CLUSTAL format seed alignment for MF_01072

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

OPGH_ECOLI      ---------------------MNKT-------TEYIDAMPIAASEKAALPK---------
OPGH_ECO57      ---------------------MNKT-------TEYIDAMPIAASEKAALPK---------
OPGH_SHIFL      ---------------------MNKT-------TEYIDAMPIAASEKAALPK---------
OPGH_ECOL6      ---------------------MNKT-------TEYIDAMPIAASEKAALPK---------
OPGH_SALTI      ---------------------MNKT-------TEYIDALLLSEREKAALPK---------
OPGH_SALTY      ---------------------MNKT-------TEYIDALLLSEREKAALPK---------
OPGH_NITEU      ---------------------MNKT-------TEYIDALPLTVAEKATLPA---------
OPGH_PSEPK      ---------------------MSNSSARPESLGEYLAHLPLSDEQRAELASC--------
OPGH_PSESM      ---------------------MSNSQWVPVSLNEYLAHLPMSDEQRAELASC--------
OPGH_PSEAE      ---------------------MNNPSTTKAPLADYLAHLPLAEEERERLGES--------
OPGH_WIGBR      ---------------------MTNNKNYMKFLKFYNKKNKIKKIKNCSYKKL--------
OPGH_RALSO      MELPATSGLNAQPGNAEGTTASTRPATALSVAERYLEALPLPAEARAALRREAGIEPADK
OPGH_BRADU      ------------------------------------------------------------
OPGH_RHOPA      ------------------------------------------------------------
OPGH_XANAC      ------------------------------------------------------------
OPGH_XANCP      ------------------------------------------------------------
OPGH_XYLFA      ------------------------------------------------------------
OPGH_XYLFT      ------------------------------------------------------------
OPGH_SHEON      ------------------------------------------------------------
OPGH_VIBCH      ------------------------------------------------------------
OPGH_CAUVC      ------------------------------------------------------------
                                                                            

OPGH_ECOLI      --TDIRAVHQALD--AEHRTWARED-DSPQGSVKARLEQA------WPDSLADGQLIKDD
OPGH_ECO57      --TDIRAVHQALD--AEHRTWARED-DSPQGSVKARLEQA------WPDSLADGQLIKDD
OPGH_SHIFL      --TDIRAVHQALD--AEHRTWARED-DSPQGSVKARLEQA------WPDSLADGQLIKDD
OPGH_ECOL6      --TDIRAVHQALD--AEHRTWARED-DSPQGSVKARLEQA------WPDSLADGQLIKDD
OPGH_SALTI      --TDIRAVHQALD--AEHRTYSRED-DSPQGSVKARLEHA------WPDSLAKGQLIKDD
OPGH_SALTY      --TDIRAVHQALD--AEHRTYSRED-DSPQGSVKARLEHA------WPDSLAKGQLIKDD
OPGH_NITEU      --TDIRTLHETLN--PEHHDYARED-DSPLGSVKARLEQS------WPDSLVNRQLTEDD
OPGH_PSEPK      --TSFSELHQRLA--ANPAASSAEA---VQASVGPRLTVG------SAAELEEAEMLGVD
OPGH_PSESM      --TTFAELHERLS--AQPVTDPAEA---AQASVGRRLTL-------SADDLEDAEMLGVD
OPGH_PSEAE      --ASFSELHARLA--GAEGAAADAGGDPALASVRARLQL-------GTPELDDAEMFGVD
OPGH_WIGBR      --FCMNHYLRTGS--NKRKKFLKKQ-YISTISVKKRLKCA------WPKLINCSNFIIKD
OPGH_RALSO      DAVALAKLHRALARLDAAQTASIEGSVPAYASIGSRLDAAYGTPHAGTATPEPAPPLEHD
OPGH_BRADU      -------------------------------------MASELPMFGQGAGVDRAACLPGA
OPGH_RHOPA      ---------------------------------------------------MDAVIAPRH
OPGH_XANAC      ----------------------------------------------MDGTVTPSPITTAM
OPGH_XANCP      ----------------------------------------------MDGTVTLSPAPTDL
OPGH_XYLFA      ----------------------------------------------MQALMEMQIGASEV
OPGH_XYLFT      ----------------------------------------------MQALMEMQIGASEV
OPGH_SHEON      -----------------------------------------------------MTVSESS
OPGH_VIBCH      ------------------------------------------------------MTNPMV
OPGH_CAUVC      --------------------------------------------MSDRSSLFDVRSSTSV
                                                                            

OPGH_ECOLI      -EGRDQLKAMPEAKRSSMFPDPWRTNPVGRFWDRLRGR-DVTPRYLARLTKEEQESEQKW
OPGH_ECO57      -EGRDQLKAMPEAKRSSMFPDPWRTNPVGRFWDRLRGR-DVTPRYLARLTKEEQESEQKW
OPGH_SHIFL      -EGRDQLKAMPEAKRSSMFPDPWRTNPVGRFWDRLRGR-DVTPRYLARLTKEEQESEQKW
OPGH_ECOL6      -EGRDQLKAMPEAKRSSMFPDPWRTNPVGRFWDRLRGR-DVTPRYLARLTKEEQESEQKW
OPGH_SALTI      -EGRDQLQAMPKATRSSMFPDPWRTNPVGRFWDRLRGR-DVTPRYVSRLTKEEQASEQKW
OPGH_SALTY      -EGRDQLQAMPKATRSSMFPDPWRTNPVGRFWDRLRGR-DVTPRYVSRLTKEEQASEQKW
OPGH_NITEU      -EGRTQLETMPKATRSSISPDPWRTNPIGRFWDHLRGH-NATPHHVSRLTKEEQAHEQKW
OPGH_PSEPK      GSGRLCLKIAPPIKRTKVVPEPWRTNVLIRMWRRMTGR-PNAPQP----PKRELP-PARW
OPGH_PSESM      ASGRLCLKATPPIRRTKVVPEPWRTNILVRGWRRLTGK-SNPPKPDHSDLPRDLP-KSRW
OPGH_PSEAE      AQGRTFLKISPPIRRTKVIPEPWRTNILVRGWRRLTGR-SNPPKP-----KRALP-RARW
OPGH_WIGBR      KKNIPLIKSYPKINRTSIAPTPWVIDSIFSFLKKFFFK-KQNSKILSK--NKKKKYLEKW
OPGH_RALSO      TAGRIHLDTGPEPARRSMVPWPWVLGPIWRARRAIGRLFSGGTAPVPYEQPDSPDPKGIW
OPGH_BRADU      ERCAGLRGLDLSMDALKQAQAPLRSAPTRPFLPQESPL--SMLPCRLDRAADVRRSPVLA
OPGH_RHOPA      EDCRDVERRAEPLPANAPLPMPVQSLLQSP------------------RAAAVR------
OPGH_XANAC      PPVSALDAGTPTLPPEAPLAMPEQNLREGS------------LQVRHQRTSPPG------
OPGH_XANCP      PPVSSLDAGQPTLPPEAPLAMPEQSLREGS------------LQVRHQRTSPMG------
OPGH_XYLFA      --VQVLDTGCAVLPPESPLPMPEQSLRKGR------------LQVPRQRTAPLG------
OPGH_XYLFT      --VQVLDTGCAVLPPESPLPMPEQSLRKGR------------LHVPRQRTAPLG------
OPGH_SHEON      VLDTEVLVGGSAMPNERPGPMEPQSLSQMP----------EGFPRRSTVANGVR------
OPGH_VIBCH      EQGASQLMGGSAMPPEQHGEMPEQNLKRLS----------EGFPRDAIQTGGVK------
OPGH_CAUVC      TLDQVVRRDTVEIPDEAALAMPVQPLSFWQ--------------GGARRATALT------
                                                                            

OPGH_ECOLI      RTVGTIRRYILLILTLAQTVVATWYMKTILPYQGWALINPMDMVGQDLWVSFMQLLPYML
OPGH_ECO57      RTVGTIRRYILLILTLAQTVVATWYMKTILPYQGWALINPMDMVGQDLWVSFMQLLPYML
OPGH_SHIFL      RTVGTIRRYILLILTLAQTVVATWYMKTILPYQGWALINPMDMVGQDLWVSFMQLLPYML
OPGH_ECOL6      RTVGTIRRYILLILTLAQTVVATWYMKTILPYQGWALINPMDMVGQDVWVSFMQLLPYML
OPGH_SALTI      RTVGTIRRYILLILTLAQTVVATWYMKTILPYQGWALINPMDMVGQDIWVSFMQLLPYML
OPGH_SALTY      RTVGTIRRYILLILTLAQTVVATWYMKTILPYQGWALINPMDMVGQDIWVSFMQLLPYML
OPGH_NITEU      CTVGTIRRYILLLLTFSQTALATWYMKTILPYQGWALIDPIDMIGQDIWISFMQLLPYIL
OPGH_PSEPK      RTVGSIRRYILLALMIGQTIVAGWYMKGILPYQGWSFVDFDEIVNQPLWDTVVQVWPYAL
OPGH_PSESM      RTVGSIRRYILLILMLGQTIVAGSYMKGILPYQGWSLVSLDEITRQTFVQTALQVLPYAL
OPGH_PSEAE      QRVGSLRRFILLLLMLAQTSVATYYMKGILPYQGWAFVDLEELAQQSLLDTVQQVLPYVI
OPGH_WIGBR      EIVGIIRRYVFLILILSQTSIATYKLNSILPYKDISWSYTIYLFNKNIFLIIKYFSPYIL
OPGH_RALSO      RFVGARRRLTLLALMIAQTVAATWAMSSVLPYHGHDW----------------------L
OPGH_BRADU      GATLIVRRLFIFVGTALLTLAGGYGMYDVVKVGGVTF----------------------L
OPGH_RHOPA      -SPAAWRRVLIMVATAVLSAAGIYEMYQVLQVGGITV----------------------L
OPGH_XANAC      ---IGVRRFYLIGGTFATTAIAVWVMLSVLWPDGISV----------------------L
OPGH_XANCP      ---IGLRRFYLIGGTLTATAVAVWVMLSVLWPGGFSV----------------------L
OPGH_XYLFA      ---IGLRRFYLIGGTMAMSLIATWVMLAVMWPGGINV----------------------L
OPGH_XYLFT      ---IGLRRFYLIGGTMSMSLIATWVMLAVMWPGGINV----------------------L
OPGH_SHEON      --SRASRRFFVVGGALLLSSFAIYEMGAVFSIGGITP----------------------L
OPGH_VIBCH      --SCSWRRVFVVGFALLISAFAIFEMRGVFLVGGLTP----------------------I
OPGH_CAUVC      -QDMNLRRWMLGLMTIAMGVAGWKASFDTIALGGVTR----------------------L
                      **  .          .       .   .                         :

OPGH_ECOLI      QTGILILFAVLFCWVSAGFWTALMGFLQLLIGRDKYSISASTVGDEPLNPEHRTALIMPI
OPGH_ECO57      QTGILILFAVLFCWVSAGFWTALMGFLQLLIGRDKYSISASTVGDEPLNPEHRTALIMPI
OPGH_SHIFL      QTGILILFAVLFCWVSAGFWTALMGFLQLLIGRDKYSISASTVGDEPLNPEHRTALIMPI
OPGH_ECOL6      QTGILILFAVLFCWVSAGFWTALMGFLQLLIGRDKYSISASTVGDEPLNPEHRTALIMPI
OPGH_SALTI      QTGILILFAVLFCWVSAGFWTALMGFLQLLIGRDKYSISASTVGDEPLNPEHQTALIMPI
OPGH_SALTY      QTGILILFAVLFCWVSAGFWTALMGFLQLLIGRDKYSISASTVGDEPLNPEHRTALIMPI
OPGH_NITEU      QSGILILFAILFCWISAGFWTALMGFLQLLIGKDKYSISASLAGDVPINPEHRTALIMPI
OPGH_PSEPK      QTSILILFGILFCWVSAGFWTALMGFLELLTGRDKYKISGSSAGNEPIAPEARTALVMPI
OPGH_PSESM      QTSILLLFGILFCWVSAGFWTALMGFLELLTGRDKYRISGASAGNEPIEAGARTALVMPI
OPGH_PSEAE      QFGILALFAILFCWVSAGFWTALMGFWELLTGRDRYRISGSSAGSEPIAADARTAIVMPI
OPGH_WIGBR      QIFVLILFYILFFWVSASFWTAFMGFYQLITKKDEYNISNKSIVKE-IKKNHRTAILMPI
OPGH_RALSO      EAIIIALFALLFCWVSAGFWTAITGFLLLAFHGDRFVISRRAAPNAPIPDDARTAIVMPI
OPGH_BRADU      EALLLGLFLVLLAWVAFSFMSALAGFFVLLTRR--QPNLPIDTTGPLPHVTSRTAMLLPT
OPGH_RHOPA      EGVVLVLFAALFAWVALSFVSALAGFTVLCCGW--RDDVGISTDGSLPSVSSRIAMLLPT
OPGH_XANAC      EGCLLGLFVLLFAWIAMSFASAVAGFVTVVARA--GRKLGIDPEQPLPTLRSRTALLMPT
OPGH_XANCP      EGCLLGLFVLLFAWIAMSFASAVAGFITVVARA--GRKLGIDPDAPLPSLHTRTALLMPT
OPGH_XYLFA      EGCLLVLFMFLFAWVTMSFASALAGFFCVVFGG--GRKLGIDPQVPLPDLHTYTALLVPT
OPGH_XYLFT      EGCLLVLFMFLFAWVTMSFASALAGFFCMVFGG--GRKLGIDPQMPLPDLHTYTALLVPT
OPGH_SHEON      EYLMLALFAINFCWIALAFCSGIAGFLLLLKKP--KPNELAQTE-----LHTRTAILMPT
OPGH_VIBCH      EYAVLVLFAINFCWIALAFSSSIAGFFVLASR---KPAPNTEQP-----LTTRTAILMPT
OPGH_CAUVC      EAVVLTLLAPLFLALSLWFCTALIGFVVLMGRP--KDPLGIDSEAPMPKLHTRTAILMPV
                :  :: *:   :  ::  * :.. **  :                         *:::* 

OPGH_ECOLI      CNEDVNRVFAGLRATWESVKATGNAKHFDVYILSDSYNPDICVAEQKAWMELIAEVGGEG
OPGH_ECO57      CNEDVNRVFAGLRATWESVKATGNAKHFDVYILSDSYNPDICVAEQKAWMELIAEVGGEG
OPGH_SHIFL      CNEDVNRVFAGLRATWESVKATGNAKHFDVYILSDSYNPDICVAEQKAWMELIAEVGGEG
OPGH_ECOL6      CNEDVNRVFAGLRATWESVKATGNAKHFDVYILSDSYNPDICVAEQKAWMELIAEVGGEG
OPGH_SALTI      CNEDVSRVFAGLRATWESVKATGNAAHFDVYILSDSYNPDICVAEQKAWMELIAEVQGEG
OPGH_SALTY      CNEDVSRVFAGLRATWESVKATGNAAHFDVYILSDSYNPDICVAEQKAWMELIAEVQGEG
OPGH_NITEU      CNEDVDRVFAGLRATWESVKATNQQQHFDIYILSDSYDPDICVAEQKAWIELLAEVQDKG
OPGH_PSEPK      CNEDVPRVFAGLRATFESVAASGNLDRFDFFVLSDTNDTDIAVAEQQAWLDVCRETKGFG
OPGH_PSESM      CNEDVPRVFAGLRATFESVAATGNLDRFDFFVLSDTNETDIAVAEQQAWLDVCRETKGFG
OPGH_PSEAE      CNEDVPRVFAGLRATVESMAATGEMERFDFFVLSDTNDPDIAVAEQQAWLELCRETKGFG
OPGH_WIGBR      CNEDVERVFAGLRATYESILSTGKIKFFDIYILSDSYNTDICMSEQKSWIDLCSETGFIG
OPGH_RALSO      CNEDVQRVFAGLRATYESLQRTGHLEHFDFFVLSDSGDPDIRTAEADAWLHVCRALDGFG
OPGH_BRADU      YNEDPHHVMARLRAMYESIDATGYGEQFDWFLLSDTTDPDIWISEEMAFIELRRACGG-D
OPGH_RHOPA      YNEDAPVVFARLQATRQSVDETGRGAQFDWFVLSDSTDPSVWIDEERCYAELAATH---D
OPGH_XANAC      YNEDPRRLLAGLQAIYESVAETGQLEHFDFFVLSDTTREHIGRAEELVYNALCDRVGGHG
OPGH_XANCP      YNEDPRRLLAGLQAIYESVAETGQLEHFDFFVLSDTTREHIGRAEEQVYAELCDSVGGHG
OPGH_XYLFA      YHEDPCRLLAGLQAIYESLAETGQLEHFDFFVLSDSRREEFGLAEEREYAALCERLGAHD
OPGH_XYLFT      YQEDPCRLLAGLQAIYESLSETGQLEHFEFFVLSDSRREEFGLAEEREYAALCERLGAHG
OPGH_SHEON      YNESPDRVFSAVSVMAEALSQTGHGHAFDWFILSDTTDPEIALLEEQAFLVLRQETHKHS
OPGH_VIBCH      YNEAPDRVFAAVETMALALAKTEHGHAFDWFILSDTTDPEVALSEEQAFWLLRQQTAGKA
OPGH_CAUVC      YNEDAAAVFARLRAMDASIAETGSARNFDIFVISDTRDAQVALAEQACFARFRREANC--
                 :*    ::: : .   ::  :     *: :::**:    .   *   :  .        

OPGH_ECOLI      QIFYRRRRRRVKRKSGNIDDFCRRWGSQYSYMVVLDADSVMTGDCLCGLVRLMEANPNAG
OPGH_ECO57      QIFYRRRRRRVKRKSGNIDDFCRRWGSQYSYMVVLDADSVMTGDCLCGLVRLMEANPNAG
OPGH_SHIFL      QIFYRRRRRRVKRKSGNIDDFCRRWGSQYSYMVVLDADSVMTGDCLCGLVRLMEANPNAG
OPGH_ECOL6      QIFYRRRRRRVKRKSGNIDDFCRRWGSQYSYMVVLDADSVMTGDCLCGLVRLMEANPNAG
OPGH_SALTI      QIFYRRRRRRMKRKSGNIDDFCRRWGNQYSYMVVLDADSVMSGECLSGLVRLMEANPNAG
OPGH_SALTY      QIFYRRRRRRMKRKSGNIDDFCRRWGNQYSYMVVLDADSVMSGECLSGLVRLMEANPNAG
OPGH_NITEU      QIFYRRRGRRVKRKSGNIDDFCRRWGSQYSYMVVLDADSVMSGECLTSLVRLMEANPNAG
OPGH_PSEPK      RIFYRRRRRRVKRKSGNLDDFCRRWGGEYKYMVVLDADSVMSGECLSSLVRLMEANPDAG
OPGH_PSESM      SIFYRRRRRRVKRKSGNLDDFCRRWGGEYRYMVVLDADSVMSGECLTSLVRLMEATPDAG
OPGH_PSEAE      KIFYRRRRRRVKRKSGNIDDFCRRWGGDYRYMVVMDADSVMSGDCLAKLVRLMEANPEAG
OPGH_WIGBR      NIFYRRRNRRVKQKSGNIDDFCRRWGKNYSYMVILDADSIMSGKCLVKLVSLMESNPRAG
OPGH_RALSO      RVFYRWRRHRVKRKSGNIDDFCRRWGGRYRYMIVLDADSVMSGDCLTRLVQLMEGAPSAG
OPGH_BRADU      QLYYRHRSDNTARKSGNIADWVTRFGAAYDHMIVLDADSLMEGDTIVRLVHAMERTPSCA
OPGH_RHOPA      RLYYRHRPHNTARKSGNIADWVERFGGAYDFMVILDADSVMTGDVLVRVAAAMETNSDVG
OPGH_XANAC      RIFYRRRADNAARKAGNVADWVRRFGGSYPQMLILDADSVMTGDTIVRLVAGMENNPDVG
OPGH_XANCP      RIFYRRRADNAARKAGNVADWVRRFGGNYPQMLILDADSVMTGDTIVRLVAGMEDNPDVG
OPGH_XYLFA      RIFYRRRADNAGRKAGNIADWVRRFGGAYQQMLILDADSVMTGDTIVRLVAAMESNPDVG
OPGH_XYLFT      RIFYRRRADNTGRKAGNIADWVRRFGGAYQQMLILDADSVMTGDTVVRLVAAMESNPDVG
OPGH_SHEON      RVYYRRRRKNVARKAGNVADFCRRWGSRYDHLLVLDADSLMESSTITGLAQRMQADPDAG
OPGH_VIBCH      NVYYRRRRKNIARKAGNIADFCRRWGSGYDHLLVLDADSVMQPSTMISLAQRMQSDPDAG
OPGH_CAUVC      NVYYRIRKENTGRKAGNVADWVSRWGSAYEHMLVLDADSLMTGEAMVRLADAMERHPGAG
                 ::** *  .  :*:**: *:  *:*  *  ::::****:*  . :  :.  *:  .  .

OPGH_ECOLI      IIQSSPKASGMDTLYARCQQFATRVYGPLFTAGLHFWQLGESHYWGHNAIIRVKPFIEHC
OPGH_ECO57      IIQSSPKASGMDTLYARCQQFATRVYGPLFTAGLHFWQLGESHYWGHNAIIRVKPFIEHC
OPGH_SHIFL      IIQSSPKASGMDTLYARCQQFATRVYGPLFTAGLHFWQLGESHYWGHNAIIRVKPFIEHC
OPGH_ECOL6      IIQSSPKASGMDTLYARCQQFATRVYGPLFTAGLHFWQLGESHYWGHNAIIRVKPFIEHC
OPGH_SALTI      IIQSSPKASGMDTLYARCQQFATRVYGPLFTAGLHFWQLGESHYWGHNAIIRVKPFIEHC
OPGH_SALTY      IIQSSPKASGMDTLYARCQQFATRVYGPLFTAGLHFWQLGESHYWGHNAIIRVKPFIEHC
OPGH_NITEU      IIQSWPRASGMDTFYARCQQFATRVYGPLFTAGLHFWQLGESHYWGHNAIIRVQPFIEHC
OPGH_PSEPK      IIQTGPKASGMDTLYARMQQFATRVYGPLFTAGLHFWQLGESHYWGHNAIIRMKPFIEHC
OPGH_PSESM      IIQTAPRASGMDTLYARMQQFATRVYGPLFTAGLHFWQLGESHYWGHNAIIRMKPFIEHC
OPGH_PSEAE      IIQTAPKASGMDTLYARMQQFATRVYGPLFTAGLHFWQLGESHYWGHNAIIRMQPFIDHC
OPGH_WIGBR      IIQSIPKASGMNTLYARYHQFSTRVYGPLFTAGMHFWQLGESHYWGHNAIIRIKPFIKYC
OPGH_RALSO      IIQTAPLAAGRDTLYARIQQFATRVYGPLFTAGLHYWQLGESHYWGHNAIIRLEPFIKHC
OPGH_BRADU      LIQTQPVIVNARTLFSRLQQFAGRVYGPLITAGNAWWHDGDGNYWGHNAIIRLKAFAAEA
OPGH_RHOPA      LIQTLPVVVQARTLFARVQQFAGSIYGPMIAAGTAWWHGSESNYWGHNAIIRVSAFAGSA
OPGH_XANAC      LIQTLPAVVNGQTLFARMQQFGGRVYGPIIAFGVAWWHGAESNYWGHNAIIRTQAFADHA
OPGH_XANCP      LIQTLPAVVNGQTLFARMQQFGGRVYGPIIAFGVAWWHGAESNYWGHNAIIRTQAFADHA
OPGH_XYLFA      LIQSLPVVVGGRTLFARMQQFGACVYGPIIAYGVAWWHGAESNYWGHNAVIRTKAFADHA
OPGH_XYLFT      LIQSLPVVVGGRTLFARMQQFGACVYGPIIAYGVAWWHGAESNYWGHNAVIRTKAFADHA
OPGH_SHEON      LIQTIPSLINGTTLMARLQQFAARIYGPVIGTGLGWWVQKEGNFWGHNAIIRTEAFMGAA
OPGH_VIBCH      LIQTIPALINGTTLMARVQQFAARIYGPVVGTGLAWWVQKEGNFWGHNAIIRTEAFMSAA
OPGH_CAUVC      LIQTMPMIINGQTIFARTLQFATRLYGRVAWTGLAWWSGSESSFWGHNAIVRTRAFAETC
                :**: *      *: :*  **.  :** :   *  :*   :. :*****::*  .*   .

OPGH_ECOLI      ALAPLPGEGSFAGSILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRW
OPGH_ECO57      ALAPLPGEGSFAGSILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRW
OPGH_SHIFL      ALAPLPGEGSFAGSILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRW
OPGH_ECOL6      ALAPLPGEGSFAGSILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRW
OPGH_SALTI      ALAPLPGEGSFAGSILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRW
OPGH_SALTY      ALAPLPGEGSFAGSILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRW
OPGH_NITEU      TLALLPGEGTFAGSILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRW
OPGH_PSEPK      ALAPLPGKGAFAGAILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRW
OPGH_PSESM      ALAPLPGKGAFAGAILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRW
OPGH_PSEAE      ALAPLPGKGSFAGAILSHDFVEAALMRRAGWGVWIAYDLDGSYEELPPNLLDELKRDRRW
OPGH_WIGBR      VLSPLPGNGIFSGSILSHDFVEAALMRRAGWSVWIAYDIPGSYEEPPPNLLDELKRDRRW
OPGH_RALSO      ALAPIPGKGSLSGEIMSHDFVEAALMRRAGWAVWIAYDLDGSYEEMPPNLLDELGRDRRW
OPGH_BRADU      GLPELRGRKPFGGHILSHDFVEAALMRRAGWAIYMVPAVRGSFEEVPPSLLDFAGRDRRW
OPGH_RHOPA      GLPTLAGRKPFGGEILSHDFVEAALMRRAGWRIHLAPTLRGSYEECPPSLLDFAARDRRW
OPGH_XANAC      GLPSLRGRKPFGGHVLSHDFVEAALMRRGGWAMHMVPYLQGSYEEGPPTLTDLLIRDRRW
OPGH_XANCP      GLPSLRGRKPFGGHVLSHDFVEAALMRRGGWAMHMVPYLQGSYEEGPPTLTDLLVRDRRW
OPGH_XYLFA      GLPALPGRKPFGGHVLSHDFVEAALIRRGGWATHMVPYLQGSYEEGPPTLTDLLIRDRRW
OPGH_XYLFT      GLPALPGRKPFGGHVLSHDFVEAALIRRGGWATHMVPYLQGSYEEGPPTLTDLLIRDRRW
OPGH_SHEON      GLPNLKGKPPFGGHILSHDFVEAALIRRAGWSVVIAYDLPGSYEECPPSIVDLAVRDRRW
OPGH_VIBCH      GLPHLSGRPPFGGHILSHDFVEAALIRRAGWSVTIAADLSGSFEECPPSIIDLAVRDRRW
OPGH_CAUVC      GLPHLPGPKPFGGEVMSHDALESALLRRGGWSVHLAPYLDGSYEESPSNLLDFATRDRRW
                 *. : *   :.* ::*** :*:**:**.**   :.  : **:** *..: *   *****

OPGH_ECOLI      CHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFMFLALSTALQVVHALTEPQYFL
OPGH_ECO57      CHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFMFLALSTALQVVHALTEPQYFL
OPGH_SHIFL      CHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFMFLALSTALQVVHALTEPQYFL
OPGH_ECOL6      CHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFMFLALSTALQVVHALTEPQYFL
OPGH_SALTI      CHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFMFLALSTALQVVHALTEPQYFL
OPGH_SALTY      CHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFMFLALSTALQVVHALTEPQYFL
OPGH_NITEU      CHGNLMNFRLFLVKGLHPVHRAVFLTGVMSYLSAPLWFMFLALSTALQVVHAFTEPHYFL
OPGH_PSEPK      CHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFLFLVLSTALLATNTLMEPQYFI
OPGH_PSESM      CHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFFFLVLSTALLAVNTLMEPTYFL
OPGH_PSEAE      CHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFFFLVLSTALLAVHQLMEPQYFL
OPGH_WIGBR      CHGNLMNFRLFFMNGLHPVHRVVFLTGVMSYLSAPLWFAFLILSTILQIIYNI-EFMCCF
OPGH_RALSO      CHGNLMNFRLFGSPGFHPVHRAVFVTGVMAYLSAPLWFLFLLLSTALLAKHTLIAPEYFT
OPGH_BRADU      CQGNLQHLAVLPTRGLHWVSRLHLLTGIGSYVTAPLWLLFLLVGLLISLQAHFIRPEYFP
OPGH_RHOPA      CQGNLQHGKLLTARGLHWVSRLHFLTGIGAYLTAPMWLAFLIAGILISLQAQFVRPEYFP
OPGH_XANAC      CQGNLQHAKVVGAKGLHWISRMHMLIGIGHYFTAPMWGLLMLIGIGIPLAGGDIDLAG-D
OPGH_XANCP      CQGNLQHAKVVGAKGLHWISRMHMMIGIGHYFTAPMWGMLMLVGIGIPLAGAGIDLAQ-G
OPGH_XYLFA      CQGNLQHAKIVTAAGLHWISRMHMLIGIGHYFTAPMWGLLMLVGIAIPLVGDGIDLTA-G
OPGH_XYLFT      CQGNLQHAKIVTAAGLHWISRMHMLIGIGHYFTAPMWGLLMLVGIAIPLVGDGIDLTA-G
OPGH_SHEON      CQGNLQHSRILPTKGLHWVSRLHLMTGIMAYLSSPFWLLLILTGLMLALQAHFIRPEYFT
OPGH_VIBCH      CQGNLQHSRIIGTKGLHWISRLHLTTGIMSYLSSPFWLLLILSGLLLALQAHFIRPEYFT
OPGH_CAUVC      CRGNIQHVPLIALPGLHWMSRMHLVIGVLSYALSPLWFFCLSAGLISRALMPELKKAAFT
                *:**: :  :.   *:* : *  :  *:  *  :*:*   :  .                

OPGH_ECOLI      QPRQLFPVWPQWRPEL---AIALFASTMVLLFLPKLLSILLIWCKG--TKEYGGFWRVTL
OPGH_ECO57      QPRQLFPVWPQWRPEL---AIALFASTMVLLFLPKLLSILLIWCKG--TKEYGGFWRVTL
OPGH_SHIFL      QPRQLFPVWPQWRPEL---AIALFASTMVLLFLPKLLSILLIWCKG--TKEYGGFWRVTL
OPGH_ECOL6      QPRQLFPVWPQWRPEL---AIALFASTMVLLFLPKLLSILLIWCKG--TKEYGGFWRVTL
OPGH_SALTI      QPRQLFPVWPQWRPEL---AIALFASTMVLLFLPKLLSIMLIWCKG--TKEYGGFWRVTL
OPGH_SALTY      QPRQLFPVWPQWRPEL---AIALFASTMVLLFLPKLLSIMLIWCKG--TKEYGGFWRVTL
OPGH_NITEU      QPHQLFPVWPQWQPEL---AIALLASTMVLLFLPKLLSILLIWCKG--TKEYGGFIRVTI
OPGH_PSEPK      EPYQLYPLWPQWHPEK---AVALFSTTIVLLFLPKLLSVILIWAKG--AVEYGGRVKVTL
OPGH_PSESM      EPRQLYPLWPQWHPER---AVALFSTTIVLLFLPKLLSVILIWAKG--AKGFGGKFKVTV
OPGH_PSEAE      EPRQLFPIWPQWHPEK---AIALFSTTLTLLFLPKLLSVMLIWAKG--AKGFGGVIRVTL
OPGH_WIGBR      KINSYFYIIPYLHLEA---SIGLFFITLLLLLLPKFFSVILIISKN--SIQYGGTRCFIL
OPGH_RALSO      QPRQLFPIWPEWHPEK---AAALFSATATVLFLPKILSVLVLWAKG--PRRFGGAVHLAL
OPGH_BRADU      KGFSLFPTWPQQDPVL---AAWVFAATMGLLILPKLLAYLVLISNREERTGFAGSGRVLA
OPGH_RHOPA      KDFSLFPIWPAQDPVR---AAWVFAGTMGLLILPKLLALFLVLIRSDTRRRFGGGLRTFG
OPGH_XANAC      LPFSPARYWHGSSQGN---AIWIFVCTMFVLLAPKLLGYIALLLNPRELRACGGAFRAAV
OPGH_XANCP      LPFSPARYWHGSSDGN---AIWIFVCTMFVLLAPKLLGYIALLLNPRERRACGGAIRAAL
OPGH_XYLFA      MHFSPAHYWHGRTDGD---VLWIFTFTMFVLLAPKLLAYFALLFKPYERRACGGALRVLL
OPGH_XYLFT      MHFSPAHYWHGRTDGD---VLWIFTFTMFVLLAPKLLAYFALLFKPYERRACGGALRVLL
OPGH_SHEON      DQFSLFPTWPIMDSDR---ALRLFYITMVVLFGPKIFGVLLLLKDGKFARSVGGRIKAMF
OPGH_VIBCH      EQFSLFPTWPVMDSAR---ALQLFYITMGILFSPKIFGLLLLMFDGEMCRTLGGRLRVIL
OPGH_CAUVC      MADLKAAAHALIDWSEIQATAWAMIITFVLLFGPKILGAILVLARKGEVKGFGGKRRMAA
                                       :  *  :*: **::. : :          .*      

OPGH_ECOLI      SLLLEVLFSVLLAPVRMLFHTVFVVSAFLGWEVVWNSPQRDDDSTSWGEAFKRHGSQLLL
OPGH_ECO57      SLLLEVLFSVLLAPVRMLFHTVFVVSAFLGWEVVWNSPQRDDDSTSWGEAFKRHGSQLLL
OPGH_SHIFL      SLLLEVLFSVLLAPVRMLFHTVFVVSAFLGWEVVWNSPQRDDDSTSWGEAFKRHGSQLLL
OPGH_ECOL6      SLLLEVLFSVLLAPVRMLFHTVFVVSAFLGWEVVWNSPQRDDDSTSWGEAFKRHGSQLLL
OPGH_SALTI      SLLLEVLFSVLLAPVRMLFHTVFVVSAFLGWEVVWNSPQRDDDSTPWGEAFMRHGSQLLL
OPGH_SALTY      SLLLEVLFSVLLAPVRMLFHTVFVVSAFLGWEVVWNSPQRDDDSTPWGEAFMRHGSQLLL
OPGH_NITEU      SLLLEVILSVLLAPVRMLFHTVFVVSAFLGWKVAWKSPQRDDDSTTWREAFMRHGSQLLL
OPGH_PSEPK      SMLMEMLFSMLLAPVRMIFHTRFVLAAFLGWAATWNSPQRDDDSTPWGEAVRRHGPQTLL
OPGH_PSESM      SMLLEMLFSVLLAPVRMLFHTRFVLAAFLGWAATWNSPQRDDDSTPWLEAVKRHGPQTLL
OPGH_PSEAE      SMLLEMFFSVLLAPVRMLFHTRFVLAAFLGWSVQWNSPQRDDDATPWSEAIRRHGMQTLL
OPGH_WIGBR      SIILEIFLSMMFSPIKMMFHTFFIFRAFFGFSLSWKSPKRRDFSTSWKESIKSHIVQVVI
OPGH_RALSO      SMVIEAVFSVLAAPVRMLFHTRFVTAAFLGWKVHWKSPPRDDAQTHWGDAVRRHGLHTLL
OPGH_BRADU      GVVCEAFVAALLAPCMMILQTKAVMEILAGRDAGWQVQRRGDGQLARGEVYRKLAGPTLC
OPGH_RHOPA      GVLLETMISALTAPVMMVFQSTAVIEILLGRDAGWQVQHRGDGAIPLREVVRRYALPTAL
OPGH_XANAC      SILLETVLAALMAPVVMYLQSRGVFEVLAGKDSGWDAQVRDDGKLSWPALLRSYGGLTVF
OPGH_XANCP      SILLETVLAALMAPVVMYLQSRGVFEVLAGKDSGWDAQVRDDGKLSWPALIRSYGGLSVF
OPGH_XYLFA      SILLESILAALMAPVVMYLQSRGVFEVLAGKDSGWDAQQRDDGKLSWSVLLRSYGGLSVL
OPGH_XYLFT      SILLESILAALMAPIVMYLQSRGVFEVLAGKDSGWDAQQRDDGKLSWSVLLRSYGGLSVL
OPGH_SHEON      SVLFEVILSALIAPIMMFIHCGAVMSILMGRDSGWSPQRRDDGSMPWLTLIYRHRWHMLA
OPGH_VIBCH      SAVTEILLSALVAPIMMLIHCGAVVSILFGRDSGWAPQRRDDGSLPIKDLLYRHRWHMTA
OPGH_CAUVC      GLGVEMLLSALVAPMLMFTQTRAIVEILAGKVGGWAAQRRDADKVDFKEAWAAMGWISLS
                .   * ..: : :*  *  :   :   : *    *    *                    

OPGH_ECOLI      GLVWA-VGMAWLDLRFLFWLAPIVFSLILSPFVSVISSRATVGLRTKRWKLFLIPEEYSP
OPGH_ECO57      GLVWA-VGMAWLDLRFLFWLAPIVFSLILSPFVSVISSRATVGLRTKRWKLFLIPEEYSP
OPGH_SHIFL      GLVWA-VGMAWLDLRFLFWLAPIVFSLILSPFVSVISSRATVGLRTKRWKLFLIPEEYSP
OPGH_ECOL6      GLVWA-VGMAWLDLRFLFWLAPIVFSLILSPFVSVISSRATVGLRTKRWKLFLIPEEYSP
OPGH_SALTI      GLVWA-VGMAWLDLRFLFWLAPIVFSLILSPFVSVISSRSTVGLRTKRWKLFLIPEEYSP
OPGH_SALTY      GLVWA-VGMAWLDLRFLFWLAPIVFSLILSPFVSVISSRSTVGLRTKRWKLFLIPEEYSP
OPGH_NITEU      GLVWA-TGMAWLDLRFLFWLAPIVFSLILSPFVSVFSSRASVGLRAKRWKLLLIPEEYSP
OPGH_PSEPK      GIAWA-ALVAWLNPSFLWWLAPIVGSLVLSIPVSVISSRTRLGLAAKDEKLFLIPEEYAT
OPGH_PSESM      GACWA-LLVFWLNPSFLWWLAPIVVSLMLSIPVSVISSRTNLGLKARDEKFFLIPEEFEP
OPGH_PSEAE      GIAWT-LLVAWLNPRFLWWLSPIVGSLILSIPVSVISSRVKLGLRARDEKLFLIPEEYDT
OPGH_WIGBR      GLIWSFLIIFFMTIKSLFIFFPIIFSLIISPLISVYSSYVKIGLIFKNFGLLLIPEEKYP
OPGH_RALSO      GLGWA-ALVYWLNPSFLWWLSPVVGALIVSILLSVFSSRVTLGRGMRRWRLFMIPEEVRP
OPGH_BRADU      GLVLSVCAYSV-SLPLLLWMSPVVLGLLLSIPLGIMTSLQ-----LSAPGVFATPEINEP
OPGH_RHOPA      GTTMAIGAWLV-SWPLLLWMTPVIVGLLLAIPVALLTTRAS----RSRPLLMMTPEQIDP
OPGH_XANAC      GLFMGAVAYAV-SPALAAWMGPVIVGMALSIPVVALTSLRRTGMALRRAGIFCIPEELDP
OPGH_XANCP      GLFMGTLAYLV-SPSLAAWMAPVIVGMVVSIPVVAVTSLRRTGLALRRAGIFCIPEELDP
OPGH_XYLFA      GVLIGALAYTV-SPPLAMWMSPVVLGMAFSVPVVALTSHRLVGAVLRRWGIFLIPEETAP
OPGH_XYLFT      GVLIGALAYTV-SPPLAMWMSPVVLGMAFSVPVVALTSHRLVGAVLRRWGIFLIPEETAP
OPGH_SHEON      GVMLGYAAILD-SLTLLAWMSPALIGLWLAVPISAWTGSIKIGEFFKRIGILATPEERNP
OPGH_VIBCH      GVLLGYAAMLD-SWTLLAWMSPALIGLWFSVPLSGITASYTIGAWFKQKRILATPEEIET
OPGH_CAUVC      GLILA-ASFWF-TPDLLTATAPILAGLVLAVPLTMLGAHKVAGLKLKANGLFMTPEERRP
                *                    * : .: .:  :                 .:  **   .

OPGH_ECOLI      PQVLVDTDRFLEMNRQRSLDDGFMHAVFNPSFNALATAMATARHRASKVLEIARDRHVEQ
OPGH_ECO57      PQVLVDTDRFLEMNRQRSLDDGFMHAVFNPSFNALATAMATARHRASKVLEIARDRHVEQ
OPGH_SHIFL      PQVLVDTDRFLEMNRQRSLDDGFMHAVFNPSFNALATAMATARHRASKVLEIARDRHVEQ
OPGH_ECOL6      PQVLVDTDRFLEMNRQRSLDDGFMHAVFNPSFNALATAMATARHRASKVLEIARDRHVEQ
OPGH_SALTI      PQVLVDTDKYLEMNRRRILDDGFMHAVFNPSLNALATAMATARHRASKVLEIARDRHVEQ
OPGH_SALTY      PQVLVDTDKYLEMNRRRILDDGFMHAVFNPSLNALATAMATARHRASKVLEIARDRHVEQ
OPGH_NITEU      PKVLVDTDNYLMMNRNRTLNDGFMHAVFHPSFNALTTATATARHRKSKVLEIARDHHIEQ
OPGH_PSEPK      PQELLATDQYTHENRWHALHDGFVRAVVDPRQNALACAMATARHGQAAPIEALRAERVAK
OPGH_PSESM      PQELVSTDQYTHENRWHALKQGFIRAVVDPRQNALACALATSRHRQAQPIEVVRMERVDH
OPGH_PSEAE      PRELRATDEYTYENRWHALKDGFLKAAVDPLLNALACAMGTARHNRAQAIETVRGERIGK
OPGH_WIGBR      PKEIINTKKYFKINKNKSLKNGFFQAILHPVYNALAVAMASSRHNSSILIDLNRKKFLDL
OPGH_RALSO      PRELRAMRKHLRQA---PPTPDFRLAVVDPVTNALMCAIGTARFPHDPKLLEVRDATVLQ
OPGH_BRADU      PAVVLRANELAA--AEPTEMAGALRQLSRDPELLAEHLGSQSPASSRRF-GPVDVPLATA
OPGH_RHOPA      PAILAQVHALADRLCPANQTTDPLSALRGDRRLRELHLAALAFHPPRRR-GRIDPHLATA
OPGH_XANAC      PKVLVRASELRRAAALEPSLI---------------------------------------
OPGH_XANCP      PKVLVRASELRRAAALEPSLI---------------------------------------
OPGH_XYLFA      SKVLIRVAELRRARQP--------------------------------------------
OPGH_XYLFT      SKVLIRVAELRRARQP--------------------------------------------
OPGH_SHEON      APICIRAQEARAAYQSHIEQPWTLAQLLKDPALMELHLAMVDKQPLRAAGTPIEPVEAIV
OPGH_VIBCH      PAIVLAAQARRDEYVVDLQEVWNARMVLADHNLIALHIAMMDKLPSRQPGTAIEPLDAVA
OPGH_CAUVC      P-AIVRAAVGAACEPPIRWFARNGRPIGPTTKIRDAA-----------------------
                .                                                           

OPGH_ECOLI      ALNETPEKLNRDRRLVLLSDPVTMARLHFRVWNSPERYSSWVSYYEGIKLNPLALRKPDA
OPGH_ECO57      ALNETPEKLNRDRRLVLLSDPVTMARLHFRVWNSPERYSSWVSYYEGIKLNPLALRKPDA
OPGH_SHIFL      ALNETPEKLNRDRRLVLLSDPVTMARLHFRVWNSPERYSSWVSYYEGIKLNPLALRKPDA
OPGH_ECOL6      ALNETPEKLNRDRRLVLLSDPVTMARLHFRVWNSPERYSSWVSYYEGIKLNPLALRKPDA
OPGH_SALTI      ALNETPEKLNRDRRLVLLSDPVTMARLHYRVWNAPERYSSWVNHYQSLVLNPQALQGRTS
OPGH_SALTY      ALNETPEKLNRDRRLVLLSDPVTMARLHYRVWNAPERYSSWVNHYQSLVLNPQALQGRTS
OPGH_NITEU      ALNEPPDKLNRDCRLTLLSDPVIMSRLHYCVWAMPEKYASWVNHYQQLTLNPSALKQCEP
OPGH_PSEPK      AIEVGPKGLDLNTRLALLSDPVALSRLHEQVWA--EHNAAWIDVWRASINNDPHSPLLPL
OPGH_PSESM      ALKVGPAKLDNQHRLMLLSDPVALGRLHERVWS--EGHEEWLAAWRASIEADPHAPLLPL
OPGH_PSEAE      AIDKGPEQLDGATRLALLSDPVALSRLHTRVWE--EDRDDWLGRWRKAEADDPHAASVPL
OPGH_WIGBR      ILIKGLNKLNMIEKLTVLNDPIILTKLHFIYLLNNQ------------------------
OPGH_RALSO      ALAAGPDKLTSKQKLVLLSDPLALSALHLAVWSSDVHRAAWLPANALASKAAA-------
OPGH_BRADU      TAKVARCESLDDVLAWFDKLEMRAVLENPTLLRRILELPAGGRD----------------
OPGH_RHOPA      RVLIDDAESYSEAAGWLGPREIRAVLGDRETLQRLLQLSGEHAQLAVGSEPSG-------
OPGH_XANAC      ------------------------------------------------------------
OPGH_XANCP      ------------------------------------------------------------
OPGH_XYLFA      ------------------------------------------------------------
OPGH_XYLFT      ------------------------------------------------------------
OPGH_SHEON      HVKVHEAQCQQSALALFNRQEMALVLANPLMLRSLQKLPEQFVPEDLVSFC---------
OPGH_VIBCH      RIKVQEAESQESLLALLTKVELSYVLGNPLLIQQVAKLPPSLANQTV-------------
OPGH_CAUVC      ------------------------------------------------------------
                                                                            

OPGH_ECOLI      ASQ--------------------
OPGH_ECO57      ASQ--------------------
OPGH_SHIFL      ASQ--------------------
OPGH_ECOL6      ASQ--------------------
OPGH_SALTI      SAG--------------------
OPGH_SALTY      SAR--------------------
OPGH_NITEU      NIEEEADYAEPTAQIDMALPGTP
OPGH_PSEPK      HPE-NAGQPSLVGA---------
OPGH_PSESM      QPVVKAPEPVLV-----------
OPGH_PSEAE      AQVVPGDAGLLPAAQS-------
OPGH_WIGBR      -----------------------
OPGH_RALSO      -----------------------
OPGH_BRADU      -----------------------
OPGH_RHOPA      -----------------------
OPGH_XANAC      -----------------------
OPGH_XANCP      -----------------------
OPGH_XYLFA      -----------------------
OPGH_XYLFT      -----------------------
OPGH_SHEON      -----------------------
OPGH_VIBCH      -----------------------
OPGH_CAUVC      -----------------------