CLUSTAL format seed alignment for MF_01068

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

OPGD_XANAC       --MQRRHFLKNAAAALAALGLPTLPQWALAA-KAVGLRRLGQPQP--FDYAWLKGQAREL
OPGD_XANCP       --MQRRHFLKNAAAALAALGLPALPPWALAA-KAVGLRRLGQPQP--FDYAWLKGQARAL
OPGD_XYLFA       MLMYRRDFLKSVTAAWVAFGLPNPLGGPFATNRVIALRRLGQSQR--FDYEWLKEHARAL
OPGD_XYLFT       MLMYRRDFLKSVTAAWVAFGLPNPLGGAFATNRVIPLRRLGQSQR--FDYEWLKERARAL
OPGD_SHEON       --MPSLEAPSTRSRLQRMVGSVLLTCSVLLSLSACAAGKASAPQEEEFSYAWLKGYAHTL
OPGD1_RALSO      --MHRRDLLKQLAAGFLALAPGLTPSTASAVSPASAATEP-------FDEAWLRRRARAL
OPGD_ECOLI       --MDRRRFIKGSMAMAAVCGTSG-IASLFSQAAFAADSDIADGQTQRFDFSILQSMAHDL
OPGD_ECO57       --MDRRRFIKGSMAMAAVCGTSG-IASLFSQAAFAADSDIADGQTQRFDFSILQSMAHDL
OPGD_SHIFL       --MDRRRFIKGSMAMAAVCGTSG-IASLFSQAAFAADSDIADGQTQRFDFSILQSMAHDL
OPGD_ECOL6       --MDRRRFIKGSMAMAAVCGTSG-IASLFSQAAFAADSDIADGQTQRFDFSILQSMAHDL
OPGD_SALTI       --MNRRRFIKGSMAMAAVCGSSG-IASLFSQAAFAAESDIADGKIVRFDFAGLQSMAQAL
OPGD_SALTY       --MNRRRFIKGSMAMAAVCGSSG-IASLFSQAAFAAESDIADGKIVRFDFAGLQSMAQAL
OPGD_PSESM       --MNRRNLLKASMALAA-YGSVS-ASGLYAARALAAA---ADGEIEHFDFAELQAHAKKL
OPGD2_RALSO      --MVTRRHLLASASLSATLAALG------ITPEALAASRVKLGNAAPFNFDALIERARAM
                   *                .                           *.   *   *: :

OPGD_XANAC       ANAPYKSHKQLLPGPLEALNWDQYQSIRYRQDHALWADG-NGKFQAKFFHLGLYFHTPVH
OPGD_XANCP       AKAPYKSHKQVLPGPLESLNWDQYQSIRYRQDHALWADG-NGKFQAKFFHLGLYFHTPVH
OPGD_XYLFA       AAAPYHSRKRVLPTPLERLSWDQYQSIRYRQDHALWADS-DAHFQVKFFHLGLYFHSPVR
OPGD_XYLFT       AATPYHSRKRVLPTPLERLSWDQYQSIRYRQDHALWADS-DAHFQVKFFHLGLYFHSPVR
OPGD_SHEON       ATESYVSHKGELPKSLQGMSWDDYQQFHFKKKAALWRED-DSEFRAELFHLGLYFDTPVH
OPGD1_RALSO      AAGPYRKRNTALPPPLAALGWDAYQSIGARADHALWAGQ-SLPFDARFFHLGLFFKSPVR
OPGD_ECOLI       AQTAWRGAPRPLPDTLATMTPQAYNSIQYDAEKSLWHNVENRQLDAQFFHMGMGFRRRVR
OPGD_ECO57       AQTAWRGAPRPLPDTLATMTPQAYNSIQYDAEKSLWHNVENRQLDAQFFHMGMGFRRRVR
OPGD_SHIFL       AQTAWRGAPRPLPDTLATMTPQAYNSIQYDAEKSLWHNVENRQLDAQFFHMGMGFRRRVR
OPGD_ECOL6       AQTAWRGAPRPLPDTLATMTPQAYNSIQYDAEKSLWHNVENRQLDAQFFHMGMGFRRRVR
OPGD_SALTI       AKKPWGGAPGPLPDTLANLTPQAYNSIQYDAAHSLWNGVANRQLDIQFFHVGMGFRRRVR
OPGD_SALTY       AKKPWGGAPGPLPDTLANLTPQAYNSIQYDAAHSLWNGVANRQLDIQFFHVGMGFRRRVR
OPGD_PSESM       AGKGYVSNKQVLPPVLANMTPLQFNAIRYDPNHSLWKDV-NGQLDVHFFHVGMGFKTPVR
OPGD2_RALSO      AGQPYTPPATAPADILAKIDYEAHGKIKFDTAHALFADG-PGQFPVTFFHLGTFFRAPVR
                 *   :       .  *  :    .  :      :*:       :   :**:*  *   *:

OPGD_XANAC       IYDIV--DGKAQQLAYDPAAFDYGRSGLGGKQLPK--DLGFAGFRLN-------TRKDTD
OPGD_XANCP       IYDIV--DGKAQQLAYDPAAFDYGRSGLGGKQLPK--DLGFAGFRLN-------TRKDTD
OPGD_XYLFA       MYEVV--DGMAQELAYDPAAFDYGSSGLNGKRLPK--DLGFAGFRLN-------TRKDTD
OPGD_XYLFT       MYEVV--DGMAQELAYDPAAFDYGSSGLNGKGLPK--DLGFAGFRLN-------TRKDID
OPGD_SHEON       IYQLE--NGKAKRIEYSPSMFDYGKSKVKGSQLPK--DLGFAGFRMQ-------FNTDWQ
OPGD1_RALSO      MHEVA--GGQSRVIAYDPAMFDYGKSGLDHAALPA--DLGFAGFRLT-------TRADPT
OPGD_ECOLI       MFSVDPATHLAREIHFRPELFKYNDAGVDTKQLEGQSDLGFAGFRVF-------KAPELA
OPGD_ECO57       MFSVDPATHLAREIHFRPELFKYNDAGVDTKQLEGQSDLGFAGFRVF-------KAPELA
OPGD_SHIFL       MFSVDPATHLAREIHFRPELFKYNDAGVDTKQLEGQSDLGFAGFRVF-------KAPELA
OPGD_ECOL6       MFSVDPATHLAREIHFRPELFKYNDAGVDTKQLEGQSDLGFAGFRVF-------KAPELA
OPGD_SALTI       MFSVDTTTHLAREIHFRPELFKYNDAGVDTTQLEGQSDLGFAGFRVF-------KAPELA
OPGD_SALTY       MFSVDTTTHLAREIHFRPELFKYNDAGVDTTQLEGQSDLGFAGFRVF-------KAPELA
OPGD_PSESM       MYSVDPQNKQAREVHFRHDLFNYESSGIDKNLVKG--DLGFAGFKLF-------KAPEIA
OPGD2_RALSO      MHVVD--KGEAREIVYDESYFDM-PADSPARKLPR--NSGFAGFRFQESRLGDQKKLDWK
                 :. :      :: : :    *.   :      :    : *****:.           :  

OPGD_XANAC       -RDFSAFLGASYFRAVGKEGQYGQSARGLAIDTG-TGGPEEFPDFIAYYLEQPA-DDSDT
OPGD_XANCP       -RDFSAFLGASYFRAVGKEGQYGQSARGLAIDTG-TGGPEEFPDFIAYYLEQPA-DDSDT
OPGD_XYLFA       -RDFAAFLGASYFRAVGQEGQYGQSARGLAVNTG-SSGPEEFPDFIAYYLEQPT-SDADT
OPGD_XYLFT       -RDFAAFLGASYFRAVGQEGQYGQSARGLAVNTG-SSGPEEFPDFIAYYLEQPT-ADADT
OPGD_SHEON       -RDVVAFLGASYFRAVGQEMQYGLSARGLAVDTA-LPKPEEFPMFTRFWLEKPQ-PGSNI
OPGD1_RALSO      -RDVAAFLGASYFRAVGGQWQYGMSARGLAIDTG-LRRAEEFPDFTEFWLVRPA-PEADT
OPGD_ECOLI       RRDVVSFLGASYFRAVDDTYQYGLSARGLAIDTY-TDSKEEFPDFTAFWFDTVK-PGATT
OPGD_ECO57       RRDVVSFLGASYFRAVDDTYQYGLSARGLAIDTY-TDSKEEFPDFTAFWFDTVK-PGATT
OPGD_SHIFL       RRDVVSFLGASYFRAVDDTYQYGLSARGLAIDTY-TDSKEEFPDFTAFWFDTVK-PGATT
OPGD_ECOL6       RRDVVSFLGASYFRAVDDTYQYGLSARGLAIDTY-TDSKEEFPDFTAFWFDTVK-PGATT
OPGD_SALTI       RRDVVSFLGASYFRAVDDTYQYGLSARGLAIDTY-TDGQEEFPDFTAFWFDTAK-PGDTT
OPGD_SALTY       RRDVVSFLGASYFRAVDDTYQYGLSARGLAIDTY-TDGQEEFPDFTAFWFDTAK-PGDTT
OPGD_PSESM       INDVVSFLGASYFRAVDSNKQYGLSARGLAIDSY-AKRQEEFPDFTKFWFETPD-KNATR
OPGD2_RALSO      KNDWVAFLGASYFRAIGELYQYGLSARGIALDVAQAGRAEEFPNFTHVWFDTPSNEHADS
                  .*  :*********:.   *** ****:*::       **** *   ::          

OPGD_XANAC       VVVYGLLDSPSVAGAYRFAITN-GDVLLMDIDSALYPRKAIERLGIGPCTSMYQVGEND-
OPGD_XANCP       VVVYGLLDSPSVSGAYRFAITN-GEVLVMDIDSALYPRKAIERLGIGPCTSMYQTGEND-
OPGD_XYLFA       VVLYGLLDSPSIAGAYRFSITN-GDVLLMDIDSALYPRETIERLGIAPCTSMYQVGEND-
OPGD_XYLFT       VVMYGLLDSPSIAGAYRFSITH-ADVLRMDIDSALYPRETIERLGIAPCTSMYQVGEND-
OPGD_SHEON       ATVYALLDSPSVTGAYRFDIEP-GERLKMKVDAAIYPRKAIERLGVAPLTSMFMVGEND-
OPGD1_RALSO      LRVYALLDAPSVAGAYRFDIRP-GDTLVMDVQATLFVRKPIERLGIAPLTSMFLYGENDR
OPGD_ECOLI       FTVYALLDSASITGAYKFTIHCEKSQVIMDVENHLYARKDIKQLGIAPMTSMFSCGTNE-
OPGD_ECO57       FTVYALLDSASITGAYKFTIHCEKSQVIMDVENHLYARKDIKQLGIAPMTSMFSCGTNE-
OPGD_SHIFL       FTVYALLDSASITGAYKFTIHCEKSQVIMDVENHLYARKDIKQLGISPMTSMFSCGTNE-
OPGD_ECOL6       FTVYALLDSASITGAYKFTIHCEKNQVIMDVENHLYARKDIKQLGIAPMTSMFSCGTNE-
OPGD_SALTI       FTVYALLDSASVTGAYKFVIHCEKTQVIMDVENHLYARKDIKQLGIAPMTSMFSCGNNE-
OPGD_SALTY       FTVYALLDSASVTGAYKFVIHCEKSQVIMDVENHLYARKDIKQLGIAPMTSMFSCGNNE-
OPGD_PSESM       FVVYALLDSPSATGAYRFDIDCQAGQVVMEIDAHINARTDIQQLGISPMTSMFSCGTHE-
OPGD2_RALSO      VTIYALLDGPGITGAYRFVMHR-GKGVVMEIDTALFLRRDIDRFGIAPASSMYWFSETA-
                   :*.***... :***:* :      : *.::  :  *  *.::*:.* :**:  .    

OPGD_XANAC       ------------NRMDWDWRPEIHDTDGLAMWTGGGEWIWRPLCNPPHLRFNMFVDENPR
OPGD_XANCP       ------------RRMDWDWRPEIHDTDGLAMWTGGGEWIWRPLCNPPHLRFNMFVDENPR
OPGD_XYLFA       ------------RRMGWDWRPEIHDTDGLFLLTGNGEWIWRPLCNPPYLRFNMFLDNNPR
OPGD_XYLFT       ------------RRMGWDWRPEIHDTDGLFLWTGNGEWIWRPLCNPLHLRFNMFLDNNPR
OPGD_SHEON       ------------RRTGYDWRQEIHDSDGLAMHTGNGEWIWRPLGNPSNLRFNAYSDENPK
OPGD1_RALSO      TDRAGDRQSAARRWRASDWRPEIHDSDGLAIWRGSGEWIWRPLANPPALRSQRFADDGPR
OPGD_ECOLI       ------------RRMCDTIHPQIHDSDRLSMWRGNGEWICRPLNNPQKLQFNAYTDNNPK
OPGD_ECO57       ------------RRMCDTIHPQIHDSDRLSMWRGNGEWICRPLNNPQKLQFNAYTDNNPK
OPGD_SHIFL       ------------RRMCDTIHPQIHDSDRLSMWRGNGEWICRPLNNPQKLQFNAYTDNNPK
OPGD_ECOL6       ------------RRMCDTIHPQIHDSDRLSMWRGNGEWICRPLNNPQKLQFNAYTDNNPK
OPGD_SALTI       ------------RRVCDTIHPQIHDSDRLAMWRGNGEWICRPLNNPQKLQFNAYMDDNPK
OPGD_SALTY       ------------RRVCDTIHPQIHDSDRLAMWRGNGEWICRPLNNPQKLQFNAYMDDNPK
OPGD_PSESM       ------------RRMCDTIHPQIHDSDRLSMWRGNGEWICRPLNNPAKPQFSAFADKDPK
OPGD2_RALSO      ------------KGTATDWRPEVHDSDGLAMWTGSGERIWRPLNDPPRVMTSAFSDNNPR
                             .      : ::**:* * :  *.** * *** :*     . : *..*:

OPGD_XANAC       GFGLLQRDRNFDHYQDDGVFYEKRPCLWVEPKSGWGKGSVQLVEIPTVDETFDNIVAFWN
OPGD_XANCP       GFGLLQRDRNFDHYQDDGVFYEKRPCLWVEPKSGWGKGSVQLVEIPTVDETFDNIVAFWN
OPGD_XYLFA       GFGLLQRDRDFDHYQDDGVFYEKRPCLWVEPKHGWGEGSVQLVEIPTFDETFDNIVSFWN
OPGD_XYLFT       GFGLLQRDRDFDHYQDDGVFYEKRPCLWVEPKHGWGEGSVQLVEIPTFDETFDNIVAFWN
OPGD_SHEON       GFGLLQRDRNFDHYQDDGVFYEKRPSLWIEPTGNWGKGSVQLVEIPTLDETFDNIVAFWN
OPGD1_RALSO      GFGLLQRDRNPDHYQDDGVFYEKRPSVWVEPAHGWGEGAVELVELSAADETFDNIVAFWR
OPGD_ECOLI       GFGLLQLDRDFSHYQDIMGWYNKRPSLWVEPRNKWGKGTIGLMEIPTTGETLDNIVCFWQ
OPGD_ECO57       GFGLLQLDRDFSHYQDIMGWYNKRPSLWVEPRNKWGKGTIGLMEIPTTGETLDNIVCFWQ
OPGD_SHIFL       GFGLLQLDRDFSHYQDIMGWYNKRPSLWVEPRNKWGKGTIGLMEIPTTGETLDNIVCFWQ
OPGD_ECOL6       GFGLLQLDRDFSHYQDIMGWYNKRPSLWVEPRNKWGKGTIGLMEIPTTGETLDNIVCFWQ
OPGD_SALTI       GFGLLQLDRDFSHYQDVMGWYNKRPSLWVEPRSKWGKGAVSLMEIPTTGETLDNVVCFWQ
OPGD_SALTY       GFGLLQLDRDFSHYQDVMGWYNKRPSLWVEPRNKWGKGAVSLMEIPTTGETLDNVVCFWQ
OPGD_PSESM       GFGLVQSDHEFSSYQDTVVWYSRRPSLWVEPITAWGEGEVSLLELPTTGETMDNIVVFWT
OPGD2_RALSO      GFGLLQRDRDFNNYMD-GVHYERRPSLWVEPLEGWGEGAVQLVEIPTDDEIHDNIVAMWV
                 ****:* *:: . * *    *.:**.:*:**   **:* : *:*:.: .*  **:* :* 

OPGD_XANAC       PQAKPQPGQELLMGYRLYWGAQPPASSPLAHCVATRTGLGGIVG------QKRSHFSWRF
OPGD_XANCP       PQAKPQPGQELLMGYRLYWGAHPPASSPLAHCVATRTGLGGIVG------QKRSHFSWRF
OPGD_XYLFA       PRNKPHPGQELLFGYRLYWGGLPPVSSSLAYCVATRTGLGGVVG------QKRKYFSWRF
OPGD_XYLFT       PRNKPHPGQELLFGYRLYWGAFPPVSSSLAYCVATRTGLGGVVG------QKRKYFSWRF
OPGD_SHEON       PAEPIQPGQELLYSYNMYWGGIPPEQSPRARVVDTFTGIGGVVG------QKRKYYSKRF
OPGD1_RALSO      PAVAPQAGQELAFGYRLSWGAQPPVAPPLARVVATRTGIGGIVG------QPRRHFSWRF
OPGD_ECOLI       PEKAVKAGDEFAFQYRLYWSAQPPVHCPLARVMATRTGMGGFSEGWAPGEHYPEKWARRF
OPGD_ECO57       PEKAVKAGDEFAFQYRLYWSAQPPVHCPLARVMATRTGMGGFPEGWAPGEHYPEKWARRF
OPGD_SHIFL       PEKAVKAGDEFAFQYRLYWSAQPPVHCPLARVMATRTGMGGFPEGWAPGEHYPEKWARRF
OPGD_ECOL6       PEKAVKAGDEFAFQYRLYWSAQPPVHCPLARVMATRTGMGGFPEGWAPGEHYPEKWARRF
OPGD_SALTI       PEKAIKAGDTLAFNYRLYWSAQPPVQSPLARVMATRTGMGGFPEGWAPGEHYPDKWARRF
OPGD_SALTY       PEKAIKAGDTLAFNYRLYWSAQPPVQSPLARVMATRTGMGGFPEGWAPGEHYPDKWARRF
OPGD_PSESM       PKTPVKAGDSLNYGYKLFWSPLPPVSTPLAQVHATRSGMGGFLEGWAPGEHYPKTWARRF
OPGD2_RALSO      PKAPARAGSHYRLRYRLHWLADEPYPTPLARCVATRLGNGGQPG------QPRPRGVRKF
                 *    :.*.     *.: *    *   . *    *  * **         :       :*

OPGD_XANAC       AVDFAGGELAALAKDPKAKVEAVLQVSRGTTE--IVSARPLHELKGYRAMFDLVPPDEGT
OPGD_XANCP       AVDFAGGELAALAKDPKAKVEAVLQVSRGTTE--IVSARPLHELKGYRAMFDLVPPDEGT
OPGD_XYLFA       AVDFVGGKLAALASVHDVSVEPVLHMTRGRAE--IVSARPLHEIRGYRVMFDVVPLEDST
OPGD_XYLFT       AVDFVGGKLAALARVHDVSVEPVLHMTRGRPE--IVSARPLHEIRGYRVMFDVVPLEDSA
OPGD_SHEON       VIDFAGGSLPMLGK--DAQVKAVISTSQGRVE--IESARPQHAINGYRAMFDIVPPEDSV
OPGD1_RALSO      VIDFAGGELGQPGR---AAVEPVIRVSRGRVE--IVSARPLANIDGVRAMFDLVP-DAGN
OPGD_ECOLI       AVDFVGGDL---KAAAPKGIEPVITLSSGEAK--QIEILYIEPIDGYRIQFDWYPTSDST
OPGD_ECO57       AVDFVGGDL---KAAAPKGIEPVITLSSGEAK--QIEILYIEPIDGYRIQFDWYPTSDST
OPGD_SHIFL       AVDFVGGDL---KAAAPKGIEPVITLSSGEAK--QIEILYIEPIDGYRIQFDWYPTSDST
OPGD_ECOL6       AVDFVGGDL---KAAAPKGIEPVITLSSGEAK--QIEILYIEPIDGYRIQFDWYPTSDST
OPGD_SALTI       AIDFVGGDL---KAAAPKGIEPVITLSSGEAK--QVEILYVEPFDGYRIQFDWYPTSDST
OPGD_SALTY       AIDFVGGDL---KAAAPKGIEPVITLSSGEAK--QIEILYVEPFDGYRIQFDWYPTSDST
OPGD_PSESM       AVDFNGGGLD--RLPEGTGIEPIVTVSHGKVQ--DFNILVLPDIKGYRITFDWVPDSDSV
OPGD2_RALSO      MVEFKGGPLE--KVPFGVKPEAVLTSSRGTFSYVFTEAVPNGVPGHWRAQFDLTV--DGK
                  ::* ** *           :.::  : *  .    .          *  **      . 

OPGD_XANAC       QQIDIRLYLRAN-GKPLTETWLYQWTPPPPSERRIY------
OPGD_XANCP       QQIDIRLFLRAN-GKPLTETWLYQWTPPPASERKIY------
OPGD_XYLFA       QQIDIRLYLRDTNGEPLTETWLYQWMPPILEERKMY------
OPGD_XYLFT       QQIDIRLYLRDTNGEPLTETWLYQWVPPILEERKY-------
OPGD_SHEON       EPINLRVYLEVD-GQPLTETWMYQWTPPPMNERELHNAGHLQ
OPGD1_RALSO      APIELQLTLQSG-DRPLSETWAYQWTPP--ADRAV-------
OPGD_ECOLI       DPVDMRMYLRCQ-GDAISETWLYQYFPPAPDKRQYVDDRVMS
OPGD_ECO57       DPVDMRMYLRCQ-GDAISETWLYQYFPPAPDKRQYVDDRVMS
OPGD_SHIFL       DPVDMRMYLRCQ-GDAISETWLYQYFPPAPDKRQYVDDRVMS
OPGD_ECOL6       DPVDMRMYLRCQ-GDAISETWLYQYFPPAPDKRQYVDDRVMS
OPGD_SALTI       APVDMRMFLRCQ-GEAISETWLYQYFPPAPDKRRYVDDRIMR
OPGD_SALTY       APVDMRMFLRCQ-GEAISETWLYQYFPPAPDKRRYVDDRIMR
OPGD_PSESM       DPVEMRMFIRTG-DRTLSETWMYQYFPPALDKRKYP------
OPGD2_RALSO      EPVDMRLFLRLD-GKPLSETWLYQYHPFQSPVGPVAS-----
                   ::::: :.   . .::*** **: *