CLUSTAL format seed alignment for MF_01075

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

NHAP2_ECOLI       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_SHIFL       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECO27       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECOK1       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECO8A       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECOHS       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_SHIDS       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECOUT       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECOLU       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECO7I       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_SHIB3       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECOBW       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_SHIBS       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECO5E       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECOL5       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_SHISS       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECO55       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECODH       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECO24       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECO45       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECO81       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_SHIF8       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECOL6       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECO57       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECOSM       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ECOLC       MDATTIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_ESCF3       MDATTIISLFILGSVLVTCSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_SALA4       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_SALHS       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_SALCH       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_SALDC       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_SALEP       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_SALPC       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_SALSV       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_SALTI       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_SALTY       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_SALPA       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_SALPK       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_SALPB       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_SALNS       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_SALG2       MDAATIISLFILGSILVTSSILLSSFSSRLGIPILVIFLAIGMLAGVDGIGGIPFDNYPF
NHAP2_KLEP3       MDAAAVISLFILGSVLVTCSILLSSFSSRLGIPILVIFLAIGMLAGIDGIGGIPFDNYPF
NHAP2_KLEP7       MDAAAVISLFILGSVLVTCSILLSSFSSRLGIPILVIFLAIGMLAGIDGIGGIPFDNYPF
NHAP2_ENT38       MDAAAIISLFILGSVLVTCSILLSSFSSRLGIPILVIFLAIGMLAGIDGIGGIPFDNYPF
NHAP2_CROS8       MDAGTIISLFILGSVLVTCSILLSSFSSRLGIPILVIFLAIGMLAGVDGVGGIPFDNYPF
NHAP2_SODGM       MDSSTIISLFIIGSILVGGSILLSAFSSRLGIPILVIFLAIGMLAGIDGLGGIAFDNYPV
J3YSM7_9ENTR      MDSSTIISLFIIGSILVGGGILLSAFSSHLGIPILVIFLAIGMLAGVDGPGGIAFDNYPV
NHAP2_YERPB       MDAITINSLFLVGAVLVAASILLSSFSSRLGIPILVIFLAIGMLAGTDGLGGIAFDNYPA
NHAP2_YERP3       MDAITINSLFLVGAVLVAASILLSSFSSRLGIPILVIFLAIGMLAGTDGLGGIAFDNYPA
NHAP2_YERPY       MDAITINSLFLVGAVLVAASILLSSFSSRLGIPILVIFLAIGMLAGTDGLGGIAFDNYPA
NHAP2_YERPS       MDAITINSLFLVGAVLVAASILLSSFSSRLGIPILVIFLAIGMLAGTDGLGGIAFDNYPA
NHAP2_YERE8       MDAITINSLFLIGAVLVGASILLSSLSSRLGIPILVIFLAIGMLAGTDGIGGIAFDNYPV
NHAP2_PSEU5       MDVGNINHLFFIGALLVAASILMSSLSNRLGVPILVIFLAVGMLAGVDGVGGIVFEDYRL
B3PIE8_CELJU      MDATTVNQVLFVGAILVAASILFSSLSTRVGVPILVIFLGVGMLAGVDGPGGIVFNNYSV
NHAP2_PSEAE       MDAVTVNNFFLIGAVLVGMSILVSSLSSRLGIPILVIFLAVGMIAGNDGVGGIVFDNYPM
NHAP2_PSEAB       MDAVTVNNFFLIGAVLVGMSILVSSLSSRLGIPILVIFLAVGMIAGNDGVGGIVFDNYPV
NHAP2_PSEA7       MDAVTVNNFFLIGAVLVGMSILVSSLSSRLGIPILVIFLAVGMIAGNDGVGGIVFDNYPM
NHAP2_PSEE4       MDASTINSLFLIGALLVGASILVSSLSSRLGIPILVIILAVGMLAGVDG-GGIIFNNYPT
NHAP2_PSEPW       MDASTINSLFLIGALLVGASILVSSLSSRLGIPILVIILAVGMLAGVDG-GGIIFNNYPT
NHAP2_PSEP1       MDASTINSLFLIGALLVGASILVSSLSSRLGIPILVIILAVGMLAGVDG-GGIIFNNYPT
NHAP2_PSEPK       MDASTINSLFLIGALLVGASILVSSLSSRLGIPILVIILAVGMLAGVDG-GGIIFNNYPT
NHAP2_PSEPG       MDASTINSLFLIGALLVGASILVSSLSSRLGIPILVIILAVGMVAGVDG-GGIIFNNYPT
NHAP2_PSEFS       MNATTINSLFLIGALLVSASILVSSLSSRLGIPILVIILAVGMVAGVDG-GGIIFDNYPT
NHAP2_PSEF5       MNATTINSLFLIGALLVGASILVSSLSSRLGIPILVIILAVGMTAGVDG-GGIIFDNYPT
NHAP2_PSEPF       MNATTINSLFLIGALLVGASILVSSLSSRLGIPILVIILAVGMSAGVDG-GGIIFDNYPT
NHAP2_PSEU2       MDATTINSLFLIGALLVAASILVSSLSSRLGIPILVIILAVGMVAGVDG-GGIIFDNYAT
NHAP2_PSESM       MDATTINSLFLIGALLVAASILVSSLSSRLGIPILVIILAVGMVAGVDG-GGIIFDNYAT
NHAP2_PSE14       MDATTINSLFLVGALLVAASILVSSLSSRLGIPILVIILAVGMVAGVDG-GGIIFDNYAT
NHAP2_PSEMY       MDASAINNLFLIGALLVAASILVSAFGTRFGIPILVIFLAVGMLAGTDGPGGIVFNNYPL
NHAP2_VIBCH       MDAVTINSFFMIGALLIGISVLLSPVSSKLGIPILLVFLAVGMLAGEDGIGQIAFDNYPV
NHAP2_VIBCM       MDAVTINSFFMIGALLIGISVLLSPVSSKLGIPILLVFLAVGMLAGEDGIGQIAFDNYPV
NHAP2_VIBC3       MDAVTINSFFMIGALLIGISVLLSPVSSKLGIPILLVFLAVGMLAGEDGIGQIAFDNYPV
F7YJE3_VIBA7      MDAIAINGFFLVGALLIALSVLLSPVSSKLGIPILLVFLLVGMLAGEDGPGGILFDNYPI
NHAP2_VIBPA       MDADTINSFFLIGALLIALSVLLSPVSSKLGIPILLVFLAVGMLAGEDGLGGILFDNYSI
B7VLQ7_VIBA3      MDAITINHLFLTGAVLIAISVLFSQVSSRLGVPILLIFLFVGMLAGEDGPGGINFDDYSL
NHAP2_SHEB5       MDANSINSFFLIGALLTAVSVLLSPMSSRLGIPILLIFLAVGILAGEDGPGGILFDDYST
NHAP2_SHEB8       MDANSINSFFLIGALLTAVSVLLSPMSSRLGIPILLIFLAVGILAGEDGPGGILFDDYST
NHAP2_SHEB2       MDANSINSFFLIGALLTAVSVLLSPMSSRLGIPILLIFLAVGILAGEDGPGGILFDDYST
NHAP2_SHEB9       MDANSINSFFLIGALLTAVSVLLSPMSSRLGIPILLIFLAVGILAGEDGPGGILFDDYST
NHAP2_SHESM       MDADSINSFFLIGALLAAVSVLLSPVSSRLGIPILLIFLAVGILAGEDGPGGILFDDYST
NHAP2_SHESR       MDADSINSFFLIGALLAAVSVLLSPVSSRLGIPILLIFLAVGILAGEDGPGGILFDDYST
NHAP2_SHESA       MDADSINSFFLIGALLAAVSVLLSPVSSRLGIPILLIFLAVGILAGEDGPGGILFDDYST
NHAP2_SHEON       MDADSINSFFLIGALLTAVSVLLSPMSSRLGIPILLIFLAVGILAGEDGPGGILFDDYST
NHAP2_SHEPC       MDADSINSFFLIGALLAAVSVLLSPMSSRLGIPILLIFLAVGILAGEDGLGGIQFDDYST
NHAP2_SHESW       MDADSINSFFLIGALLAAVSVLLSPMSSRLGIPILLIFLAVGILAGEDGLGGIQFDDYST
NHAP2_SHESH       MSAETINNFFLIGALLIAVSVLLSAVSSRVGIPILLVFLGVGIMAGEDGPGGIHFDDYSV
A1S3I1_SHEAM      MIAENMNLLFLVGALLVGLSVVLSPLSSRLGVPILLVFLGVGILAGEDGPGGIQFNDYST
NHAP2_AERHH       MDAVTINSFFLVAALLVGASVLLSALSSRLGIPILVIFLAVGMLAGEDGPGGIHFADYSI
NHAP2_AERS4       MDAVTINSFFLVAALLVGASVLLSALSSRLGIPILVIFLAVGMLAGEDGPGGIHFADYSV
                  *    :  .:: .::*   .::.* ...:.*:***:::* :*: ** ** * * * :*  

NHAP2_ECOLI       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_SHIFL       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECO27       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECOK1       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECO8A       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECOHS       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_SHIDS       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECOUT       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECOLU       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECO7I       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_SHIB3       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECOBW       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_SHIBS       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECO5E       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECOL5       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_SHISS       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECO55       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECODH       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECO24       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECO45       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECO81       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_SHIF8       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECOL6       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECO57       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECOSM       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ECOLC       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFNLDLI
NHAP2_ESCF3       AYMVSNLALAVILLDGGMRTQASSFRVALGPALSLATVGVLITSGLTGMMAAWLFNLDLI
NHAP2_SALA4       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_SALHS       TYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_SALCH       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_SALDC       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_SALEP       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_SALPC       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_SALSV       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_SALTI       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_SALTY       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_SALPA       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_SALPK       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_SALPB       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_SALNS       AYMVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_SALG2       AYIVSNLALAIILLDGGMRTQASSFRVALGPALSLATLGVLITSGLTGMMAAWLFHLDLI
NHAP2_KLEP3       AYMVSNLALAVILLDGGMRTQASSFRVALWPALSLATVGVLITSALTGMMAAWLFKLDMI
NHAP2_KLEP7       AYMVSNLALAVILLDGGMRTQASSFRVALWPALSLATVGVLITSALTGMMAAWLFKLDLI
NHAP2_ENT38       AYMVSNLALAVILLDGGMRTQASSFRVALGPALSLATVGVLITSGLTGMMAAWLFHLDIM
NHAP2_CROS8       AYLISNLALAVILLDGGMRTQASSFKVALGPALSLATVGVLITSGLTGMAAAWLFHLDIM
NHAP2_SODGM       AYLISNLALAVILLDGGMRTRATAFRVALWPSLSLATVGVIITAGLTGIAAAWLFGLDKI
J3YSM7_9ENTR      AYLISNLALAVILLDGGMRTRATAFRVALWPSLSLATVGVIITAGLTGMVAAWLFRLDMI
NHAP2_YERPB       AYLVSNLALAVILLDGGMRTRASSFRVALWPALSLATFGVIITAGLTGLVAAWLFNLDII
NHAP2_YERP3       AYLVSNLALAVILLDGGMRTRASSFRVALWPALSLATFGVIITAGLTGLVAAWLFNLDII
NHAP2_YERPY       AYLVSNLALAVILLDGGMRTRASSFRVALWPALSLATFGVIITAGLTGLVAAWLFNLDII
NHAP2_YERPS       AYLVSNLALAVILLDGGMRTRASSFRVALWPALSLATFGVIITAGLTGLVAAWLFNLDII
NHAP2_YERE8       AYLVSNLALAVILLDGGMRTRASSFRVALWPALSLATVGVLITAGLTGLAAAWLFDLDII
NHAP2_PSEU5       AFVISNLALAVILLDGGMRTRTATFRVALKPAFSLATLGVAITSGLTGLAAAWLFDLPLL
B3PIE8_CELJU      AYLVSNLALAIILLDGGMRTRVATFRVALWPAMSLATVGVVITSGLTGIAAAWLFDLSLL
NHAP2_PSEAE       AYLVGNLALAVILLDGGLRTRVSSFRVALWPALSLATLGVLVTTGLTGIAAAWLFDLHWM
NHAP2_PSEAB       AYLVGNLALAVILLDGGLRTRVSSFRVALWPALSLATLGVLVTTGLTGIAAAWLFDLHWM
NHAP2_PSEA7       AYLVGNLALAVILLDGGLRTRVSSFRVALWPALSLATLGVLVTTGLTGIAAAWLFDLHWM
NHAP2_PSEE4       AYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVLITTGLTGMVAAWLFDLSLI
NHAP2_PSEPW       AYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVMITTALTGLVAAWLFDLSLI
NHAP2_PSEP1       AYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVMITTALTGLIAAWLFNLSLI
NHAP2_PSEPK       AYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVMITTALTGLIAAWLFNLSLI
NHAP2_PSEPG       AYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVMITTALTGLVAAWLFNLSLI
NHAP2_PSEFS       AYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVLITTGLTGMAAAWLFDLNII
NHAP2_PSEF5       AYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVLITTGLTGMAAAWLFDLNLI
NHAP2_PSEPF       AYLVGNLALAVILLDGGLRTRVSSFRVALWPALSLATVGVLITTGLTGMAAAWLFDLNLI
NHAP2_PSEU2       AYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVLITTVLTGMMAAWLFNLSVI
NHAP2_PSESM       AYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVLITTVLTGMVAAWLFNLSVI
NHAP2_PSE14       AYLVGNLALAVILLDGGLRTRVASFRVALWPALSLATVGVLITTVLTGMVAAWLFNLSVI
NHAP2_PSEMY       AYLVGNLALAVILLDGGMRTRVSSFRVALWPSLSLATVGVVITAGLTGLAAAWLFNLTLL
NHAP2_VIBCH       AYLVSNLALAIILLDGGMRTRVASFRVAFWPSVSLATLGVAVTTLLTGLLAMWLFNLSLL
NHAP2_VIBCM       AYLVSNLALAIILLDGGMRTRVASFRVAFWPSVSLATLGVAVTTLLTGLLAMWLFNLSLL
NHAP2_VIBC3       AYLVSNLALAIILLDGGMRTRVASFRVAFWPSVSLATLGVAVTTLLTGLLAMWLFNLSLL
F7YJE3_VIBA7      AYLVSNLALAIILLDGGMRTRVASFRIAFWPSVSLATFGVAITTILTGLMAAWLFNLELL
NHAP2_VIBPA       AYLVSNLALAIILLDGGMRTRVASFRVALWPSVSLATIGVAITTLLTGLMATWLFDLDLL
B7VLQ7_VIBA3      TYLVSNLALAVILLDGGMRTKVASFKVAFWPSLSLATIGVACTATLTGLMAAWLFDLSLM
NHAP2_SHEB5       AYLVSNLALAIILLDGGMRTRVASFRVALWPALSLATFGVAITTSITGMMAAWLFDLHWL
NHAP2_SHEB8       AYLVSNLALAIILLDGGMRTRVASFRVALWPALSLATFGVAITTSITGMMAAWLFDLHWL
NHAP2_SHEB2       AYLVSNLALAIILLDGGMRTRVASFRVALWPALSLATFGVAITTSITGMMAAWLFDLHWL
NHAP2_SHEB9       AYLVSNLALAIILLDGGMRTRVASFRVALWPALSLATFGVAITTSITGMMAAWLFDLHWL
NHAP2_SHESM       AYLVSNLALAIILLDGGMRTRVASFRVALWPALSLATFGVAITTSITGVMAAWLFDLHWL
NHAP2_SHESR       AYLVSNLALAIILLDGGMRTRVASFRVALWPALSLATFGVAITTSITGVMAAWLFDLHWL
NHAP2_SHESA       AYLVSNLALAIILLDGGMRTRVASFRVALWPALSLATFGVAITTSITGVMAAWLFDLHWL
NHAP2_SHEON       AYLVSNFALAIILLDGGMRTRVASFRVALWPALSLATFGVAITTSITGVMAAWLFDLHWL
NHAP2_SHEPC       AYLVSNLALAIILLDGGMRTRVASFRVALWPALSLATFGVAITTSITGLMAAWLFDLHWL
NHAP2_SHESW       AYLVSNLALAIILLDGGMRTRVASFRVALWPALSLATFGVAITTSITGLMAAWLFDLHWL
NHAP2_SHESH       AYLVSNLALAVILLDGGMRTRVSSFRVALWPALSLATFGVAITTGLTGMMAAYLFDLNIL
A1S3I1_SHEAM      AYLVSNLALAVILLDGGLRTKMSSFRLALWPSLSLATLGVAITTVLTGLLAAWLFDLNLL
NHAP2_AERHH       AYLVGNLALAIILLDGGMRTRVSSFRVALWPALSLATVGVAITTGLTGLAAAWLFDLNLM
NHAP2_AERS4       AYLVGNLALAIILLDGGMRTRVSSFRVALWPALSLATVGVAITTGLTGLAAAWLFDLNLM
                  ::::.*:***:******:**: ::*::*: *:.****.**  *: :**: * :** *  :

NHAP2_ECOLI       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQHHE
NHAP2_SHIFL       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECO27       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECOK1       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECO8A       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECOHS       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQHHE
NHAP2_SHIDS       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECOUT       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECOLU       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECO7I       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_SHIB3       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECOBW       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQHHE
NHAP2_SHIBS       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECO5E       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECOL5       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_SHISS       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECO55       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECODH       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQHHE
NHAP2_ECO24       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECO45       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECO81       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_SHIF8       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECOL6       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECO57       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECOSM       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQQHE
NHAP2_ECOLC       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIAMIQHHE
NHAP2_ESCF3       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQHHE
NHAP2_SALA4       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_SALHS       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_SALCH       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_SALDC       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_SALEP       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_SALPC       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_SALSV       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_SALTI       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_SALTY       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_SALPA       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_SALPK       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_SALPB       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_SALNS       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_SALG2       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQKHE
NHAP2_KLEP3       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQQHQ
NHAP2_KLEP7       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQQHQ
NHAP2_ENT38       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVGSTLEIESGSNDPMAVFLTITLIEMIQQHE
NHAP2_CROS8       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVSSTLEIESGSNDPMAVFLTITLISMIQEHQ
NHAP2_SODGM       EGMLIGAIVGSTDAAAVFSLLGDKGLNERVTSTLEIESGSNDPMAVFLTITLIAMIQNGQ
J3YSM7_9ENTR      EGMLIGAIVGSTDAAAVFSLLGDKGLNERITSTLEIESGSNDPMAVFLTITLIAMIQKGQ
NHAP2_YERPB       QGLLIGAIIGSTDAAAVFSLLGGKGLNERVSATLEIESGSNDPMAVFLTVTLIAMIAAGE
NHAP2_YERP3       QGLLIGAIIGSTDAAAVFSLLGGKGLNERVSATLEIESGSNDPMAVFLTVTLIAMIAAGE
NHAP2_YERPY       QGLLIGAIIGSTDAAAVFSLLGGKGLNERVSATLEIESGSNDPMAVFLTVTLIAMIAAGE
NHAP2_YERPS       QGLLIGAIIGSTDAAAVFSLLGGKGLNERVSATLEIESGSNDPMAVFLTVTLIAMIAAGE
NHAP2_YERE8       QGLLIGAIIGSTDAAAVFSLLGGKGLNERVSATLEIESGSNDPMAVFLTITLISMISAGE
NHAP2_PSEU5       QGLLIGAIVGSTDAAVVFNLLNGKGLNERVGSTLEIESGSNDPMAMFLTVALIEMLLAGQ
B3PIE8_CELJU      EGLLIGAIVGSTDAAVVFNLLNGKGLNERVGSTLEIESGTNDPMAVFLTVTLIAMIAAGE
NHAP2_PSEAE       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVTATLEIESGSNDPMAVFLTVTLIEMLASGQ
NHAP2_PSEAB       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVTATLEIESGSNDPMAVFLTVTLIEMLASGQ
NHAP2_PSEA7       EGLLIGAIVGSTDAAAVFSLLGGKGLNERVTATLEIESGSNDPMAVFLTVTLIEMLASGQ
NHAP2_PSEE4       QGLLIGAIVGSTDAAAVFSLLGGKGLNERVTATLEIESGSNDPMAVFLTVTLIDMIASGQ
NHAP2_PSEPW       QGLLIGAIVGSTDAAAVFSLLGGKGLNERVTATLEIESGSNDPMAVFLTVTLIDMIASGQ
NHAP2_PSEP1       QGLLIGAIVGSTDAAAVFSLLGGKGLNERVSATLEIESGSNDPMAVFLTVTLIDMIASGE
NHAP2_PSEPK       QGLLIGAIVGSTDAAAVFSLLGGKGLNERVSATLEIESGSNDPMAVFLTVTLIDMIASGE
NHAP2_PSEPG       QGLLIGAIVGSTDAAAVFSLLGGKGLNERVTATLEIESGSNDPMAVFLTVTLIDMIASGQ
NHAP2_PSEFS       QGLLIGAIVGSTDAAAVFSLLGGKGLNERVTASLEIESGSNDPMAVFLTVTLIDMLASGQ
NHAP2_PSEF5       QGLLIGAIVGSTDAAAVFSLLGGKGLNERVTASLEIESGSNDPMAVFLTVTLIDMLASGH
NHAP2_PSEPF       QGLLIGAIVGSTDAAAVFSLLGGKGLNERVTASLEIESGSNDPMAVFLTVTLIDMLASGQ
NHAP2_PSEU2       QGLLIGAIVGSTDAAAVFSLLGGKGLNERVTASLEIESGSNDPMAVFLTVTLIGMLASGQ
NHAP2_PSESM       QGLLIGAIVGSTDAAAVFSLLGGKGLNERVTASLEIESGSNDPMAVFLTVTLIGMLASGQ
NHAP2_PSE14       QGLLIGAIVGSTDAAAVFSLLGGKGLNERVTASLEIESGSNDPMAVFLTVTLIGMLASGQ
NHAP2_PSEMY       EGLLIGAIVGSTDAAAVFSLLGGRGLNERVSSTLEIESGSNDPMAVFLTVTLIAMLASGQ
NHAP2_VIBCH       QGVLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGTNDPMAVFLTVTLIAVLGSAE
NHAP2_VIBCM       QGVLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGTNDPMAVFLTVTLIAVLGSAE
NHAP2_VIBC3       QGVLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGTNDPMAVFLTVTLIAVLGSAE
F7YJE3_VIBA7      QGILVGAIVGSTDAAAVFSLLKGRSLNERVGSTLEIESGTNDPMAVFLTVTLIAVLGSQG
NHAP2_VIBPA       QGILVGAIVGSTDAAAVFSLLKGRSLNERVGSTLEIESGTNDPMAVFLTVTLIAILSSTG
B7VLQ7_VIBA3      QGILVGAIVGSTDAAAVFSLLKGQSLNERVGSTLEIESGTNDPMAVFLTVTLIALLGTPD
NHAP2_SHEB5       QGLLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGSNDPMAVFLTVTLIAILANVD
NHAP2_SHEB8       QGLLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGSNDPMAVFLTVTLIAILANVD
NHAP2_SHEB2       QGLLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGSNDPMAVFLTVTLIAILANVD
NHAP2_SHEB9       QGLLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGSNDPMAVFLTVTLIAILANVD
NHAP2_SHESM       QGLLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGSNDPMAVFLTVTLIAILGNVD
NHAP2_SHESR       QGLLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGSNDPMAVFLTVTLIAILGNVD
NHAP2_SHESA       QGLLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGSNDPMAVFLTVTLIAILANVD
NHAP2_SHEON       QGLLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGSNDPMAVFLTVTLIAILANVG
NHAP2_SHEPC       QGLLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGSNDPMAVFLTVTLIAILANVD
NHAP2_SHESW       QGLLVGAIVGSTDAAAVFSLLKGRSLNERVGATLEIESGSNDPMAVFLTVTLIAILANVD
NHAP2_SHESH       QGLLVGAIVGSTDAAAVFSLLKGKRLNERVGATLEIESGSNDPMAVFLTVTLIAILASVG
A1S3I1_SHEAM      MGLLIGAIVGSTDAAAVFSLLKGRALNERVGSTLEIESGSNDPMAVFLTVSLIAMIA-AG
NHAP2_AERHH       QGMLIGAIVGSTDAAAVFSLLGGRSLNERVSATLEIESGSNDPMAVFLTVTLIEVLASAQ
NHAP2_AERS4       QGMLIGAIVGSTDAAAVFSLLGGRSLNERVSATLEIESGSNDPMAVFLTVTLIEILATNQ
                   *:*:***:******.**.** .: ****: ::******:*****:***::** ::    

NHAP2_ECOLI       SNISW-MFIVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFSLTT
NHAP2_SHIFL       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECO27       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECOK1       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECO8A       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECOHS       SNISW-MFIVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFSLTT
NHAP2_SHIDS       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECOUT       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECOLU       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECO7I       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_SHIB3       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECOBW       SNISW-MFIVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFSLTT
NHAP2_SHIBS       SSVSW-MFIVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFSLTT
NHAP2_ECO5E       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECOL5       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_SHISS       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECO55       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECODH       SNISW-MFIVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFSLTT
NHAP2_ECO24       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECO45       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECO81       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_SHIF8       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECOL6       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECO57       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECOSM       SSVSW-MFVVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFALTT
NHAP2_ECOLC       SNISW-MFIVDILQQFGLGIVIGLGGGYLLLQMINRIALPAGLYPLLALSGGILIFSLTT
NHAP2_ESCF3       TGVSW-TFALDILQQFGLGILLGLGGGYLLQQMINRIALPAGLYPMLALSGGILIFALTT
NHAP2_SALA4       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_SALHS       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_SALCH       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_SALDC       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_SALEP       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_SALPC       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_SALSV       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_SALTI       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_SALTY       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_SALPA       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_SALPK       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_SALPB       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_SALNS       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_SALG2       TGLDW-MFAVHIIQQFGLGIVFGLGGGYLLQQMINRISLPSGLYPMLALSGGILIFALTT
NHAP2_KLEP3       TGLSW-MFAVHIIQQFGLGIAIGLGGGYLLLQMINRIVLPAGLYPLLALSGGIMIFAVTT
NHAP2_KLEP7       TGLSW-MFAVHIIQQFGLGIAIGLGGGYLLLQMINRIVLPAGLYPLLALSGGIMIFAVTT
NHAP2_ENT38       TGLSW-MFAWHILQQFGLGIIIGLAGGYLLQQMINRISLPAGLYPLLALSGGILIFALTT
NHAP2_CROS8       TALSW-LFLVHIIQQFGLGILIGLGGGWLLLKTINRIPLPSGLYPLLALSGGIMVFSVTT
NHAP2_SODGM       IHLDW-LFLVHLIREFGLGVILGLGGGWLLQQVINRITLTNALYPLLAVSGGIMMFALTT
J3YSM7_9ENTR      THLDW-LFLAHLIREFGLGVCMGMGGGWLLQQIINRISLANGLYPLLAVSGGIMIFALTT
NHAP2_YERPB       TSLSW-MFLVHLIQQFGLGIIIGLLGGGLLLLLINRMELANGLYPLLAVSGGILVFALVT
NHAP2_YERP3       TSLSW-MFLVHLIQQFGLGIIIGLLGGGLLLLLINRMELANGLYPLLAVSGGILVFALAT
NHAP2_YERPY       TSLSW-MFLVHLIQQFGLGIIIGLLGGGLLLLLINRMELANGLYPLLAVSGGILVFALAT
NHAP2_YERPS       TSLSW-MFLVHLIQQFGLGIIIGLLGGGLLLLLINRMELANGLYPLLAVSGGILVFALAT
NHAP2_YERE8       SSLSW-MFLVHLIQQFGLGIIIGLGGGSLLLLLINRIELPSGLYPLLAVSGGILVFSLTT
NHAP2_PSEU5       STFGW-DFLLSLLQQFGIGTVLGLLGGWLLLQLINRLSVADGLYPLLAVAGGLMIFALSG
B3PIE8_CELJU      TGFSW-GVLTSFIQQFGVGIALGLAGGWLLLQIINRIHIADGLYPLLAVSGGIMLFALSG
NHAP2_PSEAE       TGLSW-GFALHLVQQFGLGALLGLGGGWLLLQLINRMHLAGGLYPLLVISGGLLVFALAN
NHAP2_PSEAB       TGLSW-GFVLHLVQQFGLGALLGLGGGWLLLQLINRMHLAGGLYPLLVISGGLLVFALAN
NHAP2_PSEA7       TGLSW-GFVLHLLQQFGLGALLGLGGGWLLLQLINRMHLAGGLYPLLVISGGLLVFALAN
NHAP2_PSEE4       TGLHW-SLLTHLLREFGIGGLMGLGGGWLMLQLVNRINLAGGLYPILVVAGGLVVFSLTN
NHAP2_PSEPW       TGLHW-SLLGHLLREFGIGGLLGLGGGWLMLQLVNRINLAGGLYPILVIAGGLAVFSLTN
NHAP2_PSEP1       TGLHW-SLLGHLLREFGIGTLLGLGGGWLMLQLVNRINLAGGLYPILVVAGGLVMFSLTN
NHAP2_PSEPK       TGLHW-SLLGHLLREFGIGTLLGLGGGWLMLQLVNRINLAGGLYPILVVAGGLVMFSLTN
NHAP2_PSEPG       TGLHW-SLLGHLLREFGIGGLLGLGGGWLMLQLVNRINLAGGLYPILVVAGGLVVFSLTN
NHAP2_PSEFS       TGLHW-SLLTHLVREFGIGGVVGLGGGWLMLQMVNRINLATGLYPILVIAGGLFVFAVTN
NHAP2_PSEF5       TGLHW-SLLTDLIREFGIGAVIGLGGGWLMLQLVNRIHLATGLYPILVVAGGLVVFALTN
NHAP2_PSEPF       TGLHW-SLLTHLIREFGIGGVIGLGGGWLMLQLVNRINLATGLYPILVIAGGLVVFALTN
NHAP2_PSEU2       TGLHW-GLLGHLIQEFGIGSFIGLGGGWILLQLVNRINLAAGLYPILVIAGGLAIFALTN
NHAP2_PSESM       TGLHW-GLLGHLIQEFGIGSFIGLGGGWILLQLVNRINLAAGLYPILVIAGGLAIFALTN
NHAP2_PSE14       TGLHW-GLLGHLIQEFGIGSFIGLGGGWILLQLVNRINLAAGLYPILVIAGGLAIFALTN
NHAP2_PSEMY       TGFSW-DLPIQLVQQFGLGALLGLGGGWLLLKLINRMELATGLYPLLVVSGGLIIFAITT
NHAP2_VIBCH       TNLSAGFLLLSFIQQFGVGALLGLAGGWILWWLINRNQLPEGLYSILAVSGGLMIFALSN
NHAP2_VIBCM       TNLSAGFLLLSFIQQFGVGALLGLAGGWILWWLINRNQLPEGLYSILAVSGGLMIFALSN
NHAP2_VIBC3       TNLSAGFLLLSFAQQFGVGALLGLAGGWILWWLINRNQLPEGLYSILAVSGGLMIFALSN
F7YJE3_VIBA7      DDLSAGFLLLSFIQQFGLGALFGLAGGWLLWKLINSNQLPEGLYSILAISGGLIIFALSN
NHAP2_VIBPA       TGLSAGFLALSFVKQFGIGALLGFAGGWVLWKVINRNQLPDGLYSILTVSGGLIIFALSN
B7VLQ7_VIBA3      AEMGMNFLLKSFAMQFGIGTLVGIGGGWVLWSLINRVQLADGLYSILVLSGGVALFAFSN
NHAP2_SHEB5       TEMSFSFMFISFIKQFGLGICLGLGGGWMLWKLVNLSKLADGLYSILVLSGGLIIYAASN
NHAP2_SHEB8       TEMSFSFMFISFIKQFGLGICLGLGGGWMLWKLVNLSKLADGLYSILVLSGGLIIYAASN
NHAP2_SHEB2       TEMSFSFMFISFIKQFGLGICLGLGGGWMLWKLVNLSKLADGLYSILVLSGGLIIYAASN
NHAP2_SHEB9       TEMSFSFMFISFIKQFGLGICLGLGGGWMLWKLVNLSKLADGLYSILVLSGGLIIYAASN
NHAP2_SHESM       AELSASFMLISFIKQFGLGIFLGLGGGWLLWKLVNLSKLAEGLYSILVLSGGLMIYAASN
NHAP2_SHESR       AELSASFMLISFIKQFGLGIFLGLGGGWLLWKLVNLSKLAEGLYSILVLSGGLMIYAASN
NHAP2_SHESA       AELSVSFMLISFIKQFGLGIFLGLGGGWLLWKLVNLSKLAEGLYSILVLSGGLMIYAASN
NHAP2_SHEON       AELSASFMLISFIKQFGLGVLLGLGGGWLLWKLVNVSKLAEGLYSILVLSGGLMIYATSN
NHAP2_SHEPC       TELSVSFMLVSFIKQFGLGICLGLGGGWLLWKLVNLSKLAEGLYSILVLSGGLIIYAVSN
NHAP2_SHESW       TELSVSFMLVSFIKQFGLGICLGLGGGWLLWKLVNLSKLAEGLYSILVLSGGLIIYAVSN
NHAP2_SHESH       EGVSASFMVMSFIKQFGLGACLGLGGGWLLWQLINRIQLADGLYPVLVLSGGLIVFAISN
A1S3I1_SHEAM      GNFDGPGLMRDLALQAGMGLAAGFGGGYLIWHLVNRSVLADGLYPILVLAGGLLLFALSS
NHAP2_AERHH       QDLNAGFLLLQLLKQFGLGAGIGLGGGWLLWKLINSAKLAPGLYPLLTVSGGLLIFALTT
NHAP2_AERS4       QGLDWFFLLLQLGKQFGLGAGIGLGGGWLLWKLINSARLAPGLYPLLTVSGGLLIFALTT
                    .    .   :  : *:*   *: ** ::   :*   :. .**.:*.::**: :::   

NHAP2_ECOLI       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_SHIFL       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECO27       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECOK1       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECO8A       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECOHS       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_SHIDS       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECOUT       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECOLU       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECO7I       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_SHIB3       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECOBW       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_SHIBS       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECO5E       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECOL5       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_SHISS       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECO55       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECODH       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECO24       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECO45       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECO81       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_SHIF8       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECOL6       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECO57       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECOSM       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ECOLC       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_ESCF3       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVNPSDLLPIA
NHAP2_SALA4       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_SALHS       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_SALCH       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_SALDC       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_SALEP       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_SALPC       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_SALSV       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_SALTI       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_SALTY       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_SALPA       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_SALPK       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_SALPB       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_SALNS       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_SALG2       ALEGSGILAVYLCGFLLGNRPIRNRYGILQNFDGLAWLAQIAMFLVLGLLVTPSDLWPIA
NHAP2_KLEP3       TLDGSGILAVYLCGFLLGNRPIRNRHGILQNFDGLAWLAQIAMFLVLGLLVTPSDLLPIA
NHAP2_KLEP7       SLDGSGILAVYLCGFLLGNRPIRNRHGILQNFDGLAWLAQIAMFLVLGLLVTPSDLLPIA
NHAP2_ENT38       ALDGSGILAVYLCGFLLGNRPIRNRHAILQNFDGLAWLAQIGMFLVLGLLVTPSDLLPIA
NHAP2_CROS8       ALDGSGILAVYLCGFVLGNKPIRNRYGIQQTFDGLAWLAQIGMFLVLGLLVTPSHLLPIA
NHAP2_SODGM       ALEGSGILAVYLCGFVLGNRPIRNRYGILQTFDGMAWLSQICMFLALGLLVTPSDLWMIA
J3YSM7_9ENTR      ALEGSGILAVYLCGFVLGNRPIRNRYGILQTFDGMAWLSQICMFLVLGLLVTPSDLWMIA
NHAP2_YERPB       ALNGSGILAVYLCGLLLGNRPIRNRAGILQTFDGLAWLSQIGMFLVLGLLLNPSDLLPIA
NHAP2_YERP3       ALNGSGILAVYLCGLLLGNRPIRNRAGILQTFDGLAWLSQIGMFLVLGLLLNPSDLLPIA
NHAP2_YERPY       ALNGSGILAVYLCGLLLGNRPIRNRAGILQTFDGLAWLSQIGMFLVLGLLLNPSDLLPIA
NHAP2_YERPS       ALNGSGILAVYLCGLLLGNRPIRNRAGILQTFDGLAWLSQIGMFLVLGLLLNPSDLLPIA
NHAP2_YERE8       AMNGSGILAVYLCGLMLGNRPIRNRAGILQTFDGLAWLSQIGMFLVLGLLLNPSELLPIA
NHAP2_PSEU5       AIGGSGILAIYVCGLLLGNRPIRNRHGILHMFDGLAWLSQIGMFLVLGLLLTPSELLPIA
B3PIE8_CELJU      VIGGSGIITVYVCGLFLGNSPIRNRHGILHMFDGLAWLSQIGMFLVLGLLLTPSHLLPIA
NHAP2_PSEAE       AVGGSGILAIYLCGLLLGNRPIRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLWPIA
NHAP2_PSEAB       AVGGSGILAIYLCGLLLGNRPIRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLWPIA
NHAP2_PSEA7       AVGGSGILAIYLCGLLLGNRPIRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLWPIA
NHAP2_PSEE4       ALHGSGFLAVYLCGLVLGNKPIRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIA
NHAP2_PSEPW       ALHGSGFLAVYLCGLVLGNKPIRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIA
NHAP2_PSEP1       ALHGSGFLAVYLCGLVLGNKPIRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIA
NHAP2_PSEPK       ALHGSGFLAVYLCGLVLGNKPIRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIA
NHAP2_PSEPG       ALHGSGFLAVYLCGLVLGNKPIRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIA
NHAP2_PSEFS       ALHGSGFLAVYLCGLVIGNRPVRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIA
NHAP2_PSEF5       ALHGSGFLAVYLCGLVIGNRPVRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIA
NHAP2_PSEPF       ALHGSGFLAVYLCGLVIGNRPVRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIA
NHAP2_PSEU2       AIHGSGFLAVYLCGLVLGNRPIRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIA
NHAP2_PSESM       AIHGSGFLAVYLCGLVLGNRPIRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIA
NHAP2_PSE14       AIHGSGFLAVYLCGLVLGNRPIRSRHGILHMLDGMAWLAQIGMFLVLGLLVTPHDLLPIA
NHAP2_PSEMY       AVGGSGILAIYLCGLLLGNRPIRSRHGILHMLDGLTWLAQIGMFLVLGLLITPHELLPIA
NHAP2_VIBCH       ALGGSGILSIYLTGLLLGNRPTRSRHAILNVLDGMTWLAQIGMFLVLGLLVTPSELMEIA
NHAP2_VIBCM       ALGGSGILSIYLTGLLLGNRPTRSRHAILNVLDGMTWLAQIGMFLVLGLLVTPSELMEIA
NHAP2_VIBC3       ALGGSGILSIYLTGLLLGNRPTRSRHAILNVLDGMTWLAQIGMFLVLGLLVTPSELMEIA
F7YJE3_VIBA7      SLGGSGILSIYLTGLLLGNKPTRCRYSILNVLDGMTWLSQIGMFLVLGLLVTPSELLTIA
NHAP2_VIBPA       SLGGSGILSIYLVGLLLGNRPTRSRHSILHVLDGMTWLAQIGMFLVLGLLVTPSNLLSIA
B7VLQ7_VIBA3      MLGGSGILSIYLVGLFIGNRPTRSRHSILNVLDGMTWLSQIVMFLVLGLLVTPSTLMDIA
NHAP2_SHEB5       KLGGSGILSIYLVGLFLGNKPTRGRHAILNVLDGMTWVSQIGMFLVLGLLLTPSDLVDIL
NHAP2_SHEB8       KLGGSGILSIYLVGLFLGNKPTRGRHAILNVLDGMTWVSQIGMFLVLGLLLTPSDLVDIL
NHAP2_SHEB2       KLGGSGILSIYLVGLFLGNKPTRGRHAILNVLDGMTWVSQIGMFLVLGLLLTPSDLVDIL
NHAP2_SHEB9       KLGGSGILSIYLVGLFLGNKPTRGRHAILNVLDGMTWVSQIGMFLVLGLLLTPSDLVDIL
NHAP2_SHESM       KLGGSGILSIYLVGLFLGNKPTRGRHSILNVLDGMTWVSQIGMFLVLGLLLTPSDLLDIW
NHAP2_SHESR       KLGGSGILSIYLVGLFLGNKPTRGRHSILNVLDGMTWVSQIGMFLVLGLLLTPSDLLDIW
NHAP2_SHESA       KLGGSGILSIYLVGLFLGNKPTRGRHSILNVLDGMTWVSQIGMFLVLGLLLTPSDLLDIW
NHAP2_SHEON       KLGGSGILSIYLVGLFLGNKPTRGRHAILNVLDGMTWVSQIGMFLVLGLLLTPSDLLDIW
NHAP2_SHEPC       KLGGSGILSIYLVGLFLGNKPTRGRHSILNVLDGMTWVSQIGMFLVLGLLLTPSDLFDIL
NHAP2_SHESW       KLGGSGILSIYLVGLFLGNKPTRGRHSILNVLDGMTWVSQIGMFLVLGLLLTPSDLFDIL
NHAP2_SHESH       SLGGSGILSIYLLGLLLGNRAMQGRHTILSVLDGMTWLSQIGMFLVLGLLLTPSDLTEVA
A1S3I1_SHEAM      LAGGSGILSIYLYGLFLGNRGMRGKHSTLAVMDGLTWLAQIGMFLVLGLLLTPSSLLEVL
NHAP2_AERHH       AVGGSGILAIYLTGLLLGNLSLRSRSTTLSVLDGLTWLSQIGMFLVLGLLASPHKLLPIA
NHAP2_AERS4       AIGGSGILAIYLTGLLLGNLSLRSRSTTLSVLDGLTWLSQIGMFLVLGLLASPHKLLPIA
                     ***::::*: *:.:**   : :      :**::*::** ***.**** .*  *  : 

NHAP2_ECOLI       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SHIFL       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECO27       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECOK1       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECO8A       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECOHS       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SHIDS       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECOUT       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECOLU       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECO7I       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SHIB3       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECOBW       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SHIBS       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECO5E       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECOL5       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SHISS       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECO55       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECODH       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECO24       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECO45       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECO81       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SHIF8       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECOL6       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECO57       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECOSM       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ECOLC       IPALILSAWMIFFARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_ESCF3       IPALLLSAWMIFFARPLSVFAGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLD
NHAP2_SALA4       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SALHS       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SALCH       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SALDC       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SALEP       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SALPC       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SALSV       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SALTI       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SALTY       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SALPA       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SALPK       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SALPB       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SALNS       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_SALG2       VPALILSIWMIFFARPLSVFTGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLE
NHAP2_KLEP3       IPALLLSMWMIFIARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLD
NHAP2_KLEP7       IPALLLSMWMIFIARPLSVFAGLLPFRGFNLRERVFISWVGLRGAVPIILAVFPMMAGLD
NHAP2_ENT38       IPALLLSAWMIFFARPLSVFAGLLPFRGFNLRERIFISWVGLRGAVPIILAVFPMMAGLD
NHAP2_CROS8       IPALLLSLWMIFVARPLSIFTGLLPFRGFTLRERVFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_SODGM       IPALILSLWLMLVARPLSIFVGLLPFRNYTTRERVFLSWVGLRGAVPIILAVFPMMAGLD
J3YSM7_9ENTR      IPALILSLWLMLVARPLSIFVGLLPFRHYTTPERFVLSWIGLRGAVPIILAVFPMMAGLD
NHAP2_YERPB       IPALLLSLWMILFARPLSVFIGLLPFRSFNLRERVFISWVGLRGAVPVILAVFPMMAGLP
NHAP2_YERP3       IPALLLSLWMILFARPLSVFIGLLPFRSFNLRERVFISWVGLRGAVPVILAVFPMMAGLP
NHAP2_YERPY       IPALLLSLWMILFARPLSVFIGLLPFRSFNLRERVFISWVGLRGAVPVILAVFPMMAGLP
NHAP2_YERPS       IPALLLSLWMILFARPLSVFIGLLPFRSFNLRERVFISWVGLRGAVPVILAVFPMMAGLP
NHAP2_YERE8       IPALILSLWMILFARPLSVFIGLLPFPSFNLRERIFISWVGLRGAVPVILAVFPMMAGIP
NHAP2_PSEU5       IPALLLSLWMILFARPLAVFVSLLPFRSFHLRERLFISWIGLRGAVPVILAVFPLMAGLE
B3PIE8_CELJU      VPALLLSLWMILFARPLSIFIGLAPFRSFNLKERLFISWVGLRGAVPVILAVFPLMAGLE
NHAP2_PSEAE       LPALALALWMILVARPLSVLIGLIPFRAFHDREKAFIAWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSEAB       LPALALALWMILVARPLSVLIGLIPFRAFHDREKAFIAWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSEA7       LPALALALWMILVARPLSVLIGLIPFRAFHDREKAFIAWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSEE4       LPALGLALWMILFARPLSVVAALLPFKAFHGREKGFISWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSEPW       LPALGLALWMILIARPLSVVAALLPFKAFHGREKAFISWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSEP1       LPALGLALWMILVARPLSVVAALLPFKAFHGREKGFISWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSEPK       LPALGLALWMILVARPLSVVAALLPFKAFHGREKGFISWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSEPG       LPALGLALWMILVARPLSVVAALLPFKAFHGREKGFISWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSEFS       LPALGLALWMILFARPLSVMVGLLPFKAFHGREKAFIAWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSEF5       LPALGLALWMILFARPLSVLVGLAPFKAFHGREKAFISWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSEPF       LPALGLALWMILFARPLSVLVGLLPFKAFHGREKAFISWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSEU2       IPALGLALWMILVARPLSVMVGLLPFKAFHDREKAFIAWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSESM       IPALGLALWMILVARPLSVMVGLLPFKAFHGREKAFIAWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSE14       IPALGLALWMILVARPLSVMVGLLPFKAFHGREKAFIAWVGLRGAVPIILAVFPLMAGLP
NHAP2_PSEMY       LPALALALWMILFARPLSIFLGLLPFRAFHDRERIFIAWVGLRGAVPIILAVFPLMAGLP
NHAP2_VIBCH       LPGLALAVGMILFARPIAVWIGLAPFKSFTAREKWFVSWVGLRGAVPIILAVFPMMAGLP
NHAP2_VIBCM       LPGLALAVGMILFARPIAVWIGLAPFKSFTAREKWFVSWVGLRGAVPIILAVFPMMAGLP
NHAP2_VIBC3       LPGLALAVGMILFARPIAVWIGLAPFKSFTAREKWFVSWVGLRGAVPIILAVFPMMAGLP
F7YJE3_VIBA7      VPGFALAFGMILFARPISVWIGLLPFKAFTAREKWFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_VIBPA       VPGLALAFGMILFARPISVWIGLLPFKSFTPREKWFVSWVGLRGAVPIILAVFPMMAGLP
B7VLQ7_VIBA3      LPALALAFGMILFARPLSVWLGLLPFRSFTTKERWFVSWVGLRGAVPIILAVFPMMAGLP
NHAP2_SHEB5       IPGFALAFGMILFARPVAVWISLLPFKSFSSRDRWFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_SHEB8       IPGFALAFGMILFARPVAVWISLLPFKSFSSRDRWFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_SHEB2       IPGFALAFGMILFARPVAVWISLLPFKSFSSRDRWFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_SHEB9       IPGFALAFGMILFARPVAVWISLLPFKSFSSRDRWFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_SHESM       LPGLALAFGMILFARPLAVWLSLLPFKSFSSRDRWFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_SHESR       LPGLALAFGMILFARPLAVWLSLLPFKSFSSRDRWFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_SHESA       LPGLALAFGMILFARPLAVWLSLLPFKSFSSRDRWFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_SHEON       LPGLALAFGMILFARPLAVWLSLLPFKSFGSRDRWFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_SHEPC       LPGFALAFGMILFARPLAVWLSLLPFKSFSSRDRWFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_SHESW       LPGFALAFGMILFARPLAVWLSLLPFKSFSSRDRWFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_SHESH       IPALALAFGMILFARPISVWLSLLPFKSFSSRDRWFISWVGLRGAVPIILAVFPMMAGLP
A1S3I1_SHEAM      LPGLVLALGMIFIARPLAVWISLAPFKRFVARERWFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_AERHH       LPALALAMWMILFARPISVWIGLLPFKNFAPRERWFISWVGLRGAVPIILAVFPMMAGLP
NHAP2_AERS4       LPALALAAWMILFARPVSVWIGLLPFKNFAPRERWFISWVGLRGAVPIILAVFPMMAGLP
                  :*.: *:  :::.***:::  .* **  :   :: .::*:*******:******:***: 

NHAP2_ECOLI       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_SHIFL       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENLWEQFVY
NHAP2_ECO27       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECOK1       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECO8A       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECOHS       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_SHIDS       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECOUT       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECOLU       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECO7I       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_SHIB3       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECOBW       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_SHIBS       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECO5E       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECOL5       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_SHISS       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECO55       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECODH       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECO24       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECO45       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECO81       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_SHIF8       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECOL6       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECO57       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECOSM       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ECOLC       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPVGRPVSRVGLDIHPENPWEQFVY
NHAP2_ESCF3       NSRLFFNVAFFVVLISLLFQGTSLSWAAKKAKVVVPAVGWPVSRVGLDIHPENPWEQFVY
NHAP2_SALA4       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_SALHS       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_SALCH       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_SALDC       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_SALEP       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_SALPC       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_SALSV       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_SALTI       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_SALTY       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_SALPA       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_SALPK       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_SALPB       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_SALNS       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_SALG2       NARLFFNVAFFVVLVSLLLQGTSLSWAAKRAKVVVPPVGWPVSRVGLDIHPDNPWEQFIY
NHAP2_KLEP3       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPISWPISRVGLDIHPENPWEQFVY
NHAP2_KLEP7       NARLFFNVAFFVVLVSLLLQGTSLSWAAKKAKVVVPPISWPISRVGLDIHPENPWEQFVY
NHAP2_ENT38       NARLFFNVAFFVVLVSLLFQGTSLGWAAKKAKVVVPPVGLPVSRVGLDIHPENPWEQFVY
NHAP2_CROS8       RANLFFDVAFFVVLVSLLFQGTTLGWAAKKAKVVVPEVGRPQSRVGLDIHPENPWEQFVY
NHAP2_SODGM       NAHMYFNVAFFIVLISLLLQGTSLGFAARLAKVVVPPTASPISRVGMDIHPENPWEQFIY
J3YSM7_9ENTR      NAPLYFNVAFFIVLISLLLQGTSLGFAARLAKVVVPPTTSPISRVGMDIHPENPWEQFIY
NHAP2_YERPB       NANLFFNVAFFVVLVSLLLQGTTLSFAARKAKLVVPPTLAPVSRIGLDIDMNNQWEQFIY
NHAP2_YERP3       NANLFFNVAFFVVLVSLLLQGTTLSFAARKAKLVVPPTLAPVSRIGLDIDMNNQWEQFIY
NHAP2_YERPY       NANLFFNVAFFVVLVSLLLQGTTLSFAARKAKLVVPPTLAPVSRIGLDIDMNNQWEQFIY
NHAP2_YERPS       NANLFFNVAFFVVLVSLLLQGTTLSFAARKAKLVVPPTLAPVSRIGLDIDMNNQWEQFIY
NHAP2_YERE8       HANLFFNVAFFVVLVSLLLQGTSLSFAARKTKLVVPPALAPVARIGLDIDKNNQWEQFIY
NHAP2_PSEU5       NAQLFFNVAFFIVLVSLLLQGSTLAWAAKKAKVEVPPSPMPVSRTGLQVHTTSQWEMFVY
B3PIE8_CELJU      HAQLFFNVAFFIVLVSLLLQGTTLGFAAKLAHVEVPSVPSPYSRAGLEINVASQWELFIY
NHAP2_PSEAE       NAQLFFNVAFFIVLVSLLVQGTSLPWAARLLRVVVPPDPAPISRAGLEIHPTSEWELFVY
NHAP2_PSEAB       NAQLFFNVAFFIVLVSLLVQGTSLPWAARLLRVVVPPDPAPISRAGLEIHPTSEWELFVY
NHAP2_PSEA7       NAQLFFNVAFFIVLVSLLVQGTSLPWAAKLLRVVVPPDPAPISRAGLEIHPTSEWELFVY
NHAP2_PSEE4       DAQLFFNLAFFIVLVSLLVQGTSLPWMAKLLKVTVPPDPAPISRSALEVHVTSEWELFVY
NHAP2_PSEPW       DAQLFFNLAFFIVLVSLLVQGTSLPWMAKLLKVTVPPDPAPISRSALEVHITSEWELFVY
NHAP2_PSEP1       DAQLFFNLAFFIVLVSLLVQGTSLPWVAKLLKVTVPPDPAPISRSALEVHITSEWEMFVY
NHAP2_PSEPK       DAQLFFNLAFFIVLVSLLVQGTSLPWVAKLLKVTVPPDPAPISRSALEVHITSEWEMFVY
NHAP2_PSEPG       DAQLFFNLAFFIVLVSLLVQGTSLPWMAKLLKVTVPPDPAPISRSALEVHVTSEWELFVY
NHAP2_PSEFS       HAQLYFNLAFFIVLVSLLVQGTSLPWVAKLLKVTVPPDPAPISRAALEVHVTSEWELFVY
NHAP2_PSEF5       NAQLYFNLAFFIVLISLLVQGTSLPWVAKWLKVTVPPEPAPISRAALEVHVTSEWELFVY
NHAP2_PSEPF       NAQLYFNLAFFIVLVSLLVQGTSLPWVAKLLKVTVPPEPAPISRAALEVHVTSEWELFVY
NHAP2_PSEU2       NAQLYFNLAFFIVLVSLLLQGTSLPWMAKLLKVTVPPDPAPISRAALEVHVTSEWELFVY
NHAP2_PSESM       NAQLYFNLAFFIVLVSLLLQGTSLPWMAKLLKVTVPPDPAPISRAALEVHVTSEWELFVY
NHAP2_PSE14       NAQLYFNLAFFIVLVSLLLQGTSLPWVAKLLKVTVPPDPAPISRAALEVHVTSEWELFVY
NHAP2_PSEMY       NAQLFFNVAFFIVIVSLLLQGTSLPLAAKLMRVTVPPEPAPVSRAGLEVHPTSQWELFVY
NHAP2_VIBCH       NAQLYFNLAFFVVMVSLVVQGGTLTKAMSLAKVELPPKPEPISRTGVEIYPTSEWELFIY
NHAP2_VIBCM       NAQLYFNLAFFVVMVSLVVQGGTLTKAMSLAKVELPPKPEPISRTGVEIYPTSEWELFIY
NHAP2_VIBC3       NAQLYFNLAFFVVMVSLVVQGGTLTKAMSLAKVELPPKPEPISRTGVEIYPTSEWELFIY
F7YJE3_VIBA7      NAQLYFNLAFFVVMVSLVVQGGTLMKAAALARVELPPKPEPISRTGVEIYPCSEWEMLVY
NHAP2_VIBPA       DAQLYFNLAFFVVMVSLIVQGGTLTKAMSLAKVELPPKPEPISRTGVEIYPTSEWELFIY
B7VLQ7_VIBA3      NAQLYFNIAFFVVMVSLIVQGGSLMKVARLAQVTLPPTPTPISRTGMEIYPTSEWEMFVY
NHAP2_SHEB5       GAQLYFNLAFFVVLVSLLVQGASLTTAARLAKVELPPKPLPVSRSGVEIYPSSEWEVFVY
NHAP2_SHEB8       GAQLYFNLAFFVVLVSLLVQGASLTTAARLAKVELPPKPLPVSRSGVEIYPSSEWEVFVY
NHAP2_SHEB2       GAQLYFNLAFFVVLVSLLVQGASLTTAARLAKVELPPKPLPVSRSGVEIYPSSEWEVFVY
NHAP2_SHEB9       GAQLYFNLAFFVVLVSLLVQGASLTTAARLAKVELPPKPLPVSRSGVEIYPSSEWEVFVY
NHAP2_SHESM       GAQLYFNLAFFVVLVSLLVQGASLTTAARLAKVELPPKPLPISRSGVEIYPSSEWEVFVY
NHAP2_SHESR       GAQLYFNLAFFVVLVSLLVQGASLTTAARLAKVELPPKPLPISRSGVEIYPSSEWEVFVY
NHAP2_SHESA       GAQLYFNLAFFVVLVSLLVQGASLTTAARLAKVELPPKPLPISRSGVEIYPSSEWEVFVY
NHAP2_SHEON       GAQLYFNLAFFVVIVSLLVQGASLTTAARLAKVELPPKPLPISRSGVEIYPKSEWEVFVY
NHAP2_SHEPC       GAQLYFNLAFFVVLVSLLIQGASLTTAARLAKVELPPKPLPISRSGVEIYPSSEWEVFVY
NHAP2_SHESW       GAQLYFNLAFFVVLVSLLIQGASLTTAARLAKVELPPKPLPISRSGVEIYPSSEWEVFVY
NHAP2_SHESH       NAQLYFNVAFFVVLVSLLVQGCSLGRAARLAKVELPTKPSPISRSGVAIYPKSDWELFVY
A1S3I1_SHEAM      NAELYFNLAFCVVLVSLLLQGSTLPLAMKLARVGLPPKPEPISRAGVDIFPASEWEIFVY
NHAP2_AERHH       NAQLYFNVAFFVVLVSLILQGSSLPLASRLARVEVPAPPSPINRSGLEIDLDSQWETFVY
NHAP2_AERS4       NAQLYFNVAFFVVLVSLILQGSSLPLASKLARVEVPAPPSPINRSGLEIDLDSQWETFVY
                   : ::*::** :*::**:.** :*       :: :*    *  * .: :   . ** ::*

NHAP2_ECOLI       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_SHIFL       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECO27       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECOK1       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECO8A       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECOHS       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_SHIDS       QLSADKWCVSAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECOUT       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECOLU       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECO7I       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_SHIB3       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECOBW       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_SHIBS       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECO5E       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECOL5       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_SHISS       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECO55       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECODH       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECO24       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECO45       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECO81       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_SHIF8       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECOL6       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECO57       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECOSM       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ECOLC       QLSADKWCVGAALRDLHMPKETRIAALFRDNQLLHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_ESCF3       QLSADKWCVGAALRDLHMPKDTRIAALFRDNVLLHPSGSTRLREGDVLCVIGRERDLPAL
NHAP2_SALA4       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_SALHS       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_SALCH       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_SALDC       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_SALEP       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_SALPC       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_SALSV       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_SALTI       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_SALTY       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_SALPA       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_SALPK       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_SALPB       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_SALNS       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_SALG2       QLSADKWCVGAALRDLHMPNETRIAALFRNNELFHPTGSTRLQEGDVLCVIGRERDLPAL
NHAP2_KLEP3       QLGADKWCIGAALRDLHMPPETRIAALFRNNALLHPTGSTRLREGDILCVIGREHDLPAL
NHAP2_KLEP7       QLGADKWCIGAALRDLHMPPETRIAALFRNNVLLHPTGSTRLREGDILCVIGREHDLPAL
NHAP2_ENT38       QLSADKWCVGASLRDLHMPTETRIAALFRDNALLHPTGSTRLREGDILCVIGRETDLPAL
NHAP2_CROS8       QLSADKWCVGAALRDLHMPKETRIAALFRENQLMHPTGSTRLREGDVLCVIGRERDLPAL
NHAP2_SODGM       QLGEENWCVGAALRDLKMPRHTRIAALFRDNVLLHPTANTRLREGDVLCVIGRERDLPAL
J3YSM7_9ENTR      QLGNENWCVGAALRDLTMPRHTRIAALFRDNILLHLTANIRLREGDVLCVIGRERDLPAL
NHAP2_YERPB       QLSCDKWCIGATLRDLKMPQGTRIAALFRGKDLLHPTGSTRLKEGDILCVIGQEHDLPAL
NHAP2_YERP3       QLSCDKWCIGATLRDLKMPQGTRIAALFRGKDLLHPTGSTRLKEGDILCVIGQEHDLPAL
NHAP2_YERPY       QLSCDKWCIGATLRDLKMPQGTRIAALFRGKDLLHPTGSTRLKEGDILCVIGQEHDLPAL
NHAP2_YERPS       QLSCDKWCIGATLRDLKMPQGTRIAALFRGKDLLHPTGSTRLKEGDILCVIGQEHDLPAL
NHAP2_YERE8       QLSSDKWCIGAALRDLKMPQETRIAALFRGKDLLHPNGNTRLKEGDILCVIGQEHHLPAL
NHAP2_PSEU5       RLSASKWCVGAALRELKMPPGTRIAALFRGKELLHPSGSTRLQVDDILCVIGHDEDLPAL
B3PIE8_CELJU      KLGAEKWCINAALRELHMPENTRIAALFRGKELLHPTGSTRLMAGDILCVIGHEEDLSEL
NHAP2_PSEAE       HLNKEKWCIGAALRELKMPGGTRIAALFRGTELLHPSGSTILEADDILCVIGHEHDLPAL
NHAP2_PSEAB       HLNKEKWCIGAALRELKMPGGTRIAALFRGTELLHPSGSTILEADDILCVIGHEHDLPAL
NHAP2_PSEA7       HLNKEKWCIGAALRELKMPEGTRIAALFRGTQLLHPSGSTILEADDILCVIGHEHDLPAL
NHAP2_PSEE4       RLGAEKWCIGAALRELKMPEGTRIAALFRKEQLLHPSGSTVLEVGDMLCVIGHEHNLPAL
NHAP2_PSEPW       RLGAEKWCIGAALRELKMPEGTRIAALFRGEQLLHPSGSTVLEVGDMLCVIGHEHNLPAL
NHAP2_PSEP1       RLGAEKWCIGAALRELKMPEGTRIAALFRGEQLLHPSGSTVLEVGDMLCVIGHEHNLPAL
NHAP2_PSEPK       RLGAEKWCIGAALRELKMPEGTRIAALFRGEQLLHPSGSTVLEVGDMLCVIGHEHNLPAL
NHAP2_PSEPG       RLGAEKWCIGAALRELKMPEGTRIAALFRNEQLLHPSGSTVLEVGDMLCVIGHEHNLPAL
NHAP2_PSEFS       RLGAEKWCIGAALRELKMPEGTRIAALFRGQQLLHPSGSTVLEVGDLLCVIGHEHNLPAL
NHAP2_PSEF5       RLGAEKWCIGAALRELKMPEGTRIAALFRGQQLLHPSGSTVLEADDLLCVIGHEHNLPAL
NHAP2_PSEPF       KLGAEKWCIGSPLRELKMPEGTRIAALFRGQQLLHPSGSTVLEVDDLLCVIGHEHNLPAL
NHAP2_PSEU2       RLGAEKWCIGAALRELKMPEGTRIAALFRGQQLLHPSGSTTLEVGDLLCVIGHEHDLPAL
NHAP2_PSESM       RLGAEKWCIGAALRELKMPEGTRIAALFRGQQLLHPSGSTTLEVGDLLCVIGHEHDLPAL
NHAP2_PSE14       RLGAEKWCIGAALRELKMPEGTRIAALFRGQQLLHPSGSTTLEVGDLLCVIGHEHDLPAL
NHAP2_PSEMY       RLGAEKWCIGAALRELNMPEGTRIAALFRGRELLHPSGSTRLEAGDLLCVIGHEHDLPAL
NHAP2_VIBCH       KLKADKWCIGEPLRNLFMPEGTRIAAVFRDNQLLHPSGSTELCEGDTLCVMAQERDLESL
NHAP2_VIBCM       KLKADKWCIGEPLRNLFMPEGTRIAAVFRDNQLLHPSGSTELCEGDTLCVMAQERDLESL
NHAP2_VIBC3       KLKADKWCIGEPLRNLFMPEGTRIAAVFRDNQLLHPSGSTELCEGDTLCVMAQERDLESL
F7YJE3_VIBA7      KLKQDKWCIGEPLRNLSMPEGTRITAVFRDEQLLHPSGSTKLQEGDVLCVLAQEKDLESL
NHAP2_VIBPA       RLKADKWCIGEPLRSLSMPEGTRIAAVFRNQELLHPSGSTRLEEDDTLCVLAQEKDLAAL
B7VLQ7_VIBA3      KLKEEKWCVGEPLKRLSMPEGTRITALFRKDALLHPSGSTVLEANDILCVLGQDKDLDSL
NHAP2_SHEB5       RLSESKWCIGEPLKRLAMPDGTRIAAVFRNDTLLHPSGSTRLEAGDILCVLGQEKSLEAL
NHAP2_SHEB8       RLSESKWCIGEPLKRLAMPDGTRIAAVFRNDTLLHPSGSTRLEAGDILCVLGQEKSLEAL
NHAP2_SHEB2       RLSESKWCIGEPLKRLAMPDGTRIAAVFRNDTLLHPSGSTRLEAGDILCVLGQEKSLEAL
NHAP2_SHEB9       RLSESKWCIGEPLKRLAMPDGTRIAAVFRDDTLLHPSGSTRLEAGDILCVLGQEKSLEAL
NHAP2_SHESM       RLSENKWCIGEPLKRLSMPDGTRIAAVFRHNTLLHPSGSTCLEAGDILCVLGQEKSLEAL
NHAP2_SHESR       RLSENKWCIGEPLKRLSMPDGTRIAAVFRHNTLLHPSGSTCLEAGDILCVLGQEKSLEAL
NHAP2_SHESA       HLSENKWCIGEPLKRLSMPDGTRIAAVFRHNTLLHPSGSTCLEAGDILCVLGQEKSLEAL
NHAP2_SHEON       CLSESKWCIGEPLKRLAMPDGTRIAAVFRNNTLLHPSGSTCLEAGDILCVLGQEKSLEAL
NHAP2_SHEPC       CLSENKWCVGEPLKRLSMPDGTRIAAVFRGDKLLHPSGSTCLEAGDILCVLGQERSLDAL
NHAP2_SHESW       CLSENKWCVGEPLKRLSMPDGTRIAAVFRGDKLLHPSGSTCLEAGDILCVLGQERSLDAL
NHAP2_SHESH       HLSEHKWCVGEPIRRLNMPAGTHIAALYRGKDMLHPSGSTKLQTGDILCVLGHEKDLDAL
A1S3I1_SHEAM      RLKPNKWCVGEPLRRLSMPEGTRIAALFREHNLLHPSGSTELAADDVLCVLGQAKDLPAL
NHAP2_AERHH       RLSDEKWCIGSPLRDLRMPKGTRICALFRDQELLHPSGSTCLQSDDILCVIGHERDLPAL
NHAP2_AERS4       RLSAEKWCIGSPLRDLRMPKGTRICALFRDQELLHPSGSTCLQSNDILCVIGHERDLPAL
                   *   :**:. .:: * **  *:* *::*   ::* ...  *  .* ***:.:   *  *

NHAP2_ECOLI       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_SHIFL       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECO27       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECOK1       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECO8A       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECOHS       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_SHIDS       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECOUT       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECOLU       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECO7I       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_SHIB3       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECOBW       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_SHIBS       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGT
NHAP2_ECO5E       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECOL5       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_SHISS       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECO55       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECODH       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECO24       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECO45       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECO81       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_SHIF8       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECOL6       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECO57       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECOSM       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ECOLC       GKLFSQSPPVALDQRFFGDFILEASAKYADVALIYGLEDGREYRDKQQTLGEIVQQLLGA
NHAP2_ESCF3       GKLFSQSPPVALDQRFFGDFILEGSAKFADVAIIYGLDAGTEYRDKQQTLGEIVQQLLGA
NHAP2_SALA4       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_SALHS       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_SALCH       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_SALDC       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_SALEP       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_SALPC       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_SALSV       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_SALTI       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_SALTY       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_SALPA       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_SALPK       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_SALPB       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_SALNS       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_SALG2       GKLFSQSPPVSLDQRFFGDFILEANAKFADVALIYGLEEGTEYRDKQQTLGEIIQQLLGA
NHAP2_KLEP3       GKMFSQSPPVALDQRFFGDFILDAEARFADVAQIYGLDGGEEFREHQQSLGEVVQQLLGA
NHAP2_KLEP7       GKMFSQSPPVALDQRFFGDFILDAEARFADVAQIYGLDGGEEFREHQQSLGEVVQQLLGA
NHAP2_ENT38       GKLFSQSPPVALDQRFFGDFILEASAKFADVALIYGLDEGLEYRDKQQTLGEIVQQLLGA
NHAP2_CROS8       GKLFSQSPPVALDQRFFGDFILEADAKFSDVAFIYGLDD-QSAVDQNRTIGEVVLALIGA
NHAP2_SODGM       GRLFSQSPPVALDQRFFGDFILEASANLRDVSSIYGLEFAGEV-DGELTLGQFVMALLGG
J3YSM7_9ENTR      GRLFSQSPTIALDQRFFGDFILEAHARLCDVSSIYGLQFAEEV-DNELNLGQFVMALLGG
NHAP2_YERPB       GKLFSQSPNIQLDERFFGDFILDADAKLQDISQIYGLNLEPTV-DKQQTLGQFVLYLFGG
NHAP2_YERP3       GKLFSQSPNIQLDERFFGDFILDADAKLQDISQIYGLNLEPTV-DKQQTLGQFVLYLFGG
NHAP2_YERPY       GKLFSQSPNIQLDERFFGDFILDADAKLQDISQIYGLNLEPTV-DKQQTLGQFVLYLFGG
NHAP2_YERPS       GKLFSQSPNIQLDERFFGDFILDADAKLQDISQIYGLNLEPTV-DKQQTLGQFVLYLFGG
NHAP2_YERE8       GKLFSQSPSIQLDERFFGDFILDADAKLDDISQIYGLNLEQGV-DKQQTLGQFVLYLFGG
NHAP2_PSEU5       GKLFSQAPTRGQDLRFFGDFILEGDARLSDIAALYGLKLGEVD--GNQTIGAFMAEQVSG
B3PIE8_CELJU      GRLFSEAPKRNMDLSFFGDFIIQGEAELADLAMLYALEMKGYE--EYKTIGELVTHLVGG
NHAP2_PSEAE       GKLFSQAPDRGLGARFFGDFVLEGDAQLSAVASLYGLKLDGID--GEQALGRFIAHEIGG
NHAP2_PSEAB       GKLFSQAPDRGLGARFFGDFVLEGDAQLSAVASLYGLKLDGID--GEQALGRFIAHEIGG
NHAP2_PSEA7       GKLFSQAPDRGLGARFFGDFVLEGDAQLSAVASLYGLKLDGVD--GEQPLGRFIAHEIGG
NHAP2_PSEE4       GKLFSQAPQRGLDLRFFGDFVLEGDAELGAVAALYGLKLDGLD--AKMPLAQFIRQKVGG
NHAP2_PSEPW       GKLFSQAPQRGLDLRFFGDFVLEGDAELGAVAALYGLKLDGLD--AKMPLAQFIRQKVGG
NHAP2_PSEP1       GKLFSQAPQRGLDLRFFGDFVLEGDAELGAVAALYGLKLDGLD--AKMPLAQFIRQKVGG
NHAP2_PSEPK       GKLFSQAPQRGLDLRFFGDFVLEGDAELGAVAALYGLKLDGLD--AKMPLAQFIRQKVGG
NHAP2_PSEPG       GKLFSQAPQRGLDLRFFGDFVLEGDAELGAVAALYGLKLDGLD--AKMPLAQFIRQKVGG
NHAP2_PSEFS       GKLFSQAPQRGLDLRFFGDFVLEGDAQLGAVSALYGLKLEGID--PDMPLSRFITQKVGG
NHAP2_PSEF5       GKLFSQAPERGLDLRFFGDFVLEGDAQLGAVSALYGLKLDGQD--ADMPLGAFIAQKVGG
NHAP2_PSEPF       GKLFSQAPQRGLDLRFFGDFVLEGDAQLKAVAALYGLPAEGID--PDMTLGHFIAQKVGG
NHAP2_PSEU2       GKLFSQAPQRGLDLRFFGDFVLEGDARLGEVAALYGLKLDGID--PGMPLSQFIVQKNRG
NHAP2_PSESM       GKLFSQAPQRGLDLRFFGDFVLEGDARLGEVAALYGLKLDGID--PGMPLSQFIVQKNRG
NHAP2_PSE14       GKLFSQAPQRGLDLRFFGDFVLEGDARLGEVAALYGLKLDGID--PGMPLSQFIVQKNRG
NHAP2_PSEMY       GKLFSQAPKRGQDLRFFGDFVLEGDAELAAVAALYGLKLDGLD--GHQPLGRFIAHEIGG
NHAP2_VIBCH       SRLFSEAPEKASLARFFGDFFLDIEAKLQDVALLYGLDLG--ELEADAKLKDLVLEHLGE
NHAP2_VIBCM       SRLFSEAPEKASLARFFGDFFLDIEAKLQDVALLYGLDLG--ELEADAKLKDLVLEHLGE
NHAP2_VIBC3       SRLFSEAPEKASLARFFGDFFLDIEAKLQDVALLYGLDLG--ELEADAKLKDLVLEHLGE
F7YJE3_VIBA7      SNLFSEAPEKASLERFFGDFFLDVDAKLVDVAAYYGLTIE--HLNQEMTLNDLLIQELGA
NHAP2_VIBPA       SLLFSEAPEKASLTRFFGDFFLDIEVKLADVAMMYGLNLG--YELQDKTLSNIVEEQLGS
B7VLQ7_VIBA3      SALFSEAPLAEEAARFFGDFFLDVELSIAAVSDCYGIELGS-EEEREMTLKQLAERELGA
NHAP2_SHEB5       SNLFSQAPENKEVQRFFGDFFIETDVKLADLAPIYGLSLD--NLADDMTVADLVVSQLGA
NHAP2_SHEB8       SNLFSQAPENKEVQRFFGDFFIETDVKLADLAPIYGLSLD--NLADDMTVADLVVSQLGA
NHAP2_SHEB2       SNLFSQAPENKEVQRFFGDFFIETDVKLADLAPIYGLSLD--NLADDMTVADLVVSQLGA
NHAP2_SHEB9       SNLFSQAPENKEVQRFFGDFFIETDVKLADLAPIYGLSLD--NLADDMTVADLVVLQLGA
NHAP2_SHESM       SNLFSQAPETKEVPRFFGDFFIDTEVKLLDLAPIYGLELD--EATGDMTVADLVAAELGS
NHAP2_SHESR       SNLFSQAPETKEVPRFFGDFFIDTEVKLLDLAPIYGLELD--EATGDMTVADLVAAELGS
NHAP2_SHESA       SNLFSQAPETKEVPRFFGDFFIDTEVKLLDLAPIYGLELD--EATGDMTVADLVAAELGS
NHAP2_SHEON       SNLFSQAPETDEVSRFFGDFFIDTEVKLADLAPIYGLTLD--DETGAMTVADLVALELGA
NHAP2_SHEPC       SHLFSQAPETKEVPRFFGDFFIETDVKLADLAPIYGLDLD--EEASEMTVADLVASELGA
NHAP2_SHESW       SHLFSQAPETKEVPRFFGDFFIETDVKLADLAPIYGLDLD--EEASEMTVADLVASELGA
NHAP2_SHESH       GTLFSEAPMQEELPRFFGDFFLDVDIQLASLAPIYGLELD--DEAQYLSVGELLVKHLGD
A1S3I1_SHEAM      SQLFSEAPENPAMAGFFGDFMLATSVRLADLAPLYGFGLH--EDEVGLTLEDLMHQKLGR
NHAP2_AERHH       GQLFSQAPEQDLGPRFFGDFLLEAAANLVDLAPLYGLDVS---EVADQTLGHFIAHQLGD
NHAP2_AERS4       GQLFSQAPEQDLGPRFFGDFLLEAAANMVDLAPLYGLDVS---EVADQTLGDFLADQLGD
                  . :**::*       *****.:        ::  *.:            :  .       

NHAP2_ECOLI       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_SHIFL       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECO27       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECOK1       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECO8A       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECOHS       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_SHIDS       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECOUT       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECOLU       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECO7I       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_SHIB3       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECOBW       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_SHIBS       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECO5E       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECOL5       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_SHISS       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECO55       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECODH       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECO24       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECO45       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECO81       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_SHIF8       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECOL6       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECO57       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECOSM       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ECOLC       A-PVVGDQVEFAGMIWTVAEKEDNEVLKIGVRVAEEEAES-----
NHAP2_ESCF3       A-PVVGDQVEFAGMIWTVAEKEDNQVMKVGVRVADEIAE------
NHAP2_SALA4       A-PVVGDQVEFGGMIWTVAEKEDNVVRKIGVRVAEDEAE------
NHAP2_SALHS       A-PVVGDQVEFGGMIWTVAEKEDSVVHKIGVRVAEDEAE------
NHAP2_SALCH       A-PVVGDQVEFGGMIWTVAEKEDNVVRKIGVRVAEDEAE------
NHAP2_SALDC       A-PVVGDQVEFGGMIWTVAEKEDNVVRKIGVRVAEDEAE------
NHAP2_SALEP       A-PVVGDQVEFGGMIWTVAEKEDNVVRKIGVRVAEDEAE------
NHAP2_SALPC       A-PVVGDQVEFGGMIWTVAEKEDNVVRKIGVRVAEDEAE------
NHAP2_SALSV       A-PVVGDQVEFGGMIWTVAEKEDNVVRKIGVRVAEDEAE------
NHAP2_SALTI       A-PVVGDQVEFGGMIWTVAEKEDNVVRKIGVRVAEDEAE------
NHAP2_SALTY       A-PVVGDQVEFGGMIWTVAEKEDNVVRKIGVRVAEDEAE------
NHAP2_SALPA       A-PVVGDQVEFGGMIWTVAEKEDNVVRKIGVRVAEDEAE------
NHAP2_SALPK       A-PVVGDQVEFGGMIWTVAEKEDNVVRKIGVRVAEDEAE------
NHAP2_SALPB       A-PVVGDQVEFGGMIWTVAEKEDNVVRKIGVRVAEDEAE------
NHAP2_SALNS       A-PVVGDQVEFGGMIWTVAEKEDNVVRKIGVRVAEDEAE------
NHAP2_SALG2       A-PVVGDQVEFGGMIWTVAEKEDNVVRKIGVRVAEDEAE------
NHAP2_KLEP3       A-PVVGDQVEFAGMVWTVAEKENDHVLKVGVRVAEDEAE------
NHAP2_KLEP7       A-PVVGDQVEFAGMVWTVAEKENDHVLKVGVRVAEDEAE------
NHAP2_ENT38       A-PVVGDQVEFAGMIWTVAEKEDNAVRKVGVRPTEDEPE------
NHAP2_CROS8       A-PVVGDQVDFAGMTWTVAEKENNQIRRIGLKVAEDSDE------
NHAP2_SODGM       GEPVVGDNVVAEGVVWTIAEKDEQKVSKIGIKIADDPA-------
J3YSM7_9ENTR      GEPVVGDNVIAEGVVWTIAEKEEHKVSKIGIKIANDTS-------
NHAP2_YERPB       E-PVIGDQIEWDGLTWTIAEMESDRVSRVGVKIVTDKA-------
NHAP2_YERP3       E-PVIGDQIEWDGLTWTIAEMESDRVSRVGVKIVTDKA-------
NHAP2_YERPY       E-PVIGDQIEWDGLTWTIAEMESDRVSRVGVKIVTDKA-------
NHAP2_YERPS       E-PVIGDQIEWDGLTWTIAEMESDRVSRVGVKIVTDKA-------
NHAP2_YERE8       E-PVIGDQIEWDGLTWTIAEMESDRVSRVGVKIVTDKA-------
NHAP2_PSEU5       N-PVVGDQVEWNGLTWTVAAMETGEVRKVGLKFPEGDKPGPQLMF
B3PIE8_CELJU      K-PVVGDHAEWSNISWTIAEVEGNHVRKIGVR-PLAKPSGKD---
NHAP2_PSEAE       E-AVIGDQVEWNGLTWTVAALEGNRIRKVGVKFPEG-RPGPGLFL
NHAP2_PSEAB       E-AVIGDQVEWNGLTWTVAALEGNRIRKVGVKFPEG-RPGPGLFL
NHAP2_PSEA7       E-AVIGDQVEWNGLTWTVAALEGNRIRKVGVKFPEG-RAGPGLFL
NHAP2_PSEE4       A-PVVGDQIEWHGTIWTVAVMDGNKIQKVGVRFPEGTRPGPGLFL
NHAP2_PSEPW       A-PVVGDQVEWHGTIWTVATMDGNKIQKVGVRFPEGTRPGPGLFL
NHAP2_PSEP1       A-PVVGDQVEWHGTIWTVATMDGNKIQKVGVRFPEGTRPGPGLFL
NHAP2_PSEPK       A-PVVGDQVEWHGTIWTVATMDGNKIQKVGVRFPEGTRPGPGLFL
NHAP2_PSEPG       A-PVVGDQVEWHGTIWTVATMDGNKIQKVGVRFPEGTRPGPGLFL
NHAP2_PSEFS       A-PVVGDQVEWNNTIWTVAVMDGNKIGKVGVRFPEGSRPGPGLFL
NHAP2_PSEF5       A-PVVGDQVEWNNTIWTVAVMDGNKIGKVGVRFPEGSRPGPGLFL
NHAP2_PSEPF       A-PIVGDQVEWNNTHWTVAVMDGNKIGKVGVRFPEGSRPGPGLFL
NHAP2_PSEU2       E-PVVGDQVEWNGTIWTVAVMDGNKIQKVGVKFPEGTRPGPGLFL
NHAP2_PSESM       E-PVVGDQIEWNGTIWTVAVMDGNKIQKVGVKFPEGTRPGPGLFL
NHAP2_PSE14       E-PVVGDQIEWNGTIWTVAVMDGNKIQKVGVKFPEGTRPGPGLFL
NHAP2_PSEMY       E-PVVGDQVEWQGLTWTVASMEGNKVRKVGVRFPEGSRPGPGLFL
NHAP2_VIBCH       T-PVLGDYFEWHGLQWVVADVVDWKVTKIGLRLPPEEELQEGAE-
NHAP2_VIBCM       T-PVLGDYFEWHGLQWVVADVVDWKVTKIGLRLPPEEELQEGAE-
NHAP2_VIBC3       T-PVLGDYFEWHGLQWVVADVVDWKVTKIGLRLPPEEELQEGAE-
F7YJE3_VIBA7      T-QVLGDHFEWQGLYLVVADVADWQATKVGLRLPLEETLDEASE-
NHAP2_VIBPA       T-PVLGDQFEWQGLQWVIADVVDHQVTKVGLRLPNEEEEGEEED-
B7VLQ7_VIBA3      H-PVLGDSFMWHDITWVVAEIDDHKVVRLGLCLPKTTLEEDISEV
NHAP2_SHEB5       N-PVLGDQFQWQSLHWVVAGLYEGKVTNVGIRLPTEHAL------
NHAP2_SHEB8       N-PVLGDQFQWQSLHWVVAGLYEGKVTNVGIRLPTEHAL------
NHAP2_SHEB2       N-PVLGDQFQWQSLHWVVAGLYEGKVTNVGIRLPTEHSL------
NHAP2_SHEB9       N-PVLGDQFQWQSLHWVVAGLYEGKVTNVGIRLPTEHSL------
NHAP2_SHESM       H-PVLGDQFLWQSLHWVVAGLYEGKVTNVGIRLPAEA--------
NHAP2_SHESR       H-PVLGDQFLWQSLHWVVAGLYEGKVTNVGIRLPAEA--------
NHAP2_SHESA       H-PVLGDQFLWQSLHWVVAGLNEGKVTNVGIRLPAEA--------
NHAP2_SHEON       H-PVLGDQFLWQSLHWVVAGLYEGKVTNVGIRLPADA--------
NHAP2_SHEPC       H-PVIGDHFQWQSLHWVVAGLHEGKVTNIGIRLPPET--------
NHAP2_SHESW       H-PVIGDHFQWQSLHWVVAGLHEGKVTNIGIRLPPET--------
NHAP2_SHESH       E-LVLGDQFEWQSLSWVVSELSQGEVVKVGIRLPNDS--------
A1S3I1_SHEAM      N-PVEGDSFEWQGCDWVVRTMEGDCPTCLGLKLKAG---------
NHAP2_AERHH       N-LVVGDHVEWQGLIWTVAEMDEGEPRKIGVRFLEEDPV------
NHAP2_AERS4       N-LVVGDQVEWQGLIWTVAEMEEGKPRKIGVRFQEEDPV------
                     : **     .   .:          :*: