A0A242P7W7_9GAMM      KADNAAQSSLTEESKNSLHQDYLIASEYASIASYPHFKNDELAMYAQTCAYQSYMKALEY
C4LBK2_TOLAT          KAKEAEEAGQQR----TARKEYFLAARYYSIASYPFLKGDELAEQAQVQANLAYRDGGRF
A0KNR1_AERHH          RGRELVAQGERA----AALKSLLKAVRYYSIASYPHLKNDELADQAQLLGNMAYREAGRL
H2G0Q1_OCESG          RAR---QAGTPE----QARQQFLAAARYFALASYPHLKGDRLALQAQLLANQAYREAGRL
R9PMH2_AGAAL          TAKDAEQSGQRD----KAYQEFLLASYSATIAAYPHFKGDDLVASAHALAHSNLMAATEQ
A1SYU2_PSYIN          QGKAYAQQGEPE----KAKKAYYLASQFYSVASYPHLKGDELSLQAQALAFNNYKESAKY
M4U9X7_9GAMM          KAKEFVEEGNNS----RAQKAFYSASQFYSVASYPHLRGDELSIQAQLLAFQNYRESFKY
A0A366WDV2_9GAMM      QANQYSQDGDTQ----QAQQHYYLASQLYSVASYPHLKGDENSIQAQTLAVTNYRQSFMH
                       .                      :     :*.**.::.*     :          .   

Q1ZPM9_PHOAS          -RPHDMRTINVKYE-GKTFEAFIHLPR--TDKLLPTVIVSGGLDTLQCDLWRLYEDYLGP
D0I7J9_GRIHO          -SPFKVKSLVTQVD-GRALEGFLYLPH--TDAPLPTVIISGGLDALQTDMCRIFETYFAP
F0LUG8_VIBFN          -TKYVVKRLEFPYK-NKKIVGHLHLSN--TEKPQPVVIVSAGLDSLQTDMWRLFRDFLVK
FRSA_VIBC3            -TGFVVKRLEFSYQ-NKKIAGYLHLRN--TDSPKPVVLVSAGLDSLQTDMWRLFRDYLAK
FRSA_VIBVU            -SKYIIKQLEIPFE-KGKITAHLHLTN--TDKPHPVVIVSAGLDSLQTDMWRLFRDHLAK
C9P2Z6_VIBME          -TQYTIKPLEFDYQ-GKKILGHLHLSH--TDEPQPVVIVSAGLDSLQTDMWRLFRDYLAK
U4K2F5_9VIBR          -SQYVTKKVEVPFG-KRKIKANLHLPH--TDRQLPVVIVSAGLDSLQSDMWRLFRDYLAP
Q5E6W2_ALIF1          -TSHRVEKILVPYQ-GRKITCYLHLPN--TEKPLPVVIVSGGMDSLQTDMWRLYRDFLAP
FRSA_SALTY            -LPGSLREMEFAVPGGSPVTAFLHMP--KGDGPFPTVLMCGGLDAMQTDYYTLYERYFAP
FRSA_SALTI            -LPGSLREMEFAVPGGSPVTAFLHMP--KGDGPFPTVLMCGGLDAMQIDYYTLYERYFAP
FRSA_ECOLI            -LPGTMRQMEFTVPGGAPITGFLHMP--KGDGPFPTVLMCGGLDAMQTDYYSLYERYFAP
V5AFM0_ENTCL          -LPGSIKELEFAIPGGAPVTGFLHMP--EGEGPFPTVLMCGGLDGLQIDYYTLYERYLAP
W1EQ05_KLEPN          -LPGSLRELEFTIPGGSPITGFLHMP--KGEGPFPTVLMCGGLDSLQTDYYNLYENYFSP
FRSA_PECAS            -LPYELKELTFPIAGGGTLTGFLHMPS-QGKAPFPTVLMCGSLETLQSDYHRLFQDYFAP
D4GL10_PANAM          -LPGELKTLTFPIQGGSPVSGFLHMPS-GVDAPYPTVMFCGALDSLQTDHYRLFHDYLAP
D3V437_XENBS          -SDYELKKLEFKLEGGKSVTGLLHLPP-NVQEPCPTILVCTSLDNVQSDFWRLFRDHLAP
D3V9T6_XENNA          -FDYELKKLEFQLEDGKSVTGLLHIPS-RVKEPCPTILVCASLDNVQSDCWRLFREHFSP
FRSA_PHOLL            -SGYQLRKIEFKLKEGGCVTGFLHLPQ-QLQRPSPTILVCGSLDNLQSDYYRLFRDYLAP
K8WPM7_9GAMM          -SLYKLKKLSFKVDGNKEVCGFLHIPA-TGQGPFPTVMICGTLDSLQIDYCQFFRRYLEP
J7U4M7_MORMO          -AAYELKKIEFKMESGGNICAFLHLPP-GKGSAFPVVMMCGSLDNLQSDYCRYFRDYLAP
A0A242P7W7_9GAMM      -SPYSTKQLEFKIE-NRVIKSILHLPNNSNSGVCPVVLICNGLGNLQIDYYRYFSEYLAP
C4LBK2_TOLAT          -LPVPLKELRVPFR-GKEIKGYLHLPN--DDHPVPLVMVTGAIDSSQLDFIRLFEKVLAP
A0KNR1_AERHH          -FKVPLKELQVPFR-GKHIQGYLHLPT--TDKPVPLVIVSGGIDSLQVDFLNFYLKCLEP
H2G0Q1_OCESG          -LPVPLKELRIPFN-GKEVQGYLHLPT--NDLPLPLVMVSGSLDSLQLDFWRFYERYLAP
R9PMH2_AGAAL          -SKHECKTINVPID-GKQVACYLHLPD--TDSVKPVVMVSGGLDTIQTELYPFFERFLAP
A1SYU2_PSYIN          NHNMILKEIKVPFQ-GKEVTCYLHLPN--DETIHPVVIISGGLDTLQCELLPLFEKELAP
M4U9X7_9GAMM          ASKSLLKEIKVPFQ-GKQIICYLHLPH--TEHIHPLVIVSGGIDMLQCEMYSLFENDLAP
A0A366WDV2_9GAMM      NRHALLKEIQVPFQ-GKQVTTFLHLPN--DDVIHPVVIVSAGIDTLQCDFLPLFERYLKP
                            . :         .   :::         * ::.   :   * :    :   :  

Q1ZPM9_PHOAS          AGYAMVTLDMPSVGHCDRWNLTEDTSRLHQALLQQIRDVPWVDHHKVAMLGLRMGGNAAI
D0I7J9_GRIHO          ANIAMLTLDMPSVGRSSHWALTQDTSRLHQAMLNELSSVPWVDHHRVGCMGVRFGGNAAV
F0LUG8_VIBFN          RDIAMLTIDMPSVGHSSHWALTEDSSCLHQAVLNQLDTLPWVDHFRVGLVGFRFGGNAMV
FRSA_VIBC3            RDIAMLTIDMPSLGASSHWPLTEDSSCLHQAVLNQLADLPWVDHFRIGLIGFRFGGNAMA
FRSA_VIBVU            HDIAMLTVDMPSVGYSSKYPLTEDYSRLHQAVLNELFSIPYVDHHRVGLIGFRFGGNAMV
C9P2Z6_VIBME          RNIAMLTIDMPSVGHSNHWSLTQDSSCLHQAVLNQLAPLPWVDHRRVGLIGFRFGGNAMV
U4K2F5_9VIBR          NDIAMLTLDMPSIGHSSHWDLTEDSSCLHKAVLDELPNLPWVDHFKVGLVGFRFGGNAAV
Q5E6W2_ALIF1          NNMAMLTLDMPSIGHSSHWPLSEDSSCLHQAVLNYLPNIPWVDRFHAAVMGFRFGGNVAL
FRSA_SALTY            RGIAMLTLDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAV
FRSA_SALTI            RGIAMLTLDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAV
FRSA_ECOLI            RGIAMLTIDMPSVGFSSKWKLTQDSSLLHQHVLKALPNVPWVDHTRVAAFGFRFGANVAV
V5AFM0_ENTCL          KGIAMLTLDMPSVGFSTKWKLTQDSSLLHQHALQALPNIPWVDHTRVAAFGFRFGANVAV
W1EQ05_KLEPN          LGIAMLTIDMPSIGFSSKWTLNQDTSLLHQHALRHLENVPWIDHTRVAAFGFRFGANIAV
FRSA_PECAS            AGMAMLTIDVPSVGFSSRWKLTQDSSFLHQQVLRALPDVPWVDHCRVTAFGFRFGANIAV
D4GL10_PANAM          RGIAMLTLDMPSVGNSMKWKLSQDTSFLHQQVLRDLTSVPWIDHTRVAALGFRFGANVAV
D3V437_XENBS          LGFAMLTVDMPAVGYSAKFKLTQDTCILHQQVLQQLNQIPWIDHTRVGVMGFRFGANIAV
D3V9T6_XENNA          LGFAMLTLDMPAVGYSAKFTLTQDTCVLHQQVLQQLNSVPWIDHTRIGVFGFRFGANIAV
FRSA_PHOLL            LGFAMLTVDMPSIGYSSRLRMTQDTCILHQQIIHQLDEIPWIDHTRIGLFGFRFGANIAV
K8WPM7_9GAMM          LGIAMLTLDMPSIGYSIKFKLTQETSALHEQVVRQLETIAWIDHTRFGIMGLKFGANIAL
J7U4M7_MORMO          QGIALLTLDMPSIGYSSKQTLGQESSLMHQQVLDQLRNVPWIDHTRVAVMGLRFGANVAM
A0A242P7W7_9GAMM      QGFAMLTVDLPTVGYSRNFVLSQNSSQIHQAVIEQLPSVPWVDSNRVIVAGFRFGSHIAT
C4LBK2_TOLAT          LGIGMLSLDLPGCGYSSHWPLVQDSSRLHQAVLQYLKDVPWVDDQRIGMIGFRLGGNVAV
A0KNR1_AERHH          NGIGMLSLDMPGIGYAEHWPLVQDTSRLHQAVLNHLSEVAWVDHQRIAMVGFRLAGNVAA
H2G0Q1_OCESG          AGIAMLTVDMPGVGYSAHWPLVQDSSRLHQAVLHYVPNIPWVDERRVAMLGVRMGGNVAA
R9PMH2_AGAAL          AGIAMLTVDMPGAGHCLNWKLQQDSSRIHLAILDHLPKVPWVDDARVAMLGYRFAGNVAA
A1SYU2_PSYIN          AGIAMLTVDLPGIGFASHVKLDQNSSNLHQAICHFLKGVPWVDHDRIALMGMRFGGNVAA
M4U9X7_9GAMM          AGIAMLTVDIPGVGFSSQVKLTEDASQLHQAIIHYMQHVPWVDQARISLMGMRFGGNIAT
A0A366WDV2_9GAMM      AGIAMLTVDMPGVGFSNHLKLTQDTSLLHQAVLQHVADIPWVDQSRVALMGMRMGANALN
                       . .::::*:*  * . .  : :: . :*      :  :.::*  :    * ::..:   

Q1ZPM9_PHOAS          RLGFMEPTRLKTCISLGGAIHSVLTQPKMIEQIPRMYLDVLASRMGKNGQSETSIISHLP
D0I7J9_GRIHO          RMAFVEQNRVKSCVSIGGVLHAMLSDTQRLNRIPPMYLDTMVSRMGKM-QASTSFLTQLQ
F0LUG8_VIBFN          RLSFLEPERVKACVSLGAPIHDVLVSPKKMKMMTKMYLDVLASRLGKSAVDIDSLSGQLM
FRSA_VIBC3            RLAFLESDKVKACVSLGAPIHDIFTSPNKLAAMPKMYLDVLASRLGKNVVDVRSLSGQLM
FRSA_VIBVU            RLSFLEQEKIKACVILGAPIHDIFASPQKLQQMPKMYLDVLASRLGKSVVDIYSLSGQMA
C9P2Z6_VIBME          RLSFIESDKIKACVAIGAPVHDIFVSQQKMKLMSKMYMDVLASRIGKHAVDIPSLSAQLM
U4K2F5_9VIBR          RLSFLEQDRIKACVALGAPIHDVLSSTDKLLQMPKMYLDMLASRLGKDVVDIHSLAGQMR
Q5E6W2_ALIF1          RLSFLEPSRLKACVALGAPVHQILTNSARLKTMPKMYLDVLASRLAKQVVDINSLTSQMQ
FRSA_SALTY            RLAYLEAPRLKAVACLGPVVHALLSDPQRQSTVPEMYLDVLASRLGMHDASDEALRVELN
FRSA_SALTI            RLAYLEAPRLKAVACLGPVVHALLSDPQRQSTVPEMYLDVLASRLGMHDASDEALRVELN
FRSA_ECOLI            RLAYLESPRLKAVACLGPVVHTLLSDFKCQQQVPEMYLDVLASRLGMHDASDEALRVELN
V5AFM0_ENTCL          RLAYLEASRLKAVACLGPVVHSLLSEPLRQGDVPEMYLDVLASRLGMHDASDEALRVELN
W1EQ05_KLEPN          RLGYLEPQRLKAVACLGPVVHGLLVDPLHQGRVPEMYLDVLASRLGMHDASDEALRVELN
FRSA_PECAS            RLAYLESQRLRGVACLGPVVHHLLSDPNRQQQVPDMFMDVLASRLGMPFSTDASLKTELG
D4GL10_PANAM          RLAYLESQRLKAVACLGPIVHSMLTQAPLQNKVPDMYMDMLASRLGMTGTTDSALRAELL
D3V437_XENBS          RLAYLEPQLIKGVAVIGPIVHTLLNDEKRQQNIPSMYIDVLANRLGIYHVDEAALRLELS
D3V9T6_XENNA          RLAYLEPKLIKGISVVGPIVHELLHDEKRQQKIPSMYIDVLASRLGIYHIDENRLRSELG
FRSA_PHOLL            RLAYLESKRIKGVATLGAIVHEWLSSVERQQNSPSMYLDMFASRLGIYNVDEKAFRLELG
K8WPM7_9GAMM          RLAYMCPDRIKGVAVLGPIVHGVLHEEKYQQDIPKMEIDIFASRLGIYYVDGAALRHELS
J7U4M7_MORMO          RMAYLSAHQLRGAVLFGPVVHDLFVSPERQDKIPGMYMDVLASRAAARCTDLDTVRTRLG
A0A242P7W7_9GAMM      RLAYLMPNKIKGLFNFTPFIHQLFVDKALQQNLPNSYKDMLASRLGLTSVSNQQLAAELN
C4LBK2_TOLAT          RLSYLEQLRLKAVVCIGPGMHNYFTDPTQFALSPPMMRACLANRLNMDAADWDGLQKSCQ
A0KNR1_AERHH          RLAFIEPFKLRTVVCIGAGVNQVFTNQEMFARCPRMMRDGLANRLGADAAQWESLRTKCQ
H2G0Q1_OCESG          RLASLEPFRLRAAVSIAGAANLFFSERDRFMRAPAMLRDSIANRLGMKSNDWEGVFQHCR
R9PMH2_AGAAL          RLAFVAAERLRAVVTIGAPVDRLFSDIQRFNNLPQMYQDCLANRSGVNASNTEGLYYRCM
A1SYU2_PSYIN          RLAFLEPNCVKSVVCVGAAVGSIFDNLDNFKKLPPMLLDCIASRMQINNSSVEMLYKFCV
M4U9X7_9GAMM          RLAFLEPKSIKSVVSVGATVSSIFDDKDKFKALPPVLLDCFASRLQVNNSDVAQLYPLCM
A0A366WDV2_9GAMM      RLAYVEPHRAKAVVSVGAAVASVFDDINRFKQLPVMTLDCLASRMQLQKSDASYLYQHCV
                      *:. :     :    .       : .       .      :..*          .     

Q1ZPM9_PHOAS          AWSLKHQGILGR-RRIDMPMLGISLKNDPVCPESDNQLIALSSYGGKAITLPEKPIHDGY
D0I7J9_GRIHO          ALSLKNQGLLAG-RKTKVPILAMSLEGDPVCPESDNQLAALYSQGGKAKTLPNKPLHDGY
F0LUG8_VIBFN          AWSLKMQGFLSS-RRTKVPILAMGLEGDPVSPYSDNQLVALFSQGGKAKQIKSKTITQGY
FRSA_VIBC3            AWSLKVQGFMSG-RRTKTPILALGLEGDPVSPYSDNQLVALFSQGGQAKKVKSKTISQGY
FRSA_VIBVU            AWSLKVQGFLSS-RKTKVPILAMSLEGDPVSPYSDNQMVAFFSTYGKAKKISSKTITQGY
C9P2Z6_VIBME          AWSLKVQGFLAT-RRTKVPILALAMEGDPVSPASDNHLIATFSQGGQSKQIKSESLTRGY
U4K2F5_9VIBR          AWSLKAQGFLSS-RRTQVPILAIGLEGDPVSPYSDNKLVSFFSQGGKAKKVSSKSISQGY
Q5E6W2_ALIF1          AWSLKNQGFLSGGRKTSVSVLAIGLKDDPVSPKSDNKLAALFSKYGKGVELNSKTLHSGY
FRSA_SALTY            RYSLKVQGLLGR--RCPTPMLSGFWKNDPFSPEEESRLITTSSSDGKLIEIPFNPVYRNF
FRSA_SALTI            RYSLKVQGLLGR--RCPTPMLSGFWKNDPFSPEEESRLITTSSSDGKLIEIPFNPVYRNF
FRSA_ECOLI            RYSLKVQGLLGR--RCPTPMLSGYWKNDPFSPEEDSRLITSSSADGKLLEIPFNPVYRNF
V5AFM0_ENTCL          RYSLKTQGLLGR--RCPTPMLSGFWQNDPFSPEAESRLITSSSSNGKLLDIPFNPVYRNF
W1EQ05_KLEPN          RYSLKTQGLLGR--RCPTPMLSGFWKDDPFSPEEESRLITSSSADGKLLEIPFNPVYRNF
FRSA_PECAS            RYSLKTQGLLGR--RCPTPMLAGYWENDLLCPKEEASLIVNSSAQGKLMPVNFSPVYQNF
D4GL10_PANAM          SYSLKNQGLLGR--RTATPMLSAYWTNDFFSPEEESKLIANSSSQGKALLIPVKPVIASF
D3V437_XENBS          CYSLKNQGLLGR--RCSVPMLSVYWKDDVFSPREDSKLIAMSSMDGSLLAIPSTPVYSGF
D3V9T6_XENNA          YYSLKNQGLLGR--RCSVPMLSVYWEDDIFSPRKDSKLIAMSSIDGSLKAIPATSIYGGF
FRSA_PHOLL            CYSLKKQGLLGR--RCSVPMLAGYWQNDIFSPKEESKLIAMSSMDSQLLAIPTTPVYNSF
K8WPM7_9GAMM          CYSLKNQGLLGR--RTNVPMMSVYWKKDIYSPKSESDLIRRSSIDGDVLELPATPVYKNL
J7U4M7_MORMO          CLSLKNQGLLGR--RCSLPVLSMCWKEDVFSPKSESELIVRSSADGKLVEFGHTPVFDTF
A0A242P7W7_9GAMM      YFSLKNQGLLTH--SCPVPVMNIIFEDDKLSNLSEAKLIQSAK-QSKIVTIPKTPLQKGL
C4LBK2_TOLAT          VFSLKRQGLAGV-SKTRVPILSIGHRRDFICPESDIRMLASSSLNGKAVVLDKEPVKEQM
A0KNR1_AERHH          VFSLKTQGLLG--TRTSVPILSIGHKKDFICPEQDVRALASASRNGKAVVFDKQPLLEVY
H2G0Q1_OCESG          GLSLKTQGLLA--RKTPVPLLSIGHRHDFLCPEPEIQALAAASRSGEALVLDRLPLLQVY
R9PMH2_AGAAL          PLSLKTQGILGG-PRTKLPMFVVGRKNDAICPETDVSLLSMASPNCKVEVLKELDSLQNY
A1SYU2_PSYIN          PLSLIKQGLLAR-TRIKTPLLSIGHKDDLICNEQDLKLIARASREGESHIIDKPPIFESY
M4U9X7_9GAMM          PFSLVKQGLLAR-KRIETPFLSIGHKHDMLCDEKDLIAIARASWEGESQIHDKPPIFTSY
A0A366WDV2_9GAMM      PFSLIKQGLLGR-KKVKTPCLSIGHSDDLMCSEQDLKLMARISYESEAKIIDKSPIFDSY
                        **  **:         . :      *  .   :       .   .             

Q1ZPM9_PHOAS          HRSLTAVVEWLNEQLG-
D0I7J9_GRIHO          HRIMLEAVKWFKETL--
F0LUG8_VIBFN          EQSLDLAINWLEDELNR
FRSA_VIBC3            EQSLDLAINWLEDELCK
FRSA_VIBVU            EQSLDLAIKWLEDELLR
C9P2Z6_VIBME          EQSLDLAIKWLEEQLCE
U4K2F5_9VIBR          EEALSLAMQWLKDELK-
Q5E6W2_ALIF1          EEALKQMIEWIKEEMKQ
FRSA_SALTY            DRALQEITDWINHRLC-
FRSA_SALTI            DHALQEITDWINHRLC-
FRSA_ECOLI            DKGLQEITDWIEKRLC-
V5AFM0_ENTCL          DAALRKIVDWINHQFG-
W1EQ05_KLEPN          -----------------
FRSA_PECAS            DRALQQISRWLQDKVC-
D4GL10_PANAM          DKALNEISDWLAQRLQR
D3V437_XENBS          NKALHETSVWLKGKAT-
D3V9T6_XENNA          NKALHEISVWLKDKVL-
FRSA_PHOLL            NKALREISQWLRNKVC-
K8WPM7_9GAMM          LKGLNEVTLWLKSKIL-
J7U4M7_MORMO          HKSLDEATRWLTRILS-
A0A242P7W7_9GAMM      QNAFTQSVKWMESIL--
C4LBK2_TOLAT          NRMLSEIGEWLRLHFNL
A0KNR1_AERHH          DEALKEMVDWLKKHLCT
H2G0Q1_OCESG          EAALARTRDWLLHHL--
R9PMH2_AGAAL          NQIFTKVTHWLQKQL--
A1SYU2_PSYIN          LKSLSYSAEWLTIHLAE
M4U9X7_9GAMM          LHSLRYSAQWLTRHLLE
A0A366WDV2_9GAMM      LITLQYSAQWLAKHLQE