CLUSTAL format seed alignment for MF_01065

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YNFC_SALTY            -------------MKKPLLLTLLCMILAGCDNPKSLESFTPEMASFSNEFDFDPLRGPVK
A8AGU8_CITK8          -MIENHLLILVNNVKKQTLVSFLCVLLVGCDNATVLVSFTPEMASFSNEFDFDPLRGPVK
YNFC_ECOLI            -------------MKYKLLPCLLAIFLTGCDRTEVTLSFTPEMASFSNEFDFDPLRGPVK
A4WA74_ENT38          -------------MKKLAVMIALASVLAGCDNASAPLSFTPEMASFSNEFDFDPLRGPVK
A0A482MEZ8_9CAUD      -------------MKRLYWLIPAALLLTACDRKSAPDAFTPEMASFSNEFEFDPLRGPVK
A6T8U2_KLEP7          ----------------MYWLIPAALLLTACDRKSAPDAFTPEMASFSNEFEFDPLRGPVK
W1DU42_KLEPN          -------------MKRLYWLIPAALLLTACDRKSAPDAFTPEMASFSNEFEFDPLRGPVK
V5AXI5_ENTCL          -------------MKKQLLLISLTLILAGCDEEKGPVAFTPEMASFSNEFDFDPLRGAVK
H5V295_ATLHE          -------------MKPQIFIIALTAALSGCDDPQGPIAYTPEMASFSNEFDFDPLRGPVK
A7MLD4_CROS8          MPLLARPQKDNKDVKNYVTVMMVTLVLTGCDKPDALAPFSPEMASFSSEFNFDPLRGPVK
C6CDD8_DICP7          ------------MNKRTIALTAAMLAVAGCDDKQRLEPVSPMMAGFSNIFGFDALRGKIK
E0SMK7_DICD3          ------------MKLRATLLAGSVL-LAGCDLKPAAEPVNPVLAGLSNVFGFDALRGKVK
I2B6H6_SHIBC          ------MRATPDILRGIITGLLALSVALPAAAVLKPEPFSPVMASFSNELEFDALRGKVK
A0A3E2BHN8_PRORE      ----------MSKKYPLGIVFLSLFPISFVSLAFQEQQYNPVVFNLAQLYDFNPVRGAVK
                                                             .* : .::.   *:.:** :*

YNFC_SALTY            DFSQTLMSENGEVAKQVTGTLSQEGCFDTLELHD-----LENNTGLALVLD--ANYYRDA
A8AGU8_CITK8          DFSQTLMNDKGEVTKRISGTLSQEGCFDTLELHD-----LENNTGLALVLD--ANYYRDA
YNFC_ECOLI            DFTQTLMDEQGEVTKRVSGTLSEEGCFDSLELLD-----LENNTVVALVLD--ANYYRDA
A4WA74_ENT38          DFTQTLFNEKGEVSKRVTGTLSAEGCFDKLELHD-----LDANTGVALVLD--ANFYLDA
A0A482MEZ8_9CAUD      DFSQTLLDEHDVVVKKVSAQLSREGCFDLLTLED-----VENKTGATLLLD--ANYYVDG
A6T8U2_KLEP7          DFSQTLLDEHDVVVKKVSAQLSREGCFDLLTLED-----VENKTGATLLLD--ANYYVDG
W1DU42_KLEPN          DFSQTLLDEHDVVVKKVSAQLSREGCFDLLTLED-----VENKTGATLLLD--ANYYVDG
V5AXI5_ENTCL          NFSQTLLNEKGEVTKRVSGTLSKEGCFDTLELHD-----LENNSGVSLVLD--ANYYIEA
H5V295_ATLHE          DFSQTLLNDHGEVTRRVSGTMSKEGCFDTLEFHD-----LDANTGAALVLD--ANYYLEA
A7MLD4_CROS8          NFTQKLINDSGEVETEVNGTLSQEGCFETLNYSD-----KPSNSHLALVLD--ANYYLDA
C6CDD8_DICP7          RFTQTQTDEQGKVVAYVAVTLNQNGCVDTLKSYQ-----PTMNLDLDLVRE--GQLLVDR
E0SMK7_DICD3          RFTQTQIDDAGKVTAYVEGEFDAEGCLAALRTYQ-----PSMNLDLDLVRN--GQMLVEQ
I2B6H6_SHIBC          SFEQALYDSGDTPVMLARGEFDTRGCLMRYEKID-----GVNNGKIKLTRNVADNTLISA
A0A3E2BHN8_PRORE      QIKSVVYNEDKSINYESMLKIGHDGCVESFTFDQKKDEYLNGAHNYLFVKRVKNKLIGRD
                       : .   ..           :.  **.      :             :      :     

YNFC_SALTY            QTLEKKVQLQGKCQLAALPSAG---VTWETDDNGFVVSATGKE---MKVEYRYDSEGYPL
A8AGU8_CITK8          ETMEKRVRLQGKCQLAELPSAG---VVWDTDDNGFVVSATGRE---TKVQYRYDAEGYPL
YNFC_ECOLI            ETLEKRVRLQGKCQLAELPSAG---VSWETDDNGFVIKASSKQ---MQMEYRYDDQGYPL
A4WA74_ENT38          ETQQQKIKLQGKCQLAELPSAG---VTWDTDDKGFIVSAHGKE---MEVNYRYDADGYPL
A0A482MEZ8_9CAUD      RTHEKRLRLQGKCQLAEMPAAG---VSWETDDNGFIISARGKE---TTATYRYDSDGYPL
A6T8U2_KLEP7          RTHEKRLRLQGKCQLAEMPAAG---VSWETDDNGFIISARGKE---TTATYRYDSDGYPL
W1DU42_KLEPN          RTHEKRLRLQGKCQLAEMPAAG---VSWETDDNGFIINARGKE---TTATYRYDSDGYPL
V5AXI5_ENTCL          ETQEKRLRLQGKCQLAEFPSAG---VTWDTDDNGFVVRASGKD---MEVKYRYDDEGYPL
H5V295_ATLHE          GSQEKRVKLQGKCQLAELPAIG---LQYETDDNGFVVAARGKE---ASVEYRYDEEGYPL
A7MLD4_CROS8          ISREKRIRLQGKCQLAELPAVG---MVYETNDREFVVKGHTPE---VSTTYRYDDEGYPL
C6CDD8_DICP7          NDRKPAFQLGKDCLLEKSVDGR---LIYRHDDKGFITDVFYNGHTTPFATYQYDDDGFPS
E0SMK7_DICD3          SDRQALFQLTDHCQLANTNDGR---LSYRSNDKYAIAEVVYRDKPTPLASYRYDDDGFPV
I2B6H6_SHIBC          YDKQRVIHLNDRCEVVSTDAKGDDAKDYIYDARGFLVKVKGHKDAWVYKEYFYTPEGMPK
A0A3E2BHN8_PRORE      VSGPVEMVIGDNCQIISKKDSNGE-LIYQYNKDGIIAGSLLADTKKQYSKNDYNEFKLPT
                            . :   * :            :  :    :                *     * 

YNFC_SALTY            GKTTINSQ--NTLSVTAKPSADPRKKLDYTAVSRVDDRQVGNVTQSCEYDAYANPVDCRL
A8AGU8_CITK8          GKTTISKD--KTLSIDAKPSADPLKKLDYTAVSLLNDRPLGNVKQTCEYDNYANPINCQL
YNFC_ECOLI            GKTTKSND--KTLSVSATPSTDPIKKLDYTAVTLLNNQRVGNVKQSCEYDSHANPVDCQL
A4WA74_ENT38          GKTTKAGG--QQLSVAATPSKDKRKKLDYSAVSLLNEKQLGTVQQRCEYDGYDNPVSCDL
A0A482MEZ8_9CAUD      GKTTTAKE--ERFTVASTPSKDPRKKLDYTAISTFNDRTLGTVRQTCDYDDHDNPLSCEL
A6T8U2_KLEP7          GKTTTAKE--ERFTVASTPSKDPRKKLDYTAISTFNDRTLGTVRQTCDYDDHDNPLSCEL
W1DU42_KLEPN          GKTTTAKE--ERFTVASTPSKDPRKKLDYTAISTFNDRTLGTVRQTCDYDDHDNPLSCEL
V5AXI5_ENTCL          GKSTTSKD--VHLDVASTPAKDKRKKLDYAAVSTLNDKPLSKVQQTCDYDKHDNPLSCSL
H5V295_ATLHE          GKKTQAKA--STLDVKATTTGDKRKKLNYQSVSLLDNKAISHATQVCKYDDYFNPVSCTL
A7MLD4_CROS8          GKTSKTKD--AELSTVATPS-DTRKKHDYTSVTTLNSKVIDTAKQSCEYDRHLNPSSCVL
C6CDD8_DICP7          DMTFTSPESGKVTLVSLRNDAAPGKRLDSTMSVTENGEQTSITRTTCRYDVRFNPVVCRV
E0SMK7_DICD3          SMTFVSPENGKVTKVEMRNDAPAQKRLDATVVVTENDEQVSVTRTSCQYDQHFNPRLCQV
I2B6H6_SHIBC          SVVYYGDE--KDFLIITEPKKKLSEQWDFITEGLDDGKPVFQSVKKCLYDDRYNPTVCYL
A0A3E2BHN8_PRORE      TIKYFKDN-ALISETIVTYGKDMSKPFDHTMDIRALGQTILLVNSKCDYNTKNIAYKCNF
                                              :  :         .        * *:    .  * .

YNFC_SALTY            VIVDESVKPAVSHHYTIKNRIDYY--------
A8AGU8_CITK8          VIVDESVEPAVARSYTIKNTIDYYPAASDTAG
YNFC_ECOLI            IIVDEGVKPAVERVYTIKNTIDYY--------
A4WA74_ENT38          SIKDESVKPAVERKFTIKNSIDYY--------
A0A482MEZ8_9CAUD      QVIDESVQPPLTRHYTIKNRIDYY--------
A6T8U2_KLEP7          QVIDESVQPPLTRHYTIKNRIDYY--------
W1DU42_KLEPN          QVVDESVQPPLTRHYTIKNRIDYY--------
V5AXI5_ENTCL          EIVDESVTPQVTHKYSIKNTIEYY--------
H5V295_ATLHE          DVTDESATPPTVHHFTIKNTIEYY--------
A7MLD4_CROS8          EITDASATPPVLHKFTIQNEINYY--------
C6CDD8_DICP7          LMTNGKGAGQTLSTLTNTTKVEYR--------
E0SMK7_DICD3          LVSNGKGAAQTVTTLTHTTKIEYY--------
I2B6H6_SHIBC          ITAVVENGVQKKRVEQIHYIVKYY--------
A0A3E2BHN8_PRORE      TLNLNSNGNNIKLLKNSITEVDFY--------
                                          :.: