CLUSTAL format seed alignment for MF_01069

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

OPGG_ECOL6       ----------------------------------MMKMRWLSAAV---------------
OPGG_ECOLI       ----------------------------------MMKMRWLSAAV---------------
OPGG_SHIFL       ----------------------------------MMKMRWLSAAV---------------
OPGG_SALTY       ----------------------------------MMKMRWLGAAI---------------
OPGG_NITEU       ----------------------------MRHKPQIIKMRWLGVAVT--------------
OPGG_PSEPK       ----------------------------------------MASVAL--------------
OPGG_PSESM       --------------------MIVSPCDAPKTPVKRLRSALLASSAL--------------
OPGG_PSEAE       ----------------------MIFRSVSNTDFRARVRTLLLAGST--------------
OPGG_RALSO       ---------------------------------------MRLAVGL--------------
OPGG_RHOS4       MPAPAAPSARLNRRLLLSAASSSLALAASGLMGLPLRAQEAPADAP--------------
OPGG1_SHEON      -------------MVSLLRCQSFKPSSIICSLALSAAFALSGTAFADESKPAENKPATPV
OPGG_VIBCH       -----------MIRVSSAVQRHAQKLIVLFSLLFGASLLMSDNGFATDIKNTNASSPVNS
OPGG_BRADU       ---------------------------MNRRQLLRGSVAVSAAAVL--------------
OPGG2_SHEON      ----------MRLHLTFNHSTPATGRKNTKHTLFFGSMLACIISII--------------
                                                                             

OPGG_ECOL6       ------------MLTLYTSSSWAFSIDDVAKQAQSLAGKGYEAPKSNLPSVFRDMKYADY
OPGG_ECOLI       ------------MLTLYTSSSWAFSIDDVAKQAQSLAGKGYETPKSNLPSVFRDMKYADY
OPGG_SHIFL       ------------MLTLYTSSSWAFSIDDVAKQAQSLAGKGYEAPKSNLPSVFRDMKYADY
OPGG_SALTY       ------------MLTLYASSSWAFSIDDVAKQAQSLAGKGYEAPKSNLPSVFRDMKYADY
OPGG_NITEU       ------------LLVLYASSAWAFSINDVAKQAQLLASESYETPETNLPSIFRDMKYADY
OPGG_PSEPK       ------------VGLMSAGQLWAFNLDDVAAKAKDLAGQKYEAPKSNLPAVFRDMKFADY
OPGG_PSESM       ------------VCLFSAGQLWAFSLDDVAAKAKEMAGQKFEAPRSNLPNELRDMKFADY
OPGG_PSEAE       ------------ALAFVAAPVWAFSIDDVASKAKDLAGDKYSAPTSNLPSEFSEMKFADY
OPGG_RALSO       ------------LALASAQAALAFGLNDVAARAKQLAAKPYQAPPDTLPHELRELRYDQY
OPGG_RHOS4       ------------PASVPVAAPQQFSYDWLTEEMRVAATQPHVEPE-NLTGFLGELQYDDY
OPGG1_SHEON      VSPPKATAPSANKTQVRFTKTGTFDGDSVVKLARKLASKPYVVLKDPMPAGLAKLTYDEY
OPGG_VIBCH       ES-TKPTKAGEVKNVVRFAKTGSFDNDTVVRLARQLAKKPYVALKDPLPESLANISYDEY
OPGG_BRADU       ------PRAADAQSGTAL--T--FSPSYVRELARALATKPFAAPDEKLPEALKNLNYDQY
OPGG2_SHEON      S----LVVPAYGANVSDEKKAKPFTHDNVIDLAMQLAQKPFKEAR-KAPKELIDLDYATY
                                        *  . :       * . .       .  : .: :  *

OPGG_ECOL6       QQIQFNHDKAYWNNLKTPFKLEFYHQGMYFDTPVKINEVTATAVKRIKYSPDYFTFGDVQ
OPGG_ECOLI       QQIQFNHDKAYWNNLKTPFKLEFYHQGMYFDTPVKINEVTATAVKRIKYSPDYFTFGDVQ
OPGG_SHIFL       QQIQFNHDKAYWNNLKTPFKLEFYHQGMYFDTPVKINEVTATAVKRIKYSPDYFTFGDVQ
OPGG_SALTY       QQIQFNSDKAYWNNLKTPFKLEFYHQGMYFDTPVKINEVTATTVKRIKYSPDYFNFGNVQ
OPGG_NITEU       QQIQFNHDKAYWNNLKTPFKLEFYHQGMYFDTPVKINEVTATSVHQIKYTPDYFNFGNVQ
OPGG_PSEPK       QKIRFLQEKAEWAKDKTPFKLSFYHQGMHFDTPVKINEVTATKVEEIKYDPDRFEFGDVP
OPGG_PSESM       QKIRFRDDKAEWAGDKTPFKVSFYHQGMHFDTPVKINEVTATSVDEIKYDASRFDFGGLN
OPGG_PSEAE       QQIRFINERAYWGKLKTPFKLSFYHQGMHFDTPVKINEVTATTVKPIKYDRTKFDFGSLK
OPGG_RALSO       REIRFKSDQAYWRRDKLPFELGFFHEGSYYDQPVKINEVSPAGAREIRFDPRLFDYGPVK
OPGG_RHOS4       RSINFRTDRSRWADTDSMFRIQAFHLGWLFGAPVRLYDVTDGYVHEVRFSTDDFEYRNEL
OPGG1_SHEON      RDIRFNPVSSIWRDQGLPFQMQMFHRGFYFQDLIEIAIVEANQATHLAYEPKYFTAGEVI
OPGG_VIBCH       RDIRFKPDSAVWKADGLPYQMQLFHRGFFFQDLIEIALVEGNQATHLSYDPNMFTAGEVL
OPGG_BRADU       RSIRFAPEKALWRAEKLPFEVQFFHRGFFYKNRVDIFQVADRSVTPVSYRRDDFSFGEGL
OPGG2_SHEON      GKINYQENAAIWGGTPTKFSVQLFAPGFLYKNLVDIDVVENSRAFPIELTESSFSVPNDT
                  .*.:    : *      : :  :  *  :   : :  *    .  :      *      

OPGG_ECOL6       HDK--DTVKDLGFAGFKVLYPINSKDKNDEIVSMLGASYFRVIGAGQVYGLSARGLAIDT
OPGG_ECOLI       HDK--DTVKDLGFAGFKVLYPINSKDKNDEIVSMLGASYFRVIGAGQVYGLSARGLAIDT
OPGG_SHIFL       HDK--DTVKDLGFAGFKVLYPINSKDKNDEIVSMLGASYFRVIGAGQVYGLSARGLAIDT
OPGG_SALTY       HDK--DTVKDLGFAGFKVLYPINSKDKNDEIVSMLGASYFRVIGAGQVYGLSARGLAIDT
OPGG_NITEU       HDK--DTVKDLGFAGFKVLNPINSKNKNDEILSMLGASYFRMIGAGQVYGLSARGLAIDT
OPGG_PSEPK       HDP--ETTKNLGYAGFRVLYPINKADKQDEIMTLLGASYFRVVGKGHVYGLSARGLAIDT
OPGG_PSESM       IDP--KTSEKLGYAGFRVLYPINKDDKQDEIMTMLGASYFRVIGKGQVYGLSARGMAIDT
OPGG_PSEAE       FDE--NATKDLGYAGFRVLYPINKADKQDEIATFLGASYFRVVGKGQVYGLSARGLAIDT
OPGG_RALSO       LDP--KHLRNLGFAGFRIHYPMNTPKYKDEVIVFLGASYFRGIGKGQVYGLSARGLAIDT
OPGG_RHOS4       STRVAAHVDLPGVAGFRLNFPLNRPDVFDELVAFLGASYFRALGRGNGYGISARGLAVNT
OPGG1_SHEON      TQA--LPNDDIGYSGFRIHNQLNTNGVFDELMVFQGASYFRALGKGNAYGLSARGLALKT
OPGG_VIBCH       QQN--LPTEDIGYSGLRVHYPLNSPSYFDELFVFQGASYFRALGKGNAYGLSARGLAIKT
OPGG_BRADU       GQ---WPDADLGFAGFRIHAPINKPDYYDELCVFLGASYFRVVAKGQTYGLSARGLAIDT
OPGG2_SHEON      IEK--LLTQVGQYAGVRLHYPINDDEVKDEFIMFQGASYFRALSKGQTYGLSNRGLAIDV
                              :*.::   :*     **.  : ****** :. *: **:* **:*:..

OPGG_ECOL6       ALPSGEEFPRFKEFWIERPKPTDKRLTIYALLDSPRATGAYKFVVMPGRDTVVDVQSKIY
OPGG_ECOLI       ALPSGEEFPRFKEFWIERPKPTDKRLTIYALLDSPRATGAYKFVVMPGRDTVVDVQSKIY
OPGG_SHIFL       ALPSGEEFPRFKEFWIERPKPTDKRLTIYALLDSPRATGAYKFVVMPGRDTVVDVQSKIY
OPGG_SALTY       ALPSGEEFPRFREFWIERPKPTDKRLTVYALLDSPRATGAYRFVIIPGRDTVVDVQSKVY
OPGG_NITEU       ALPSGEEFPRFREFWIERPKPADRHLIIYALLDSPRATGAYRFVIMPNRDITVNVQSKIY
OPGG_PSEPK       ALPSGEEFPRFTEFWVEKPKPADKHLVIYALLDSPRSTGAYKLTLRPGNDTVVDVQSRVF
OPGG_PSESM       ASPSGEEFPRFKEFWIEKPGPDDNHLVIFALLDSPRATGAYQLTLRPGTNTLVDVKSRMF
OPGG_PSEAE       ALPSGEEFPRFREFWIERPKAQDKQLVIYALLDSPRATGAYRFVLRPGKDAVMDVQARVF
OPGG_RALSO       ALNSGEEFPRFTEFWIERPAANAKELTIYALLNSRRATGAYRFVIKPGTDTEVDVKAQLY
OPGG_RHOS4       ATSAPEEFPRFSRFYLERPHGGGLSAVLYAAMESPSVTGAYRFVITPGIETMIEVTARLF
OPGG1_SHEON      ADPEGEEFPIFRAFWVERPSYDSNLIVVHALLDSPSVAGAYRFSVRPGDNTQIDVEATLF
OPGG_VIBCH       ADPAGEEFPIFRAFWVEKPNYDTNLIVVHALLDSPSVSGAYRFSIRPGENTRMDVEAVLF
OPGG_BRADU       GESKGEEFPVFKAFWLEKPAPSASSMVVHALLDSKSAAASYRFTIRPGQTTVFDVEMALY
OPGG2_SHEON      AQPKGEEYPLFKRFWIERPSKYQTAIVVHALLDSQSVTGAYRFGIYPGAPTRVDVDVTLF
                 .    **:* *  *::*:*        :.* ::*   :.:*:: : *.    .:*   ::

OPGG_ECOL6       LRDKVGKLGVAPLTSMFLFGPNQPSPANNYRPELHDSNGLSIHAGNGEWIWRPLNNPKHL
OPGG_ECOLI       LRDKVGKLGVAPLTSMFLFGPNQPSPANNYRPELHDSNGLSIHAGNGEWIWRPLNNPKHL
OPGG_SHIFL       LRDKVGKLGVAPLTSMFLFGPNQPSPANNYRPELHDSNGLSIHAGNGEWIWRPLNNPKHL
OPGG_SALTY       LRDKVGKLGVAPLTSMFLFGPNQPSPTTNYRPELHDSNGLSIHAGNGEWIWRPLNNPKHL
OPGG_NITEU       LRDKVGKLGIAPLTSMFLFGSNHPSPMVNFRPELHDSNGLSIHASNGEWIWRPLNNPRRL
OPGG_PSEPK       LRDHVSRLGIAPLTSMYLFGPNQPSKVLNYRPALHDSEGLSIHAGNGEWLWRPLNNPKHL
OPGG_PSESM       LRDKVNKLGVAPLTSMFLFGANQPSRVPNYRRELHDSSGLSIQAANGEWLWRPLNNPKHL
OPGG_PSEAE       LRDKVSKLGLAPLTSMYLFGSNQPSEQHNFRPELHDSSGLQIHAGNGEWLWRPLNNPKHL
OPGG_RALSO       MRENVSKLGIAPLTSMFFFGENQPASALDFRPEVHDSDGLSMLSGTGEWIWRPLTNPKRL
OPGG_RHOS4       FRSAVTQLGVAPLTSMFLFSEKNRATYDDFRPNVHDSDGLAVRRRDGDILWRPLNNPPRL
OPGG1_SHEON      PRVELSKVGLAPSTSMFLHSLNGRHDTDDFRPEVHDSDGLLMFNGRGEHLWRPLANPRQL
OPGG_VIBCH       PRVELSKVGLAPATSMFMHSPNGREKTDDFRPSVHDSDGLLMINGRGERLWRPLANPSTL
OPGG_BRADU       PRVDLEHAGLAPMTSMFFFGPNDRKDFDDFRPAVHDSDGLSIFNGRGEQLWRPLNNPHDL
OPGG2_SHEON      PRRDIAHVGLAPLTSMFLYGGLDTPDKPDYRPAVHNSEGLQIDRGNGERLWRPLNNPNKL
                  *  : : *:** ***::..        ::*  :*:*.** :    *: :**** **  *

OPGG_ECOL6       AVSSFSMENPQGFGLLQRGRDFSRFEDLDDRYDLRPSAWVTPKGEWGKGSVELVEIPTND
OPGG_ECOLI       AVSSFSMENPQGFGLLQRGRDFSRFEDLDDRYDLRPSAWVTPKGEWGKGSVELVEIPTND
OPGG_SHIFL       AVSSFSMENPRGFGLLQRGRDFSRFEDLDDRYDLRPSAWVTPKGEWGKGSVELVEIPTND
OPGG_SALTY       AVSSYAMENPQGFGLLQRGREFSRFEDLDDRYDLRPSAWITPKGDWGKGKVELVEIPTND
OPGG_NITEU       AISSFSTENPQGFGLLQRGRQFSRFEDLDDRYDLRPSAWITPKGKWGKGSVELIEIPTND
OPGG_PSEPK       AVSNFSVENPRGFGLMQRQRAFSDYEDLDDNYQKRPSAWIEPKGDWGKGSVDLVEIPTAD
OPGG_PSESM       SISSFSVENPRGFGLLQRGRDFSQYEDLDDRYDKRPSAWIEPKGDWGKGTVELVEIPTAD
OPGG_PSEAE       SVSTFSVENPKGFGLLQRGREFSRYEDLDDRYDLRPSAWIEPKGDWGKGTVELVEIPTPD
OPGG_RALSO       LVSSFSTTNPGGFGLMQRDRAFSSYQEIGDRYELRPSAWVEPVGKWGAGRVELVQIPTPD
OPGG_RHOS4       ASSYFGEENPQAFGLHQRKRSFDDYQDAEAHYELRPSVDVEPIGDWGKGMVRLVEIPTRY
OPGG1_SHEON      QVSAFSDNSPQGFGLIQRERNYASYQDLEAQYERRPSLWIEPVGNWGQGAVVLTEIPTES
OPGG_VIBCH       QVSAFMDNSPQGFGLMQRERDYANYQDLEAHYEKRPSLWVEPVGNWGPGAVVLTEIPTQS
OPGG_BRADU       QVSSFTDVNPGGFGLMQRERNYLAYQDLESSFETRPSLWFEPIGDWGEGAVKLFEIPTKE
OPGG2_SHEON      QISAFGDEDIKGFGLIQRHRNFDYYQDLGANYQQRPSAWIEPLNDWGKGQLILLEIPSNA
                   * :   .  .*** ** * :  :::    :: ***  . * ..** * : * :**:  

OPGG_ECOL6       ETNDNIVAYWTPDQLPEPGKEMNFKYTITFSRDEDKLHAPDNAWVQQTRRSTGDVKQSNL
OPGG_ECOLI       ETNDNIVAYWTPDQLPEPGKEMNFKYTITFSRDEDKLHAPDNAWVQQTRRSTGDVKQSNL
OPGG_SHIFL       ETNDNIVAYWTPDQLPEPGKEMNFKYTITFSRDEDKLHAPDNAWVQQTRRSTGDVKQSNL
OPGG_SALTY       ETNDNIVAYWTPDQLPEPGKEMNFKYTLTFSRDEDKLHAPDNAWVLQTRRSTGDVKQSNL
OPGG_NITEU       ETNDNIVAFWTPDQLPEAGKEINFKYTLTFSKDEDKLHAPDNAYVMQTLRSTGDVKQSNL
OPGG_PSEPK       ETNDNIVAFWSPEKLPEPGKPFEYAYRLHWTIDEPKFQAPDLGWVKQTLRSTGDVKQSNL
OPGG_PSESM       ETNDNIVAFWKPETLKAPGEEMAFDYRLHWTMQENSIHSPDLGWVKQTQRSIGDVRQSNL
OPGG_PSEAE       ETNDNIVAFWNPETQPEVGKPLDFAYRLHWTMDEDELHDPKSSWVKQTMRSVGDVKQKNL
OPGG_RALSO       ETNDNVVAYWVPETPPKPQQPFNLEYRLLWQKEGD--KKPGLSWVTQTRRSHGWTTKRPD
OPGG_RHOS4       ETNDNIVAFWVPEGQISAGDAREFAYRLRWGALPIE-EPSDIAHIWETRAGHGGVSG---
OPGG1_SHEON      EIHDNIVSFWKPRQPIPAGSEYHFAYRMSWGDEPV----AKTNSVVVSRTASGRADI---
OPGG_VIBCH       EIHDNIVAFWKPAQPLAAGSEYRFSYHLNWGAQPE----ANPQAITVSRTASGRADI---
OPGG_BRADU       EVHDNIAALWQPKQPLTAKSEHIFTYRLHWGADAP----RADALARFTRTGIG-------
OPGG2_SHEON      ETNDNIVAYWEPQGGLKQAEPYRYSYRITASNDSP----SFTNKARVIRSSKG-------
                 * :**:.: * *       .     * :                      . *       

OPGG_ECOL6       IRQPDGTIAFVVDFTGAEMKKLPEDTPVTAQTSIGDNGEIVESTVRYNPVTKGWRLVMRV
OPGG_ECOLI       IRQPDGTIAFVVDFTGAEMKKLPEDTPVTAQTSIGDNGEIVESTVRYNPVTKGWRLVMRV
OPGG_SHIFL       IRQPDGTIAFVVDFTGAEMKKLPEDTPVTAQTSIGDNGEIVESTVRYNPVTKGWRLVMRV
OPGG_SALTY       IRQPDGTIAFVVDFVGADMKKLPPDTPVAAQTSIGDNGEIVDSNVRYNPVTKGWRLMLRV
OPGG_NITEU       IRQPDGTIAFIIDFTGRKMKKLPQDTPVAAQASIDDNGTIVESSVRYNPIIKGWRLTLRV
OPGG_PSEPK       IRQPDGSVAFLVDFAGPALAALPEDAAVRSQISVGDNAEVVENNLRYNPETKGWRLTLRL
OPGG_PSESM       IRQPDGSLAFLVDFVGPVLAALPEDKTIRSQVTTDDNVELVENNLRYNPVTKGYRLTLRV
OPGG_PSEAE       IRQQDGSTALVVDFEGPALKDLAPDAPVTTQVSTDSNAEVVENSLRYNPVLKGWRLTLRI
OPGG_RALSO       ERKPDDTIALVVDFEGPALAKLPPNAPVEPVFTADANGKIESIFGQPNTATGGWRVTVRL
OPGG_RHOS4       VENTGETRKFVIDFKGGLLGGLPGDAEVEAITSV-QHGQIVTQTLERLDGMDIWRLVLDV
OPGG1_SHEON      -AKATPRRLFVVDYHLNGTMPDELPLAK--VESS--GGVISNVVIARNAANNGYRLAFEL
OPGG_VIBCH       -AKPTPKRLFVIDYQVQGAKPAQMPEPK--VRSN--AGVISNVVLRDNPANNGYRLSFEF
OPGG_BRADU       -SRGDDSKLFVLELTGDRLKGVDPKTIKGVVTAE--KADISNIVTQPNPATGGWRLSFQC
OPGG2_SHEON      -QKQAKGKELLIDYSNIKPQDIEKITID--ASIS--KGKILSSRIVAHPEINGARIFITF
                   .      ::::                          :              *: .  

OPGG_ECOL6       KVKDAKKTTEMRAALVNADQTL--------------------------------------
OPGG_ECOLI       KVKDAKKTTEMRAALVNADQTL--------------------------------------
OPGG_SHIFL       KVKDAKKITEMRAALVNADQTL--------------------------------------
OPGG_SALTY       KVKDAKKTTEMRAALVNADQTL--------------------------------------
OPGG_NITEU       KVKDVEKITEMRAALVNGDQIL--------------------------------------
OPGG_PSEPK       KVKEANKSTEMRAALVRDVPVEPAKP----------------------------------
OPGG_PSESM       KVKDAGKATEMRAYLLREIPAEPGKEPALLVADKADEKKAAAKEAAAKEAAKPAVAKESA
OPGG_PSEAE       KVKDPKKPVEMRAALVDEAQKP--------------------------------------
OPGG_RALSO       KRVDDDKPIELRGYLRSGGTGL--------------------------------------
OPGG_RHOS4       AAAE-GATVELAAHIAGYGRKL--------------------------------------
OPGG1_SHEON      EPED-KDLIELRAELKFSTPRQ--------------------------------------
OPGG_VIBCH       DPGE-VTLAELRAELTLQEARP--------------------------------------
OPGG_BRADU       SVKG-QASIELRAFLAQNDAPV--------------------------------------
OPGG2_SHEON      EPES-TNVAELRIQLRKDEKPV--------------------------------------
                          *:   :                                             

OPGG_ECOL6       ------------------------------------------------------------
OPGG_ECOLI       ------------------------------------------------------------
OPGG_SHIFL       ------------------------------------------------------------
OPGG_SALTY       ------------------------------------------------------------
OPGG_NITEU       ------------------------------------------------------------
OPGG_PSEPK       ----------------------------AQDAKQDKAAAKHAKAEKAVKAEQSAKAEQPA
OPGG_PSESM       NDQVEIAKADAPKPEAAKPEAGKADASKADAAKGDVAKADAAKADDVAKGKDGKDIQQPA
OPGG_PSEAE       ------------------------------------------------------------
OPGG_RALSO       ------------------------------------------------------------
OPGG_RHOS4       ------------------------------------------------------------
OPGG1_SHEON      ------------------------------------------------------------
OPGG_VIBCH       ------------------------------------------------------------
OPGG_BRADU       ------------------------------------------------------------
OPGG2_SHEON      ------------------------------------------------------------
                                                                             

OPGG_ECOL6       -----------------SETWSYQLPANE--
OPGG_ECOLI       -----------------SETWSYQLPANE--
OPGG_SHIFL       -----------------SETWSYQLPANE--
OPGG_SALTY       -----------------SETWSYQLPANE--
OPGG_NITEU       -----------------SETWSYQLPADE--
OPGG_PSEPK       ADAAPTNGALATTEKVLTETWSYQLPADE--
OPGG_PSESM       TEAAPTHPEPAKTLQVMTETWSYQLPSDE--
OPGG_PSEAE       ----------------LSETWSYQLPADE--
OPGG_RALSO       -----------------SETWSYLLPPG---
OPGG_RHOS4       -----------------SETWLYQWMKA---
OPGG1_SHEON      -----------------VETWLYRWTL----
OPGG_VIBCH       -----------------VETWLYRWTL----
OPGG_BRADU       -----------------SEVWIYRWTP----
OPGG2_SHEON      -----------------AATWLYRWNSDDWP
                                    .* *