CLUSTAL format seed alignment for MF_01080

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TRUB_UREPA      --------------------------------------------------MSAISKNIII
TRUB_UREP2      --------------------------------------------------MSAISKNIII
TRUB_MYCPE      ---------------------------------------MKQKYQYIKNTELDLKDKIFG
TRUB_MYCMS      ----------------------------------------------------MQKSGIFI
TRUB_MYCCT      ----------------------------------------------------MQKSGIFI
TRUB_MESFL      ----------------------------------------------------MNKSGIII
TRUB_AYWBP      ------------------------------------------------------MNGFFL
TRUB_ONYPE      ------------------------------------------------------MNGFFL
TRUB_ACHLI      ------------------------------------------------------MNGIFL
TRUB_CAUVC      --------------------------------------MARRKK-------GDAVSGWLC
TRUB_CAUSK      --------------------------------------MARRKK-------GDAISGWIC
TRUB_MARMM      --------------------------------------MARRRK-------GDDIHGWVI
TRUB_BRUSI      --------------------------------------MARRGK-----KKGRPISGWVI
TRUB_BRUAB      --------------------------------------MARRGK-----KKGRPISGWVI
TRUB_BRUA2      --------------------------------------MARRGK-----KKGRPISGWVI
TRUB_BRUSU      --------------------------------------MARRGK-----KKGRPISGWVI
TRUB_BRUO2      --------------------------------------MARRGK-----KKGRPISGWVI
TRUB_BRUC2      --------------------------------------MARRGK-----KKGRPISGWVI
TRUB_BRUME      --------------------------------------MARRGK-----KKGRPISGWVI
TRUB_OCHA4      --------------------------------------MARRGK-----KKGRPISGWVI
TRUB_RHILO      --------------------------------------MGRRGK-----KKGRPVSGWVV
TRUB_CHESB      --------------------------------------MARRGK-----KKGRAVSGWLV
TRUB_RHIME      --------------------------------------MSRPRK-----PKGRPISGWLI
TRUB_SINMW      --------------------------------------MSRPRK-----PKGRPISGWLI
TRUB_RHIEC      --------------------------------------MSKPRK-----PKGRPISGWLI
TRUB_RHIL3      --------------------------------------MSKPRK-----PKGRPISGWLI
TRUB_AGRFC      --------------------------------------MSKPRKQQHRKPKGRPISGWLI
TRUB_BARHE      --------------------------------------MARQSK-----KKGRPVSGWII
TRUB_BARQU      --------------------------------------MVRQRK-----KRGRPVSGWVI
TRUB_BART1      --------------------------------------MARQRK-----KKGRPVSGWVV
TRUB_BARBK      --------------------------------------MSRQSK-----KKGRSISGWVI
TRUB_BRADU      -----------------MGGNSQPHQEPR-RVNNDPR-AKQQKGN-QVRRDRRDVHGWVV
TRUB_RHOPA      MTVTTPDALLAPHDVQHAGADESAAQIRKPRDNNDPRNANRGGGNGKPRRDKRDVHGWVV
TRUB_GLUDA      ---------------------------------------MRRKR-------GRPIDGWLV
TRUB_GLUOX      ---------------------------------------MGRKR-------GRDIDGWLI
TRUB_RHORT      --------------------------------------MSRRRR-------GQAIHGWLA
TRUB_RUEST      --------------------------------------MGRKRK-------GRDISGWLV
TRUB_RUEPO      --------------------------------------MARKRK-------GRDISGWLV
TRUB_ROSDO      --------------------------------------MGRRRK-------GRDISGWLI
TRUB_RHOS4      --------------------------------------MGRTRK-------GRAISGWLV
TRUB_RHOS1      --------------------------------------MGRTRK-------GRAISGWLV
TRUB_RHOS5      --------------------------------------MGRTRK-------GRAISGWLV
TRUB_DINSH      --------------------------------------MGRRKK-------GRAVSGWIV
TRUB_JANSC      --------------------------------------MARRNK-------GRDISGWVL
TRUB_PARDP      --------------------------------------MARK-K-------GREIHGWLI
TRUB_EHRRW      ------------------------------------------------------MYGWIN
TRUB_EHRRG      ------------------------------------------------------MYGWIN
TRUB_EHRCJ      ------------------------------------------------------MYGWVN
TRUB_EHRCR      ------------------------------------------------------MYGWIN
TRUB_ANAMM      ------------------------------------------------MQSARVKYGWLN
TRUB_ZYMMO      --------------------------------------MTLTPS------PTDALHGWII
TRUB_RICB8      -----------------------------------------------------MNSYWLN
TRUB_RICBR      -----------------------------------------------------MNSYWLN
TRUB_RICRS      -----------------------------------------------------MSNYWLN
TRUB_RICRO      -----------------------------------------------------MSNYWLN
TRUB_RICCK      -----------------------------------------------------MSNYWLN
TRUB_RICAH      -----------------------------------------------------MSNYWLN
TRUB_RICTY      -----------------------------------------------------MSNYWLN
TRUB_BORAP      -----------------------------------------------------MENGFLL
TRUB_BORBP      -----------------------------------------------------MENGFLL
TRUB_BORBU      -----------------------------------------------------MENGFLL
TRUB_TREPA      ------------------------------------------------MCRLSMPDAIVP
TRUB_TREDE      --------------------------------------------------MELNKNLIIP
TRUB_ARTS2      -----------------------------------------------------MLSGLVI
TRUB_PAEAT      -----------------------------------------------------MLSGLVI
TRUB_THEFY      -----------------------------------------------------MADGVVI
TRUB_STRAW      -----------------------------------------------MTEKHRTPDGLVI
TRUB_STRCO      -----------------------------------------------MTEKHTTPDGLVI
TRUB_LEIXX      --------------------------------------------------MGMIGSGLLL
TRUB_CUTAK      --------------------------------------------------MNTLQSGVLV
TRUB_CORGL      -----------------------------------------MN-------APAPKPGLVI
TRUB_CORGB      -----------------------------------------MN-------APAPKPGLVI
TRUB_COREF      -----------------------------------------MN-------DPVQNSGLVV
TRUB_CORDI      -----------------------------------------MN-------DALADSGLVI
TRUB_CORJK      -----------------------------------------MNQRSA--RSVLSRSGVVL
TRUB_MYCTU      -----------------------------------------MSAT---------GPGIVV
TRUB_MYCBP      -----------------------------------------MSAT---------GPGIVV
TRUB_MYCBO      -----------------------------------------MSAT---------GPGIVV
TRUB_MYCTA      -----------------------------------------MSAT---------GPGIVV
TRUB_MYCA1      -------------------------------------------MS---------PPGLVV
TRUB_MYCPA      -------------------------------------------MS---------PPGLVV
TRUB_MYCLE      -----------------------------------------MSESST---GAGLGPGIVV
TRUB_MYCUA      -----------------------------------------MSRQNA---GPGFGPGIVV
TRUB_NOCFA      -----------------------------------------MGERSAPTRRVDPLGGLLV
TRUB_RHOJR      -----------------------------------------MSAREKPSSGLVG-AGLLI
TRUB_BIFLO      -------------------------------------------------MLHTTPSGLLI
TRUB_DEIRA      -------------------------------------------------------MPVIA
TRUB_DEIGD      -------------------------------------------------------MPVIP
TRUB_THET2      -------------------------------------------------------MALYA
TRUB_THET8      -------------------------------------------------------MALYA
TRUB_TROWT      ---------------------------------------MLGKVERSEMYILFAMTQVLL
TRUB_TROW8      ---------------------------------------MLGKVERSEMYILFAMTQVLL
TRUB_TRIV2      ------------------------------------------------------MQGFIN
TRUB_NOSS1      ------------------------------------------------------MQGFIN
TRUB_TRIEI      ------------------------------------------------------MQGFLN
TRUB_ACAM1      ------------------------------------------------------MLGFLN
TRUB_SYNP6      ----------------------------------------------------MSSEGFVN
TRUB_SYNE7      ----------------------------------------------------MSSEGFVN
TRUB_GLOVI      ------------------------------------------------------MEGFLN
TRUB_THEEB      ------------------------------------------------------MFGFLN
TRUB_SYNY3      ------------------------------------------------------MFGFLN
TRUB_MICAN      ------------------------------------------------------MFGFLN
TRUB_PROMT      ---------------------------------------------------MEKPFGFVV
TRUB_PROM1      ---------------------------------------------------MEKPFGFVV
TRUB_PROMA      --------------------------------------------------MNSIALGFLV
TRUB_SYNPW      ---------------------------------------------------MTAPLGFAV
TRUB_SYNPX      ---------------------------------------------------MDGPFGFVV
TRUB_SYNS3      ---------------------------------------------------MDAPLGFVV
TRUB_PROMM      ---------------------------------------------------MTVPFGFVV
TRUB_PROMP      ---------------------------------------------------MEIKDGFIA
TRUB_PROM5      ---------------------------------------------------MEIKDGFII
TRUB_PROM0      ---------------------------------------------------METKDGFLV
TRUB_PROMS      ---------------------------------------------------METKDGFLV
TRUB_PROM9      ---------------------------------------------------MENKDGFLV
TRUB_PROM2      ---------------------------------------------------METNDGFLV
TRUB_BACFN      --------------------------------------------------MNFKEGEVLY
TRUB_BACFR      --------------------------------------------------MNFKEGEVLY
TRUB_BACTN      --------------------------------------------------MNFKKGEVLF
TRUB_BACV8      --------------------------------------------------MNFKEGEVLY
TRUB_PARD8      --------------------------------------------------MDFIAGEILY
TRUB_FLAJ1      -----------------------------------------------MTPEEYLEGQVLL
TRUB_PELLD      -----------------------------------------MEAEHTSTKGVPEAGEFLL
TRUB_CHLPM      ------------------------------------------MVEMHEGAGLPEDGEFLL
TRUB_CHLCH      --------------------------------------MCNVHAQQGSAQEAPPPGELLL
TRUB_CHLTE      ------------------------------------------MIDQGRISVLSEEGDYLL
TRUB_RHOBA      ----------------------------------------------MDPNGEHSPLGFLP
TRUB_CUPMC      ----------------------------MTDSSATRPPRLP----------RRDVHGVLL
TRUB_CUPPJ      ----------------------------MTDSANNRPPRLP----------RREVHGVLL
TRUB_RALSO      ----------------------------MTEQRPSQQAKQP----------RRDVHGVLL
TRUB_BURPS      ------------------------------MTTVSPRPRMA----------RRALDGVLL
TRUB_BURMA      ------------------------------MTTVSPRPRMA----------RRALDGVLL
TRUB_BURP1      ---------------------------------------MA----------RRALDGVLL
TRUB_BURP0      ---------------------------------------MA----------RRALDGVLL
TRUB_BURM7      ---------------------------------------MA----------RRALDGVLL
TRUB_BURP6      ---------------------------------------MA----------RRALDGVLL
TRUB_BURL3      -----------------MRPPRTTELDRPMTTAASQRPRVP----------RRLLDGVLL
TRUB_VEREI      -------------------------------MPPASRTRVQ----------RRPVHGVLL
TRUB_DECAR      -----------------------------------MQFKRA----------WKQVDGVLL
TRUB_BORPE      ------------------------------------MAKRR----------GLALDGVLL
TRUB_BORBR      ------------------------------------MAKRR----------GLALDGVLL
TRUB_BORPA      ------------------------------------MAKRR----------GLALDGVLL
TRUB_BORA1      ------------------------------------MAKRR----------GQPLDGVLL
TRUB_AROAE      -------------------------------MKASKQFRHQ----------RRIVDGVLL
TRUB_THIDA      -------------------------------------MKPA----------RQAVDGVLL
TRUB_CHRVO      ----------------------------------MSKPRSN----------RRHIDGVLL
TRUB_NEIMB      ----------------------------------MNTGKPQ----------KRAVNGVLL
TRUB_NEIG1      -----------------------------------MTNKPA----------KRPVNGVLL
TRUB_NEIMA      -----------------------------------MTNKPA----------KRPVNGVLL
TRUB_NITMU      ------------------------------------MSPGS----------KRHISGVLL
TRUB_NITEU      -----------------------------------------------------------M
TRUB_PSEAB      ----------------------------------MAQVKRI----------RRSISGILV
TRUB_PSEAE      ----------------------------------MAQVKRI----------RRSISGILV
TRUB_PSEA7      ----------------------------------MAQVKRI----------RRSISGILV
TRUB_PSEF5      ----------------------------------MAQVKRI----------RRNVSGIIL
TRUB_PSEPF      ----------------------------------MAQVKRI----------RRNVSGIIL
TRUB_PSE14      ----------------------------------MAQVKRI----------RRNVSGIIL
TRUB_PSEU2      ----------------------------------MAQVKRI----------RRNVSGIIL
TRUB_PSEP1      ----------------------------------MAQVKRI----------RRNISGIIL
TRUB_PSEPG      ----------------------------------MAQVKRI----------RRNVSGIIL
TRUB_PSEE4      ----------------------------------MAQVKRI----------RRNVSGIIL
TRUB_PSEMY      ----------------------------------MAQVKRI----------RRKVDGIIL
TRUB_PSEU5      ----------------------------------MAQVKRV----------RRDVSGIIL
TRUB_COXBU      -------------------------------MTATNHPKLF----------KRPVDGVLL
TRUB_COXBR      -------------------------------MTATNHPKLF----------KRPVDGVLL
TRUB_COXBN      -------------------------------MTATNHPKLF----------KRPVDGVLL
TRUB_NITOC      ---------------------------------MKKQRRFQ----------GQDIHGMLL
TRUB_METFK      -----------------------------------MQFKRV----------KRNIDGVLL
TRUB_ACIAD      ---------------MNEFFNIIFNLFDVEHIMTAKSSKIS----------RRPVSGVFL
TRUB_MARMS      ------------------------------------MVKAK----------WRSVDGIVL
TRUB_LEGPC      -----------------------------------MTTIES----------QCSIDGILL
TRUB_LEGPA      -----------------------------------MTTIES----------QCSIDGILL
TRUB_LEGPH      -----------------------------------MTTIES----------QCSIDGILL
TRUB_LEGPL      -----------------------------------MTTIES----------KCSIDGILL
TRUB_MARHV      ----------------------------------MSRRRK-----------GRDVNGILV
TRUB_HAHCH      ----------------------------------MARRKK-----------GAPLNGVMV
TRUB_SACD2      ----------------------------------MGNRKRP----------GRPISGVIV
TRUB_XANAC      -----------------------------------MKPRIV----------YRPLHGILL
TRUB_XANC5      -----------------------------------MKPRIV----------YRPLHGILL
TRUB_XANOM      -----------------------------------MKPRIA----------YRPLHGILL
TRUB_XANOR      -----------------------------------MKPRIA----------YRPLHGILL
TRUB_XANCP      -----------------------------------MRPRIT----------FRPLHGILL
TRUB_XANC8      -----------------------------------MRPRIT----------FRPLHGILL
TRUB_XYLFA      ----------------------------------MLMSRIA----------YCRLDGILL
TRUB_XYLFT      ----------------------------------MLMSRIS----------YRRLDGILL
TRUB_METCA      ------------------------------------MGAIS----------TATLSGVLL
TRUB_SERP5      ----------------------------------MSRPRRR----------GRDIHGVLL
TRUB_PECAS      ----------------------------------MSRPRRR----------GRDVHGVLL
TRUB_ECOL5      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_ECOL6      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_ECOLI      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_ECOHS      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_ECOUT      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_SHIF8      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_SHISS      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_ECOLC      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_ECOK1      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_ECO57      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_ECO24      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_SHIDS      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_SHIFL      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_SHIBS      ----------------------------------MSRPRRR----------GRDINGVLL
TRUB_CITK8      ----------------------------------MSRPRRR----------GRDIHGVLL
TRUB_SALCH      ----------------------------------MSRPRRR----------GRDIHGVLL
TRUB_SALTY      ----------------------------------MSRPRRR----------GRDIHGVLL
TRUB_SALTI      ----------------------------------MSRPRRR----------GRDIHGVLL
TRUB_SALPA      ----------------------------------MSRPRRR----------GRDIHGVLL
TRUB_SALPB      ----------------------------------MSRPRRR----------GRDIHGVLL
TRUB_SALAR      ----------------------------------MSRPRRR----------GRDIHGVLL
TRUB_ENT38      ----------------------------------MSRPRRR----------GRDVHGVLL
TRUB_KLEP7      ----------------------------------MSRPRRR----------GRDVHGVLL
TRUB_CROS8      ----------------------------------MSRPRRR----------GRDVHGVLL
TRUB_YERPE      ----------------------------------MGRPRRR----------GRDINGVLL
TRUB_YERPA      ----------------------------------MGRPRRR----------GRDINGVLL
TRUB_YERPP      ----------------------------------MGRPRRR----------GRDINGVLL
TRUB_YERP3      ----------------------------------MGRPRRR----------GRDINGVLL
TRUB_YERPN      ----------------------------------MGRPRRR----------GRDINGVLL
TRUB_YERPS      ----------------------------------MGRPRRR----------GRDINGVLL
TRUB_YERE8      ----------------------------------MGRPRRR----------GRDINGVLL
TRUB_YEREN      ----------------------------------MGRPRRR----------GRDINGVLL
TRUB_PHOLL      ----------------------------------MGRHRR-----------GRDIHGVLL
TRUB_SODGM      ----------------------------------MGRPSRR----------GRDIDGIVL
TRUB_VIBVU      ----------------------------------MAR-RRK----------GRPIDGVIL
TRUB_VIBVY      ----------------------------------MAR-RRK----------GRPIDGVIL
TRUB_VIBCB      ----------------------------------MAR-RRK----------GRPINGVIL
TRUB_VIBPA      ----------------------------------MAR-RRK----------GRPINGVIL
TRUB_VIBC3      ----------------------------------MVR-RRK----------GRVIHGVIL
TRUB_VIBCH      ----------------------------------MAR-RRK----------GRVIHGVIL
TRUB_ALIF1      ----------------------------------MAR-RRK----------GRPVNGVIL
TRUB_PHOPR      ----------------------------------MAR-RRK----------GRPIDGVIL
TRUB_SHEHH      ----------------------------------MAR-RSR----------GRFIDGILL
TRUB_SHEPA      ----------------------------------MAR-RSR----------GRFIDGIVL
TRUB_SHELP      ----------------------------------MAR-KPR----------GRLVDGIVL
TRUB_SHEDO      ----------------------------------MAR-RSK----------GRQIDGIVL
TRUB_SHEFN      ----------------------------------MAR-RPK----------GRFIDGIVL
TRUB_SHESR      ----------------------------------MAR-RSK----------GRFIDGIVL
TRUB_SHESM      ----------------------------------MAR-RSK----------GRFIDGIVL
TRUB_SHESA      ----------------------------------MAR-RSK----------GRFIDGIVL
TRUB_SHESW      ----------------------------------MAR-RPK----------GRFIDGIVL
TRUB_SHEPC      ----------------------------------MAR-RPK----------GRFIDGIVL
TRUB_SHEB9      ----------------------------------MAR-RPK----------GRFIDGIVL
TRUB_SHEB8      ----------------------------------MAR-RPK----------GRFIDGIVL
TRUB_SHEB5      ----------------------------------MAR-RPK----------GRFIDGIVL
TRUB_SHEAM      ----------------------------------MAR-RTK----------GRNIDGIVL
TRUB_PSYIN      ----------------------------------MAR-RGK----------GRSINGIIL
TRUB_COLP3      ----------------------------------MAK-RRK----------GRQVNGVLL
TRUB_PSEA6      ----------------------------------MAR-RRK----------GRAIDGILL
TRUB_HAEIE      ----------------------------------MSRPRKR----------WRDVDGVFL
TRUB_HAEIG      ----------------------------------MSRPRKR----------WRDVDGVFL
TRUB_HAEI8      ----------------------------------MSRPRKR----------WRDVDGVFL
TRUB_HAEIN      ----------------------------------MSRPRKR----------WRDVDGVFL
TRUB_MANSM      ----------------------------------MSRPRKR----------GRDIHGVFL
TRUB_PASMU      ----------------------------------MAKPRKR----------GRDIDGVFL
TRUB_ACTP2      ----------------------------------MSRPRKK----------GRDVHGVFL
TRUB_HAEDU      ----------------------------------MARPKKK----------GRDIHGVFL
TRUB_HAES1      ----------------------------------MSKPRKK----------GRDINGIFL
TRUB_HISS2      ----------------------------------MSKPRKK----------GRDINGIFL
TRUB_PSEHT      ----------------------------------MAK-RSK----------GRPVDGILL
TRUB_IDILO      ----------------------------------MSKARLRK---------GRALTGVVL
TRUB_BUCAI      ------------------------------------MFFHK----------KRDVHGLLL
TRUB_BUCAP      ------------------------------------MFFHK----------KRNVNGFLL
TRUB_BUCBP      -------------------------------------MYSE----------FRSIDGIIL
TRUB_BLOPB      -------------------------------MKRYKNVRN------------RDINGILL
TRUB_BLOFL      -------------------------------MQRYVNFFDK---------NRRDVHGLLL
TRUB_WIGBR      -----------------------MIYLIIILLKFQKNLYDLLYSVIIKEDYLRNINGILL
TRUB_FRATT      ------------------------------------MKKNR-----------LNLNGVVV
TRUB_FRAT1      ------------------------------------MKKNR-----------LNLNGVVV
TRUB_FRATW      ------------------------------------MKKNR-----------LNLNGVVV
TRUB_FRATH      ------------------------------------MKKNR-----------LNLNGVVV
TRUB_FRATF      ------------------------------------MKKNR-----------LNLNGVVV
TRUB_FRATO      ------------------------------------MKKNR-----------LNLNGVVV
TRUB_FRATN      ------------------------------------MKKNR-----------LNLNGVVV
TRUB_FRAP2      ------------------------------------MKKNR-----------LNLNGVVV
TRUB_PSYCK      -------------------------------MSIASTQADKKSSNHPN---KIKVSGVIL
TRUB_PSYA2      -------------------------------MSIASTQADKKSSNHPD---KIKISGVIL
TRUB_HYDCU      ---------------------------------MAKKQWQK-------------IDGIVL
TRUB_GEOSL      ------------------------------------------------------MDGFIV
TRUB_GEOMG      ------------------------------------------------------MDGFIV
TRUB_GEOUR      ------------------------------------------------------MDGFIV
TRUB_PELCD      ------------------------------------------------------MNGILI
TRUB_DESAG      ----------------------------------------------MADSKLAQQHGVLV
TRUB_DESVH      --------------------------------------------------MPVQQHGLLV
TRUB_DESPS      ------------------------------------------------MEEQDFTAGIFL
TRUB_SYNWW      ------------------------------------------------------MHGFLN
TRUB_DEHMB      ------------------------------------------------------MDGILN
TRUB_DEHMC      ------------------------------------------------------MDGILN
TRUB_DEHM1      ------------------------------------------------------MNGILN
TRUB_CHLMU      -----------------------------------------------MELATEPIEGVLL
TRUB_CHLTR      -----------------------------------------------MELATESIEGVLL
TRUB_CHLFF      -----------------------------------------------MELATELKEGILL
TRUB_CHLAB      -----------------------------------------------MELATELKEGILL
TRUB_CHLPN      -----------------------------------------------MDLAVELKEGILL
TRUB_PARUW      ---------------MINTCALKNYLEKSQKKESPAKETIVTSLNRSLSTPPSHLEGILL
TRUB_AQUAE      ------------------------------------------------------MDGALL
TRUB_SOLUE      ------------------------------------------------------MDGVIV
TRUB_THEMA      -----------------------------------------------------MKHGILV
TRUB_THEP1      -----------------------------------------------------MKHGILV
TRUB_THEM4      ------------------------------------------------------MMGFLN
TRUB_SYNAS      ------------------------------------------------------MDGILI
TRUB_CALS8      ------------------------------------------------------MNGILL
TRUB_BDEBA      ------------------------------------------------MTNKNQFNGLLL
TRUB_CLOAB      ------------------------------------------------------MDGILN
TRUB_CLONN      ------------------------------------------------------MNGILN
TRUB_CLOBL      ------------------------------------------------------MDGVIN
TRUB_CLOTE      ------------------------------------------------------MNGVIN
TRUB_CLOPE      ------------------------------------------------------MNGVIN
TRUB_CLOP1      ------------------------------------------------------MNGVIN
TRUB_CLOPS      ------------------------------------------------------MNGVIN
TRUB_CLOK5      ------------------------------------------------------MDGILN
TRUB_ALKOO      ------------------------------------------------------MNGILN
TRUB_LACP7      ------------------------------------------------------MNGIIN
TRUB_CLOD6      ------------------------------------------------------MNKIIS
TRUB_FUSNN      ------------------------------------------------------MEGIIV
TRUB_GEOTN      ------------------------------------------------------MDGVLL
TRUB_GEOKA      ------------------------------------------------------MDGVLL
TRUB_BACHK      ------------------------------------------------------MEGVVL
TRUB_BACAH      ------------------------------------------------------MEGVVL
TRUB_BACCZ      ------------------------------------------------------MEGVVL
TRUB_BACAN      ------------------------------------------------------MEGVVL
TRUB_BACC1      ------------------------------------------------------MEGVVL
TRUB_BACCR      ------------------------------------------------------MEGVVL
TRUB_BACCN      ------------------------------------------------------MEGVVL
TRUB_BACVZ      -----------------------------------------------------MVNGVLL
TRUB_BACSU      -----------------------------------------------------MVNGVLL
TRUB_BACLD      -----------------------------------------------------MYNGVLL
TRUB_BACP2      -----------------------------------------------------MINGVLL
TRUB_BACHD      ----------------------------------------------------MDMTGILP
TRUB_BACSK      ----------------------------------------------------MEPTGIVV
TRUB_OCEIH      ------------------------------------------------------MHGILP
TRUB_LISMF      ------------------------------------------------------MNGIIP
TRUB_LISMO      ------------------------------------------------------MNGIIP
TRUB_LISIN      ------------------------------------------------------MNGIIP
TRUB_LISW6      ------------------------------------------------------MNGIIP
TRUB_STAEQ      -----------------------------------------------------MYNGILP
TRUB_STAES      -----------------------------------------------------MYNGILP
TRUB_STAAT      -----------------------------------------------------MYNGILP
TRUB_STAA3      -----------------------------------------------------MYNGILP
TRUB_STAA8      -----------------------------------------------------MYNGILP
TRUB_STAAC      -----------------------------------------------------MYNGILP
TRUB_STAAE      -----------------------------------------------------MYNGILP
TRUB_STAAS      -----------------------------------------------------MYNGILP
TRUB_STAAW      -----------------------------------------------------MYNGILP
TRUB_STAAR      -----------------------------------------------------MYNGILP
TRUB_STAA1      -----------------------------------------------------MYNGILP
TRUB_STAA2      -----------------------------------------------------MYNGILP
TRUB_STAAM      -----------------------------------------------------MYNGILP
TRUB_STAAN      -----------------------------------------------------MYNGILP
TRUB_STAA9      -----------------------------------------------------MYNGILP
TRUB_STAAB      -----------------------------------------------------MYNGILP
TRUB_STAHJ      -----------------------------------------------------MYNGILP
TRUB_STAS1      -----------------------------------------------------MYNGILP
TRUB_LACPL      -----------------------------------------------------MLNGILP
TRUB_LACBA      ------------------------------------------------------MNGIIP
TRUB_LACP3      ------------------------------------------------------MNGILP
TRUB_PEDPA      ------------------------------------------------------MDGIIP
TRUB_LACSS      ------------------------------------------------------MDGIIP
TRUB_LACS1      ------------------------------------------------------MDGILP
TRUB_LACRD      ------------------------------------------------------MDGIIP
TRUB_STRR6      ------------------------------------------------------MNGIIN
TRUB_STRP2      ------------------------------------------------------MNGIIN
TRUB_STRPN      ------------------------------------------------------MNGIIN
TRUB_STRGC      ------------------------------------------------------MNGIIN
TRUB_STRSV      ------------------------------------------------------MNGIIN
TRUB_STRT2      -----------------------------------------------------MISGIIN
TRUB_STRT1      -----------------------------------------------------MISGIIN
TRUB_STRA1      -----------------------------------------------------MITGIIN
TRUB_STRA3      -----------------------------------------------------MITGIIN
TRUB_STRA5      -----------------------------------------------------MITGIIN
TRUB_STRMU      -----------------------------------------------------MISGIIN
TRUB_STRP1      -----------------------------------------------------MINGIIN
TRUB_STRP8      -----------------------------------------------------MINGIIN
TRUB_STRPF      -----------------------------------------------------MINGIIN
TRUB_STRP6      -----------------------------------------------------MINGIIN
TRUB_STRPB      -----------------------------------------------------MINGIIN
TRUB_STRPC      -----------------------------------------------------MINGIIN
TRUB_STRP3      -----------------------------------------------------MINGIIN
TRUB_STRPM      -----------------------------------------------------MINGIIN
TRUB_STRPG      -----------------------------------------------------MINGIIN
TRUB_STRPD      -----------------------------------------------------MINGIIN
TRUB_LACLM      --------------------------------------------------MNENLNGILN
TRUB_LACLS      --------------------------------------------------MNENLNGILN
TRUB_LACLA      --------------------------------------------------MNENLNGILN
TRUB_LACDB      -----------------------------------------------------MFNGIIV
TRUB_LACDA      -----------------------------------------------------MFNGIIV
TRUB_LACGA      -----------------------------------------------------MLNGIVV
TRUB_LACJO      -----------------------------------------------------MLNGIVV
TRUB_LACAC      -----------------------------------------------------MLNGIIV
TRUB_OENOB      -----------------------------------------------------MYNGIVL
TRUB_SYMTH      -------------------------------------------MARAQNEAASEVDGVLN
TRUB_MOOTA      -----------------------------------------------------MVMGFVN
TRUB_PELTS      ------------------------------------------------------MNGIVN
TRUB_CARHZ      ------------------------------------------------------MDGFIN
TRUB_CALS4      ----------------------------------------------------MSVDGVLN
TRUB_MYCMO      ------------------------------------------------------MKMILL
TRUB_MYCH2      ---------MADTLDLGSSAFGCKGSSPFLRTTMIGQPCVDFFFFFFFFFKKKKKKMITF
TRUB_MYCPU      --------------------------------------------------------MFYL
TRUB_WOLSU      ------------------------------------MEANKGKFYHETGGESLKPNALFV
TRUB_HELHP      ----------------------------------------------------MANALLVA
TRUB_SULNB      ------------------------------------------------------MNRLFV
TRUB_NITSB      ------------------------------------------------------MNRLFV
TRUB_SULDN      ------------------------------------------------------MNRLFV
TRUB_CAMJJ      ------------------------------------------------------MNKIFA
TRUB_CAMJ8      ------------------------------------------------------MNKIFA
TRUB_CAMJE      ------------------------------------------------------MNKIFA
TRUB_CAMJR      ------------------------------------------------------MNKIFA
TRUB_CAMJD      ------------------------------------------------------MNKIFA
TRUB_CAMC1      ------------------------------------------------------MNAIFV
TRUB_CAMC5      ------------------------------------------------------MNAIFV
                                                                            

TRUB_UREPA      INKPIKWTSNDVVQKVKRVI-------GAKKVGHAGTLDPNASGVLVLGINE--GTKLLT
TRUB_UREP2      INKPIKWTSNDVVQKVKRVI-------GAKKVGHAGTLDPNASGVLVLGINE--GTKLLT
TRUB_MYCPE      INKPKNFSSNQVIQIIKKYY-------GLKKIGHAGTLDPLATGLLLVATNS--KTKELN
TRUB_MYCMS      LNKPSNISTYQLINQVKKKL-------NIKKVGHCGTLDLLATGVVICLVNN--ATKISD
TRUB_MYCCT      LNKPKNISTYQLINQVKKKL-------NIKKVGHCGTLDLLATGVVICLVNN--ATKISD
TRUB_MESFL      LNKPKGLTTNHLIQKLKRKL-------NVKKIGHAGTLDPLATGVVICLINN--GTKLSD
TRUB_AYWBP      VNKPEKMTSHDVVFQIKKKF-------HFDKVGHTGTLDPLASGLLIVCVGK--ATKLAF
TRUB_ONYPE      VNKPEKMTSHDVVFQIKKKF-------HFDKVGHTGTLDPLASGLLIICVGK--ATKLAF
TRUB_ACHLI      VNKKAGLTSHDIVYQIRKKF-------NIKKVGHTGTLDPFATGLLIILVGK--ATKLAF
TRUB_CAUVC      LDKPYDLTSTTAVSRVRRA-------FNAQKGGHAGTLDPLATGILPIALGE-ATKTVPF
TRUB_CAUSK      LDKPYDLTSTSAVSRVRRA-------FNAQKAGHAGTLDPLATGVLPLALGE-ATKTVPF
TRUB_MARMM      LDKPLDMTSTQAVSAVRRI-------YNAKKAGHAGTLDPLASGILPIALGE-ATKTVPF
TRUB_BRUSI      FDKPKGMGSTEAVSKIKWL-------FSAEKAGHAGTLDPLASGMLPIALGE-ATKTVPY
TRUB_BRUAB      FDKPKGMGSTEAVSKIKWL-------FSAEKAGHAGTLDPLASGMLPIALGE-ATKTVPY
TRUB_BRUA2      FDKPKGMGSTEAVSKIKWL-------FSAEKAGHAGTLDPLASGMLPIALGE-ATKTVPY
TRUB_BRUSU      FDKPKGMGSTEAVSKIKWL-------FSAEKAGHAGTLDPLASGMLPIALGE-ATKTVPY
TRUB_BRUO2      FDKPKGMGSTEAVSKIKWL-------FSAEKAGHAGTLDPLASGMLPIALGE-ATKTVPY
TRUB_BRUC2      FDKPKGMGSTEAVSKIKWL-------FSAEKAGHAGTLDPLASGMLPIALGE-ATKTVPY
TRUB_BRUME      FDKPKGMGSTEAVSKIKWL-------FSAEKAGHAGTLDPLASGMLPIALGE-ATKTVPY
TRUB_OCHA4      FDKPKGMGSTEAVSKIKWL-------FNAEKAGHAGTLDPLASGMLPIALGE-ATKTVPY
TRUB_RHILO      LDKPVGMGSTEAVSKIKWL-------FQAEKAGHAGTLDPLASGMLPIALGE-ATKTVPY
TRUB_CHESB      LDKPAGLGSTEAVSKVKWL-------FGAQKAGHAGTLDPLASGMLPIALGE-ATKTVPY
TRUB_RHIME      LDKPLDFGSTEAVSKIKWL-------FKAQKAGHAGTLDPLASGMLPIALGD-ATKTVPY
TRUB_SINMW      LDKPLDFGSTEAVSKIKWL-------FKAQKAGHAGTLDPLASGMLPIALGD-ATKTVPY
TRUB_RHIEC      LDKPMDFGSTEAVSKLKWL-------YKAQKAGHAGTLDPLASGMLPIALGD-ATKTVPY
TRUB_RHIL3      LDKPVDFGSTEAVSKIKWL-------YKAEKAGHAGTLDPLASGMLPIALGD-ATKTVPY
TRUB_AGRFC      LDKPLDFGSTEAVSKIKWL-------FNAQKAGHAGTLDPLASGMLPIALGD-ATKTVPY
TRUB_BARHE      LDKPKGMRSTEAVSQIKYL-------FHAQKVGHAGTLDPLASGLLPIALGE-ATKTVPY
TRUB_BARQU      FDKPKGMRSTEAVSQIKWL-------FHAQKAGHAGTLDPLASGLLPIALGE-ATKTVPY
TRUB_BART1      FDKPKGMKSTEAVSKIKWL-------FHAQKAGHAGTLDPLASGLLPIALGE-ATKTVPY
TRUB_BARBK      LDKPKAMKSTEAVSKIKRL-------FNAQKAGHAGTLDPLASGLLPIALGE-ATKTVPY
TRUB_BRADU      LDKPIGMTSTQAVAVLKRL-------FNAKRAGHAGTLDPLASGGLPIALGE-ATKTVPF
TRUB_RHOPA      LDKPIGMTSTQAVAVLKRL-------FSAKRAGHAGTLDPLASGGLPIAMGE-ATKTVPF
TRUB_GLUDA      IDKPSGMTSTDVVNRVKRL-------FDARKAGHGGTLDPLATGLLPIAFGA-ATKTVPY
TRUB_GLUOX      LDKPLGPTSTDMVNKLRWA-------FDAKKAGHGGTLDPLASGVLPIAFGK-ATRTIPY
TRUB_RHORT      IDKPVGITSTDVVNRLRRT-------MDAAKVGHGGTLDPLASGVLPIAFGE-ATKTVSY
TRUB_RUEST      VDKPAGLTSTAVVNKVRWA-------FDAKKAGHAGTLDPEATGVLAVALGE-ATKTVPF
TRUB_RUEPO      VDKPAGMTSTAVVNKVRWA-------LGANKAGHAGTLDPEATGVLAIALGE-ATKTVPY
TRUB_ROSDO      VDKPAGLTSTAVVNKVRWA-------LDAKKAGHAGTLDPDATGVLAVALGE-ATKTVPY
TRUB_RHOS4      VDKPAGMTSTAVVNKVRWA-------LEAQKAGHAGTLDPDATGVLAVALGE-ATKTVPY
TRUB_RHOS1      VDKPAGMTSTAVVNKVRWA-------LEAQKAGHAGTLDPDATGVLAVALGE-ATKTVPY
TRUB_RHOS5      VDKPAGMTSTAVVNKVRWA-------LGAQKAGHAGTLDPDATGVLAVALGE-ATKTVPY
TRUB_DINSH      IDKPAGLSSNAVVGKVRWA-------FDAQKAGHAGTLDPEATGVLAIALGE-ATKTVPF
TRUB_JANSC      VDKPAGLTSTAVVNKVRWC-------FDAKKAGHAGTLDPDATGMLPVALGE-ATKTIAY
TRUB_PARDP      VDKPAGIGSTDVVGKVRWA-------LDAKKAGHAGTLDPDATGVLAVALGE-ATKTVPI
TRUB_EHRRW      IDKPCGISSASVVSRVKKI-------LNVKKVGYAGTLDPLASGILPIAIGE-ATKLMPY
TRUB_EHRRG      IDKPCGISSASVVSRVKKI-------LNVKKVGYAGTLDPLASGILPIAIGE-ATKLMPY
TRUB_EHRCJ      LDKPCGMSSALAVNLVKRI-------LNVKKAGHAGTLDPLASGVLPIAIGE-ATKVMPY
TRUB_EHRCR      LDKPCGISSASAVNLVKKI-------LNVKKVGHAGTLDPLASGVLPIAIGE-ATKVMPY
TRUB_ANAMM      VDKPLHMSSGSVVGRVKKI-------FNCK-VGHAGTLDPLATGVLPVAVGE-ATKTIPY
TRUB_ZYMMO      LDKQEGLGSTQAVSAVKRAIRIAG--LPKVKVGHGGTLDPLASGVLPVALGE-ATKLAGY
TRUB_RICB8      VYKPRGISSAKLVSIIKKVLGK-------VKIGHSGTLDVEAEGVLPLAIGE-ATKLVQM
TRUB_RICBR      VYKPRGISSAKLVSIIKKVLGK-------VKIGHSGTLDVEAEGVLPLAIGE-ATKLVQM
TRUB_RICRS      IYKPRGISSAQLVSIVKKILGK-------TKIGHAGTLDVEAEGILPFAVGE-ATKLIRL
TRUB_RICRO      IYKPRGISSAQLVSIVKKILGK-------TKIGHAGTLDVEAEGILPFAVGE-ATKLIRL
TRUB_RICCK      IYKPRGISSAKLVSIVKTILGK-------VKIGHAGTLDVEAEGVLPLAVGE-ATKLVQI
TRUB_RICAH      IYKPGGISSAKLVSMVKQILGKK------VKVGHAGTLDVEAEGILPIAVGE-ATKLIQL
TRUB_RICTY      FYKPKGISSAKLVNIVKKIIGK-------TKIGHAGTLDVEAEGILPLAVGE-ATKLIQL
TRUB_BORAP      INKEQGKTSFETLFPIKKY-------FNTNHVGHAGILDKFASGILIALVGK-YTKLANY
TRUB_BORBP      INKEQGKTSFETLFPIKKY-------FNTNHVGHAGTLDKFASGILIALVGK-YTKLAGY
TRUB_BORBU      INKEQGKTSFETLFPIKKY-------FNTNRVGHAGTLDKFASGILVCLVGK-YTKLSGY
TRUB_TREPA      FAKVSGLTSFAALAQVRRL-------LGVKKVGHTGTLDRFADGLLLLLVGG-FTKLAPV
TRUB_TREDE      FAKQAGLTSFASMSAVKKA-------LSTKKVGHTGTLDLFADGLLVLLTGQ-LTRLADI
TRUB_ARTS2      VDKPQGWTSHDVVGRMRRLAGT-------RKVGHAGTLDPMATGVLVLGINK--ATRLLT
TRUB_PAEAT      VDKPQGWTSHDVVGRMRRLAGT-------RKVGHAGTLDPMATGVLVLGINK--ATRLLT
TRUB_THEFY      VDKPAGWTSHDVVARVRRLAGT-------RRVGHAGTLDPMATGVLVVGVGK--ATRLLG
TRUB_STRAW      VDKPSGFTSHDVVAKMRGIART-------RRVGHAGTLDPMATGVLVLGVEK--ATKLLG
TRUB_STRCO      VDKPSGFTSHDVVAKMRGIART-------RRVGHAGTLDPMATGVLVLGVER--ATKLLG
TRUB_LEIXX      IDKPGGWTSHDVVARVRRLAGT-------RKVGHAGTLDPMATGLLVLGLNS--STRLLT
TRUB_CUTAK      VDKPAGVTSHQVVGRVRRLMGT-------RKVGHAGTLDPMASGVLVVGVNR--ATRLLG
TRUB_CORGL      VDKPAGMTSHDVVSKLRRAFST-------RKVGHAGTLDPMATGVLVVGIER--GTRFLA
TRUB_CORGB      VDKPAGMTSHDVVSKLRRAFST-------RKVGHAGTLDPMATGVLVVGIER--GTRFLA
TRUB_COREF      VDKPAGMTSHDVVSKLRRAFST-------RKVGHAGTLDPMATGVLVVGIER--GTRFLA
TRUB_CORDI      VDKPQGMTSHDVVSKIRRTFST-------KKVGHAGTLDPMATGVLVLGLER--GTKFLA
TRUB_CORJK      VDKPSGPTSHDMVAKLRRIMGT-------RRIGHSGTLDPMATGLLVVGVER--GTKFLA
TRUB_MYCTU      IDKPAGMTSHDVVGRCRRIFAT-------RRVGHAGTLDPMATGVLVIGIER--ATKILG
TRUB_MYCBP      IDKPAGMTSHDVVGRCRRIFAT-------RRVGHAGTLDPMATGVLVIGIER--ATKILG
TRUB_MYCBO      IDKPAGMTSHDVVGRCRRIFAT-------RRVGHAGTLDPMATGVLVIGIER--ATKILG
TRUB_MYCTA      IDKPAGMTSHDVVGRCRRIFAT-------RRVGHAGTLDPMATGVLVIGIER--ATKILG
TRUB_MYCA1      VDKPAGMTSHDVVGRCRRIFAT-------RRVGHAGTLDPMATGVLVLGVER--ATKILG
TRUB_MYCPA      VDKPAGMTSHDVVGRCRRIFAT-------RRVGHAGTLDPMATGVLVLGVER--ATKILG
TRUB_MYCLE      IDKPSGMTSHDVVARCRRIFCT-------RRVGHAGTLDPMATGVLVLGVDR--ATKILG
TRUB_MYCUA      VDKPGAMTSHDVVGRCRRIFGT-------RRLGHAGTLDPMATGVLVIGIER--ATKILG
TRUB_NOCFA      VDKDGGMTSHDVVARCRKILGT-------RKIGHAGTLDPMATGVLVLGVER--ATKLLG
TRUB_RHOJR      VDKDAGVTSHDVVARCRKLLGT-------RKVGHAGTLDPMATGVLVLGVER--ATKLLG
TRUB_BIFLO      IDKPQGVTSFDAVAAVRGALHI-------KKVGHAGTLDPMATGTLVIAFGH--ATRLLN
TRUB_DEIRA      ADKPLHLTSHDVVNRARRALGT-------KRVGHTGTLDPLATGVVVLCVDD--STKLVQ
TRUB_DEIGD      VDKPLGLTSHDVVNRARRARGT-------RRVGHTGTLDPLATGVLVLCVDD--STKLVQ
TRUB_THET2      VDKPLHLTSHDVVEEARRRLST-------RRVGHTGTLDPLATGLLLLVTNE--STKLVP
TRUB_THET8      VDKPLHLTSHDVVEEARRRLST-------RRVGHTGTLDPLATGLLLLVTNE--STKLVP
TRUB_TROWT      VDKISGITSHTAVAKIRHLTGI-------KKIGHCGTLDPAACGLLIMGCGT--ATRLIR
TRUB_TROW8      VDKISGITSHTAVAKIRHLTGV-------KKIGHCGTLDPAACGLLIMGCGT--ATRLIR
TRUB_TRIV2      LDKPFGWTSHDCVARLRKMLRL-------KRVGHAGTLDPAATGVLPIAVGK--ATRLLQ
TRUB_NOSS1      LNKQFGWTSHDCVARLRKMLRL-------KRVGHAGTLDPAATGVLPIAVGK--ATRLLQ
TRUB_TRIEI      LNKPSGMTSHDCVAKVRKLLRL-------KRVGHGGTLDPAATGVLPIAVGK--ATRLLQ
TRUB_ACAM1      LHKPTGMTSHDCVGKVRRICGL-------KRVGHGGTLDPLATGVLPIALGP--ATRLLH
TRUB_SYNP6      LDKPAGWTSHDCVAKLRRLLRE-------RRIGHGGTLDPAVTGVLPIAVGR--ATRLLP
TRUB_SYNE7      LDKPAGWTSHDCVAKLRRLLRE-------RRIGHGGTLDPAVTGVLPIAVGR--ATRLLP
TRUB_GLOVI      LDKPAGLTSHDCIARLRRVLGE-------RRIGHGGTLDPAATGVLPVAVGR--ATRLLR
TRUB_THEEB      LNKPAGCTSHDCINELRRRLRL-------KRIGHGGTLDPMATGVLPIALGA--ATRLLP
TRUB_SYNY3      LHKPLHLTSHDCVAKVRRLLRQ-------KRVGHGGTLDPLAEGVLPLAVGS--ATRLLP
TRUB_MICAN      LNKPPDWTSHDCVAKVRKILKT-------KRVGHGGTLDPMATGVLPIAVGA--ATRLLA
TRUB_PROMT      IDKPSGLTSHDCVNRLRKVFGI-------KKIGHSGTLDPAVTGVLPIAIGD--ATRLIS
TRUB_PROM1      IDKPSGLTSHDCVNRLRKVFGI-------RKIGHSGTLDPAVTGVLPIAIGD--ATRLIS
TRUB_PROMA      INKPAGLTSHDCVNRLRRIYGI-------KRIGHGGTLDPAVTGVLPIAIGK--ATRLLS
TRUB_SYNPW      IDKPAGLTSHACVARIRRLLGI-------RRVGHGGTLDPAVTGVLPIAVGQ--ATRLLP
TRUB_SYNPX      IDKPAGHTSHSCVSRLRRCYGL-------KRVGHGGTLDPAVTGVLPIALGP--ATRLLP
TRUB_SYNS3      IDKPSGLTSHACVSRMRRVLQT-------KRVGHGGTLDPAVTGVLPIAVGQ--ATRLLP
TRUB_PROMM      IDKPAGITSHDCVSRMRRVFGI-------KRVGHGGTLDPAVTGVLPIALGH--ATRLLP
TRUB_PROMP      INKEKGFTSHDCVKQIRKLLGI-------KKVGHTGTLDPDVTGTLPIAIGS--ATRFIQ
TRUB_PROM5      INKEKGYTSHDCVQQIRKLLGT-------KKVGHTGTLDPGVTGTLPIAIGS--ATRFIQ
TRUB_PROM0      INKDKGCTSHDCVKQIRKLLNT-------KKVGHTGTLDPEVIGILPIAIGS--ATRFIQ
TRUB_PROMS      INKDKGCTSHDCVKQIRKLLNT-------KKVGHTGTLDPEVIGTLPIAIGN--ATRFIQ
TRUB_PROM9      INKDKGCTSHDCVKQIRKLLNT-------RKVGHTGTLDPEVIGTLPIAIGS--ATRFIQ
TRUB_PROM2      INKDKGCTSHDCVKQIRKLLNT-------KKVGHTGTLDPEVIGTLPIAIGS--ATRFIQ
TRUB_BACFN      FNKPLGWTSFKVVGHARYHMCRRMKV-KKLKVGHAGTLDPLATGVMIVCTGK--ATKRIE
TRUB_BACFR      FNKPLGWTSFKVVGHARYHMCRRMKV-KKLKVGHAGTLDPLATGVMIVCTGK--ATKRIE
TRUB_BACTN      FNKPLGWTSFKVVGHVRYHICRRIGV-KKLKVGHAGTLDPLATGVMILCTGK--ATKRIE
TRUB_BACV8      FDKPLKWTSFAVVNKIRYHICRKLGV-KKIKVGHAGTLDPLATGVMIICTGK--ATKRIE
TRUB_PARD8      FNKPLTWTSFDLVNKFRYKLSRKLKV-KKIKVGHAGTLDPLATGVMIVCTGR--ATKRID
TRUB_FLAJ1      IDKPLKWSSFQAVNKLKYLLINKVGLPKKFKIGHAGTLDPLATGLLLICTGK--FTKKIS
TRUB_PELLD      LDKPLDWTSFDVVAKIR-NTYKRGGL--KRKVGHSGTLDPKATGLLILATGR--KTKEIA
TRUB_CHLPM      LDKPLDWTSFDVVAKVR-NAYKRGGL--KRKVGHSGTLDPKATGLLILATGK--KTRELS
TRUB_CHLCH      IDKPLDWTSFDVVAKVR-NTYRKCGS--KRKVGHCGTLDPKATGLLIVATGR--KTKEIS
TRUB_CHLTE      VDKPLDWTSFDVVAKIR-GAYKRNGA--KRKVGHCGTLDPKATGLLILATGR--KTKTIS
TRUB_RHOBA      CYKPPGATSRDLVNRAQRRLRGEFGL-RKLKVGHTGTLDPLAEGLVLLAIGS--AARLTP
TRUB_CUPMC      LDKPLGLSSNDALVRAKRLL-------RANKAGHTGTLDPLATGLLPLCFGE-ATKFSQD
TRUB_CUPPJ      LDKPLGLSSNDALVRAKRLL-------RALKAGHTGTLDPLATGLLPLCFGE-ATKFSQD
TRUB_RALSO      LDKPIGWSSNDALIRAKRLL-------WAKKAGHTGTLDPLATGLLPLCFGE-ATKFSQD
TRUB_BURPS      LDKPVGLSSNDALMRAKRLY-------QAKKAGHTGTLDPLASGLLPLCFGE-ATKFSQD
TRUB_BURMA      LDKPVGLSSNDALMRAKRLY-------QAKKAGHTGTLDPLASGLLPLCFGE-ATKFSQD
TRUB_BURP1      LDKPVGLSSNDALMRAKRLY-------QAKKAGHTGTLDPLASGLLPLCFGE-ATKFSQD
TRUB_BURP0      LDKPVGLSSNDALMRAKRLY-------QAKKAGHTGTLDPLASGLLPLCFGE-ATKFSQD
TRUB_BURM7      LDKPVGLSSNDALMRAKRLY-------QAKKAGHTGTLDPLASGLLPLCFGE-ATKFSQD
TRUB_BURP6      LDKPVGLSSNDALMRAKRLY-------QVKKAGHTGTLDPLASGLLPLCFGE-ATKFSQD
TRUB_BURL3      LDKPVGLSSNDALIRAKRLL-------LAKKAGHTGTLDPLASGLLPLCFGE-ATKFSQD
TRUB_VEREI      LDKPLALSSNQALQKAKWLL-------RAEKAGHTGTLDPLATGVLPLCFGA-ATKFSQL
TRUB_DECAR      LDKPLGMTSNDALQKARRLF-------SAAKGGHTGTLDPLATGLLPLCFGE-ATKFSAD
TRUB_BORPE      LDKPVGLSSNHALQRAKRTV-------DAAKAGHTGTLDPFATGLLVCCMGR-ATKISGR
TRUB_BORBR      LDKPVGLSSNHALQRAKRTV-------DAAKAGHTGTLDPFATGLLVCCMGR-ATKISGR
TRUB_BORPA      LDKPVGLSSNHALQRAKRTV-------DAAKAGHTGTLDPFATGLLVCCMGR-ATKISGR
TRUB_BORA1      LDKPVGLSSNHALQRAKRTL-------DAAKAGHTGTLDPFATGLLLCCMGR-ATKISGA
TRUB_AROAE      LDKPRGLTSNAALQTARRLL-------NAAKAGHTGTLDPMATGLLPLTLGE-ATKFSQM
TRUB_THIDA      LNKPVGITSNAALQKAKWLL-------NAKKAGHTGTLDPFADGLLPLCFGE-ATKFSAY
TRUB_CHRVO      IDKPYDISSNNALQKARWLL-------NAAKAGHTGVLDPLATGLLPVCLGE-ATKFSSY
TRUB_NEIMB      LDKPEGLSSNTALQKARRLF-------HAEKAGHTGVLDPLATGLLPVCFGE-ATKFAQY
TRUB_NEIG1      LDKPEGLSSNTALQKARRLF-------HAEKAGHTGVLDPLATGLLPVCFGE-AAKFAQY
TRUB_NEIMA      LDKPEGLSSNTALQKTRHLF-------RAEKAGHTGVLDPLATGLLPVCFGE-ATKFAQY
TRUB_NITMU      LDKASGLSSNQALQTAKRIF-------SAHKAGHTGTLDPMATGLLPICFGE-ATKFSSA
TRUB_NITEU      LNKPSGISSNRALQISKRLL-------SAAKAGHTGTLDPMAQGLLPICLGE-ATKFSST
TRUB_PSEAB      LDKPRGMSSNQALQKVRWLL-------NAEKAGHTGSLDPLATGVLPLCFGE-ATKFSQY
TRUB_PSEAE      LDKPRGMSSNQALQKVRWLL-------NAEKAGHTGSLDPLATGVLPLCFGE-ATKFSQY
TRUB_PSEA7      LDKPRGMSSNQALQKVRWLL-------NAEKAGHTGSLDPLATGVLPLCFGE-ATKFSQY
TRUB_PSEF5      LDKPLGFTSNAALQKVRWLL-------NAEKAGHTGSLDPLATGVLPLCFGE-ATKFSQY
TRUB_PSEPF      LDKPLGFTSNAALQKVRWLL-------NAEKAGHTGSLDPLATGVLPLCFGE-ATKFSQY
TRUB_PSE14      LDKPLGFTSNAALQKVRWLL-------NAEKAGHTGSLDPLATGVLPLCFGE-ATKFSQY
TRUB_PSEU2      LDKPLGFTSNAALQKVRWLL-------NAEKAGHTGSLDPLATGVLPLCFGE-ATKFSQY
TRUB_PSEP1      LDKPLGFTSNAALQKVRWLL-------NAEKAGHTGSLDPLATGVLPLCFGE-ATKFSQY
TRUB_PSEPG      LDKPLGFTSNAALQKVRWLL-------NAEKAGHTGSLDPLATGVLPLCFGE-ATKFSQY
TRUB_PSEE4      LDKPLGFTSNAALQKVRWLL-------NAEKAGHTGSLDPLATGVLPLCFGE-ATKFSQY
TRUB_PSEMY      LDKPRGFTSNAALQKVRWLL-------NAEKAGHTGSLDPLATGVLPLCFGE-ATKFSQY
TRUB_PSEU5      LDKPRGFTSNAALQKVRWLL-------NAEKAGHTGSLDPLATGVLPLCFGE-ATKFSQY
TRUB_COXBU      LDKPGGMTSNEALQRVKRLF-------HAKKAGHTGSLDPLATGLLPICLGE-ATKFSQF
TRUB_COXBR      LDKPGGMTSNEALQRVKRLF-------HAKKAGHTGSLDPLATGLLPICLGE-ATKFSQF
TRUB_COXBN      LDKPGGMTSNEALQRVKRLF-------HAKKAGHTGSLDPLATGLLPICLGE-ATKFSQF
TRUB_NITOC      LDKPVGISSNGALQRVKQIY-------QARKAGHTGSLDPLANGLLPICLGE-ATKLSGF
TRUB_METFK      LDKPLGISSNQALQMVKRLY-------QAAKAGHTGSLDPLASGLLPICLGE-ATKFSHF
TRUB_ACIAD      LNKPLGLSSNGVLQKVRWLF-------RAQKAGHTGALDPLATGLLPICLGE-ATKFSHY
TRUB_MARMS      LNKPIGLSSNQALQRVRRLY-------QAAKAGHTGALDPLATGMLPLCLGE-ATKFSQY
TRUB_LEGPC      LNKPQGMTSNAALQKAKHLF-------GAKKAGHTGSLDPLATGMLPLCFGE-ATKICQY
TRUB_LEGPA      LNKPQGMTSNAALQKAKHLF-------GAKKAGHTGSLDPLATGMLPLCFGE-ATKICQY
TRUB_LEGPH      LNKPQGMTSNAALQKTKHLF-------GAKKAGHTGSLDPLATGMLPLCFGE-ATKICQY
TRUB_LEGPL      LNKPQGMTSNAALQKAKHLF-------GAKKAGHTGSLDPLATGMLPLCFGE-ATKICQY
TRUB_MARHV      IDKPQGVTSNGILQQVKRLY-------GAAKAGHTGALDPLATGVLPLCFGE-ATKFSQT
TRUB_HAHCH      VDKPQDWTSNAVLQKVKYAL-------NAQKAGHTGALDPLATGVLPLCFGE-ATKFSQL
TRUB_SACD2      IDKPAGDSSNGVLQRVKRLF-------FANKAGHTGSLDPLATGVLPVCFGD-ATKFSQF
TRUB_XANAC      LDKPSGLSSNNALQAARRLL-------RAEKGGHTGSLDPLATGLLPLCFGE-ATKIAGL
TRUB_XANC5      LDKPAGLSSNNALQAARRLL-------RAEKGGHTGSLDPLATGLLPLCFGE-ATKIAGL
TRUB_XANOM      LDKPAGLSSNNALQAARRLL-------RAEKGGHTGSLDPLATGLLPLCFGE-ATKIAGL
TRUB_XANOR      LDKPAGLSSNNALQAARRLL-------RAEKGGHTGSLDPLATGLLPLCFGE-ATKIAGL
TRUB_XANCP      LDKPAGLSSNNALQAARRLL-------RAEKGGHTGSLDPLATGLLPLCFGE-ATKIAGL
TRUB_XANC8      LDKPAGLSSNNALQAARRLL-------RAEKGGHTGSLDPLATGLLPLCFGE-ATKIAGL
TRUB_XYLFA      LDKPAGISSNSALQIARRLL-------RAKKGGHTGSLDPLATGLLPLCFGE-ATKIAGL
TRUB_XYLFT      LDKPAGISSNSALQVARRLL-------RAKKGGHTGSLDPLATGLLPLCFGE-ATKIAGL
TRUB_METCA      LDKGSGMTSNSALQRARKLL-------DMRKAGHTGSLDPLASGILPLCFNE-ATKLSSY
TRUB_SERP5      LDKPQGLSSNDALQKVKRLY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_PECAS      LDKPQGVSSNDVLQKVKRIF-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_ECOL5      LDKPQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_ECOL6      LDKPQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_ECOLI      LDKPQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_ECOHS      LDKPQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_ECOUT      LDKPQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_SHIF8      LDKPQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_SHISS      LDKPQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_ECOLC      LDKPQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_ECOK1      LDKPQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_ECO57      LDKPQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_ECO24      LDKSQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_SHIDS      LDKPQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_SHIFL      LDKPQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_SHIBS      LDKPQGMSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICFGE-ATKFSQY
TRUB_CITK8      LDKPQGMSSNDVLQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_SALCH      LDKPQGMSSNDVLQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_SALTY      LDKPQGMSSNDVLQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_SALTI      LDKPQGMSSNDVLQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_SALPA      LDKPQGMSSNDVLQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_SALPB      LDKPQGMSSNDVLQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_SALAR      LDKPQGMSSNDVLQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_ENT38      LDKPQGASSNDVLQKVKRIY-------NANRAGHTGALDPLATGMLPVCLGE-ATKFSQY
TRUB_KLEP7      LDKPQGASSNDVLQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_CROS8      LDKPQGLSSNDALQKVKRIY-------NANRAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_YERPE      LDKPLGLSSNDVLQKVKRLF-------SANRAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_YERPA      LDKPLGLSSNDVLQKVKRLF-------SANRAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_YERPP      LDKPLGLSSNDVLQKVKRLF-------SANRAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_YERP3      LDKPLGLSSNDVLQKVKRLF-------SANRAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_YERPN      LDKPLGLSSNDVLQKVKRLF-------SANRAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_YERPS      LDKPLGLSSNDVLQKVKRLF-------SANRAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_YERE8      LDKPLGLSSNDVLQKVKRLF-------SANRAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_YEREN      LDKPLGLSSNDVLQKVKRLF-------SANRAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_PHOLL      LDKPQDISSNDALQKVKRIF-------NASKAGHTGALDPLATGMLPVCLGE-ATKFSQF
TRUB_SODGM      LDKPLGLSSNDLLQKVKRLF-------RANKAGHTGALDPLATGMLPVCLGE-ATKFSQH
TRUB_VIBVU      LDKPTGMSSNDALQKVKRLY-------FAEKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_VIBVY      LDKPTGMSSNDALQKVKRLY-------FAEKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_VIBCB      LDKPTGISSNDALQKVKRIF-------FAEKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_VIBPA      LDKPTGISSNDALQKVKRIY-------FAEKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_VIBC3      LDKPTGISSNDALQKVKRLY-------GAEKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_VIBCH      LDKPTGISSNDALQKVKRLY-------GAEKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_ALIF1      IDKPTGITSNDTLQKVKRIY-------FAEKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_PHOPR      LDKPTGITSNDTLQKVKRIF-------FAQKAGHTGALDPLATGMLPICFGE-ATKFSQF
TRUB_SHEHH      LDKDTGMSSNFALQRVKRFF-------NANKAGHTGALDPLATGMLPICLGE-ATKFSQH
TRUB_SHEPA      LDKDTGMSSNFALQRVKRFF-------NANKAGHTGALDPLATGMLPICLGE-ATKFSQH
TRUB_SHELP      LDKDTGMSSNFALQRVKRIY-------NAAKAGHTGALDPLATGMLPICLGE-ATKFSQH
TRUB_SHEDO      LDKDTGMSSNYALQRVKRFF-------NANKAGHTGALDPLATGMLPICLGE-ATKFSQH
TRUB_SHEFN      LDKDTGMSSNFALQRVKRFF-------NANKAGHTGALDPLATGMLPICLGE-ATKFSQH
TRUB_SHESR      LDKATGMSSNFALQRVKRFF-------NANKAGHTGALDPLATGMLPVCLGE-ATKFSQH
TRUB_SHESM      LDKATGMSSNFALQRVKRFF-------NANKAGHTGALDPLATGMLPICLGE-ATKFSQH
TRUB_SHESA      LDKATGMSSNFALQRVKRFF-------NANKAGHTGALDPLATGMLPVCLGE-ATKFSQH
TRUB_SHESW      LDKSTGMSSNFALQRVKRFF-------NANKAGHTGALDPLATGMLPVCLGE-ATKFSQH
TRUB_SHEPC      LDKSTGMSSNFALQRVKRFF-------NANKAGHTGALDPLATGMLPVCLGE-ATKFSQH
TRUB_SHEB9      LDKSTGMSSNFALQRVKRFF-------NANKAGHTGALDPLATGMLPVCLGE-GTKFSQH
TRUB_SHEB8      LDKSTGMSSNFALQRVKRFF-------NANKAGHTGALDPLATGMLPVCLGE-GTKFSQH
TRUB_SHEB5      LDKSTGMSSNFALQRVKRFF-------NANKAGHTGALDPLATGMLPVCLGE-GTKFSQH
TRUB_SHEAM      LDKPTGMSSNHALQRVKRIY-------NASKAGHTGALDPLATGMLPVCLGE-ATKFSQH
TRUB_PSYIN      LDKPTDISSNHALQRVKRIF-------FANKAGHTGALDPLATGMLPVCLGE-ATKFSQF
TRUB_COLP3      LDKPHGLSSNHALQTVKRIY-------FAQKAGHTGALDPLATGMLPICLGE-GTKFSQY
TRUB_PSEA6      LDKPLEISSNQALQKVKRAF-------LAAKAGHTGALDPLATGMLPVCLGE-ATKFSQF
TRUB_HAEIE      LDKPQGMSSNDIMQKVKRLF-------QANKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_HAEIG      LDKPQGMSSNDIMQKVKRLF-------QANKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_HAEI8      LDKPQGMSSNDIMQKVKRLF-------QANKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_HAEIN      LDKPQGMSSNDIMQKVKRLF-------QANKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_MANSM      LDKPQGMSSNDILQKVKRIY-------QANKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_PASMU      LDKPQGMSSNDIMQKVKRVF-------QANKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_ACTP2      LDKPQGMSSNDILQKVKRLF-------QANKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_HAEDU      LDKPQGMSSNEVLQKVKRFY-------QANKAGHTGALDPLATGMLPICLGE-ATKFSQF
TRUB_HAES1      LDKSQGMSSNDIMQKVKRLF-------QANKAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_HISS2      LDKSQGMSSNDIMQKVKRLF-------QANKAGHTGALDPLATGMLPICLGE-ATKFSQY
TRUB_PSEHT      LNKPIGISSNKALQQTKGVY-------FAQKAGHTGALDPLATGMLPICFGE-ATKFTQF
TRUB_IDILO      LNKPQGMSSNHALQRVKRLY-------NAQKAGHTGALDPLATGILPVCLGE-ATKFSQY
TRUB_BUCAI      LDKPQGISSNNALQKVKMLF-------SAKKAGYIGTLDPLATGMLPICFGE-CSKFSHY
TRUB_BUCAP      LDKPKGMTSNNVLQKVKIIF-------KAKKAGYIGTLDPLATGILPICFGE-ATKFSNY
TRUB_BUCBP      IDKPYGLSSHETLQKVKGIL-------KIKKMGHTGTLDPLATGMLPMCCGR-ATKFSQF
TRUB_BLOPB      LDKPKGISSGLFLNKIKKLF-------NAKKIGHTGTLDPLATGMLPVCFGK-ATKLAKY
TRUB_BLOFL      LDKPTGFSSSFFLNKIKKLF-------YAKKVGYIGTLDPIATGMLPICFGK-ATKFASY
TRUB_WIGBR      LDKPIGLSSNLILQKIKKLF-------KAKKAGYIGTLDPIASGMLPIFFGD-ATKFSDY
TRUB_FRATT      INKVKDISSNKVLQQLKYLF-------NAQKAGHTGTLDPMATGVLPICFGR-ATKIAQY
TRUB_FRAT1      INKVKDISSNKVLQQLKYLF-------NAQKAGHTGTLDPMATGVLPICFGR-ATKIAQY
TRUB_FRATW      INKAKDISSNKVLQQLKYLF-------NAQKVGHTGTLDPMATGVLPICFGR-ATKIAQY
TRUB_FRATH      INKAKDISSNKVLQQLKYLF-------NAQKAGHTGTLDPMATGVLPICFGR-ATKIAQY
TRUB_FRATF      INKAKDISSNKVLQQLKYLF-------NAQKAGHTGTLDPMATGVLPICFGR-ATKIAQY
TRUB_FRATO      INKAKDISSNKVLQQLKYLF-------NAQKAGHTGTLDPMATGVLPICFGR-ATKIAQY
TRUB_FRATN      INKAKDVSSNKVLQQLKYLF-------NAQKAGHTGTLDPMATGVLPICFGR-ATKIAQY
TRUB_FRAP2      INKTQGLSSNKVLQKLKYLF-------NAQKAGHTGTLDPMATGVLPICFGR-ATKIAQY
TRUB_PSYCK      VDKPQGMTSQQVVSKVKYLFKSPNH--DSKKAGHTGTLDPMATGLLPICLGE-ATKFSHY
TRUB_PSYA2      VDKPQGMTSQQVVSKVKYLFKSPNH--DSKKAGHTGTLDPMATGLLPICLGE-ATKFSHY
TRUB_HYDCU      LNKPEGVTSNGLLQQVRRVY-------NAKKAGHTGALDPFATGLLPICLGE-ATKISGL
TRUB_GEOSL      IDKPIGLTSHDVVARVRQTLR-------QKKAGHTGTLDPFATGVLPVAVGE-GTKAIPY
TRUB_GEOMG      IDKPAGLTSHDIIARVRRILG-------QKKAGHTGTLDPFATGVLPVAMGE-GTKAIPF
TRUB_GEOUR      VDKSAGMTSHDVVSAVRRIAG-------QKKVGHTGTLDPFATGVLPVALGE-ATKAIPF
TRUB_PELCD      VDKPQGMTSHAVVGRIRRLFG-------LRKVGHAGTLDPLATGVLVVALGQ-ATRILQF
TRUB_DESAG      LNKPKGPTSAHCIARIKRLG--------QKKIGHAGTLDPMAQGVLLVLLGQ-CTKISGY
TRUB_DESVH      LDKPSGPSSAQCISKVKRLG--------QKKIGHAGTLDPMAGGVLLVLLGH-ATKISGH
TRUB_DESPS      IDKPVGITSFGVVSRVRRILG-------MKKVGHAGTLDPFATGLLVVCAGRPATKMISS
TRUB_SYNWW      INKPQAMTSFDVIKKLKKVLPR------KYKLGHLGTLDPMAEGVLPVAVGC-GTRIIPF
TRUB_DEHMB      INKPFGITSFDVVAKVRRIYS-------QKRVGHGGTLDPYATGVIPVFLGKS-TRLIEY
TRUB_DEHMC      INKPFGITSFDVVAKVRRIYS-------QKRVGHGGTLDPYATGVIPVFLGRS-TRLIEY
TRUB_DEHM1      INKPPGLTSFGVVSKVRHIYS-------QKKVGHGGMLDPSATGVIPVFLGSA-TRLIEY
TRUB_CHLMU      VDKPQGRTSFSLIRSLVRLIG-------VKKIGHAGTLDPFATGVMVMLIGRKFTRLSDI
TRUB_CHLTR      VDKPQGRTSFSLIRSLVRLIG-------VKKIGHAGTLDPFATGVMVMLIGRKFTRLSDI
TRUB_CHLFF      VDKPQGRTSFSLIRTLTKLIG-------VKKIGHAGTLDPFATGVMVMLIGRKFTRLSDV
TRUB_CHLAB      IDKPQGRTSFSLIRTLTKLIG-------VKKIGHAGTLDPFATGVMVMLIGRRFTRLSDV
TRUB_CHLPN      VDKPQGRTSFSLIRALTKLIG-------VKKIGHAGTLDPFATGVMVMLIGRKFTRLSDI
TRUB_PARUW      INKPKGKTSFSLVRDLRKRLG-------VKKIGHAGTLDPFATGVMVMLVGRNYTRLSDQ
TRUB_AQUAE      IDKPKGITSTEVVERVKEKL-------KARKAGHTGTLDPIATGLLIILINK-ATRFSQF
TRUB_SOLUE      IDKPEGWTSHDVVNKVRRIA-------KTKKVGHLGTLDPIATGVLPLVIER-ATRLAQF
TRUB_THEMA      AYKPKGPTSHDVVDEVRKKL-------KTRKVGHGGTLDPFACGVLIIGVNQ-GTRILEF
TRUB_THEP1      AYKPKGPTSHDVVDEVRKKL-------KTRKVGHGGTLDPFACGVLIIGVNQ-GTRILEF
TRUB_THEM4      LYKPKGVTSHDVVDEVRRKL-------NIRRVGHAGTLDPFAEGVLVVGVGS-TTRLLEY
TRUB_SYNAS      LDKSPGKTSQKVVQEVKRIL-------GVRKAGHAGTLDPLATGVLPLCLNE-ATKLVQF
TRUB_CALS8      VDKPVGLTSHDVVEYVRKLF-------KTK-VGHCGTLDPFASGLLVLLIGE-ATKLSSF
TRUB_BDEBA      VDKPSGISSHDVVARLRRIL-------STRAVGHSGTLDPMASGLMACLVNE-GTKLSQY
TRUB_CLOAB      IFKPIGLTSFDVVRQVKKIS-------KEKKVGHTGTLDPLASGVLPICIGK-ATKIVDF
TRUB_CLONN      VYKPIGITSFDVVCQIKKIT-------GIKKIGHTGTLDPLACGVLPVCIGK-GTKVVDY
TRUB_CLOBL      VLKPKGITSFDVVRDIRKIA-------KIKKVGHTGTLDPLASGVLPICIGK-ATKIVDY
TRUB_CLOTE      VYKPQNITSFDVVRIIKKIS-------RIKKVGHTGTLDPMATGVLPICLGG-STKIVDF
TRUB_CLOPE      IYKNTGMTSFDVVAMVRRVA-------KMKKVGHTGTLDPAASGVLPVCLGK-ATKIIDY
TRUB_CLOP1      IYKNTGMTSFDVVAIVRRVA-------KMKKVGHTGTLDPAASGVLPVCLGK-ATKIIDY
TRUB_CLOPS      IYKNTGMTSFDVVAMVRRVA-------KMKKVGHTGTLDPEASGVLPVCLGK-ATKIIDY
TRUB_CLOK5      INKPEGMTSFDVVRKVRFML-------KNEKVGHTGTLDPMASGVLPICVGR-ATKFADY
TRUB_ALKOO      ILKPPGMTSHDVVSVVRKKL-------NMKKVGHTGTLDPNAAGVLPICIGQ-ATKISQF
TRUB_LACP7      VYKEKGFTSFDVCAKLRGIL-------KQKKIGHTGTLDPDAEGVLPVCVGN-ATKLCDL
TRUB_CLOD6      ILKPTGMTSHDVVSRVRKIL-------NIKKVGHTGTLDPDASGVLPICIGK-ATKVCEV
TRUB_FUSNN      INKPKGITSFDVIRKLKKFL-------KTKKIGHTGTLDPLAIGVMLVCVGK-ATKLASD
TRUB_GEOTN      LNKPKGMTSHDCVAKVRRLL-------GIKKVGHTGTLDPNVSGVLPICLGK-ATRIAEF
TRUB_GEOKA      LNKPKGMTSHDCVAKVRRLL-------GVKKAGHTGTLDPNVSGVLPICLGK-ATRIAEF
TRUB_BACHK      LHKPKGMTSHDCVFKLRKIL-------REKRIGHTGTLDPDVTGVLPICVGR-ATKIAQF
TRUB_BACAH      LHKPKGMTSHDCVFKLRKIL-------REKRIGHTGTLDPDVTGVLPICVGR-ATKIAQF
TRUB_BACCZ      LHKPKGMTSHDCVFKLRKIL-------REKRIGHTGTLDPDVTGVLPICVGR-ATKIAQF
TRUB_BACAN      LHKPKGMTSHDCVFKLRKIL-------REKRIGHTGTLDPDVTGVLPICVGR-ATKIAQF
TRUB_BACC1      LHKPKGMTSHDCIFKLRKIL-------REKRIGHTGTLDPDVTGVLPICVGR-ATKIAQF
TRUB_BACCR      LHKPKGMTSHDCVFKLRKIL-------REKRIGHTGTLDPDVTGVLPICVGR-ATKIAQF
TRUB_BACCN      LHKPKGMTSHDCVFKLRKIL-------REKRIGHTGTLDPDVTGVLPICVGR-ATKIAQF
TRUB_BACVZ      LHKPVGMTSHDCVMKIRKLL-------KTKKVGHTGTLDPEVSGVLPICVGR-ATKIVEY
TRUB_BACSU      LHKPVGMTSHDCVMKIRKLL-------KTKKVGHTGTLDPEVSGVLPICVGR-ATKIVEY
TRUB_BACLD      LHKPVGMTSHDCVMKIRKLL-------KTKKVGHTGTLDPEVSGVLPICVGR-ATKIVEY
TRUB_BACP2      LHKERGMTSHDCVFKVRKIL-------HTKKVGHTGTLDPEVSGVLPICIGR-ATKIVEY
TRUB_BACHD      LAKPRGMTSHDCVAKLRRLL-------KTKKVGHTGTLDPDVYGVLPVCIGH-ATKVAQY
TRUB_BACSK      LDKPKGWTSHDCVHQMRKWF-------QTRKVGHTGTLDPEVDGVLPICIGK-ATKVVKY
TRUB_OCEIH      LWKPKGLTSHDCVMRCRRYF-------KTKKVGHTGTLDPEVEGVLPICIGQ-ATKIVPF
TRUB_LISMF      LWKERGMTSHDCVFKLRKIL-------HTKKVGHTGTLDPEVEGVLPICIGR-ATKLAEY
TRUB_LISMO      LWKERGMTSHDCVYKLRKIL-------HTKKVGHTGTLDPEVEGVLPICIGR-ATKLAEY
TRUB_LISIN      LWKERGMTSHDCVFKLRKIL-------HTKKVGHTGTLDPEVEGVLPICIGR-ATKLAEY
TRUB_LISW6      LWKERGMTSHDCVFKLRKIL-------HTKKVGHTGTLDPEVEGVLPICIGR-ATKLAEY
TRUB_STAEQ      VFKERGLTSHDVVFKLRKIL-------KMKKIGHTGTLDPEVNGVLPICLGD-ATKVSDY
TRUB_STAES      VFKERGLTSHDVVFKLRKIL-------KMKKIGHTGTLDPEVNGVLPICLGD-ATKVSDY
TRUB_STAAT      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAA3      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAA8      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAAC      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAAE      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAAS      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAAW      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAAR      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAA1      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAA2      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAAM      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAAN      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAA9      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAAB      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVAGVLPVCIGN-ATRVSDY
TRUB_STAHJ      VYKERGLTSHDVVFKLRKIL-------KTKKIGHTGTLDPEVSGVLPVCIGT-ATRVSDY
TRUB_STAS1      VFKDRGLTSHDVVFKLRKIL-------KTKKVGHTGTLDPEVSGVLPICIGS-ATKVSDY
TRUB_LACPL      LYKPRGMTSFDCVAKIRRLY-------QTRKVGHSGTLDPNVDGVLPICIGN-ATKVVQF
TRUB_LACBA      LYKERGLTSFDCVAKLRHIL-------QTKKVGHSGTLDPSVDGVLPICIGS-ATKVVPY
TRUB_LACP3      LYKPTGMTSADAVYHARKIL-------GIKKIGHSGTLDPNVDGVLPLAIGA-GTKAVPQ
TRUB_PEDPA      INKERGMTSHDVVAKVRGIL-------RTKKVGHSGTLDPSVDGVLPICVGR-ATKVVDY
TRUB_LACSS      LYKERGMTSNDCVFKVRRIL-------HMKKVGHSGTLDPNVDGVLPICIGQ-ATKVVDQ
TRUB_LACS1      LYKERGMTSNDAVIKCRKIF-------KTRKIGHSGTLDPEVDGVLPICVGK-ATKVVNY
TRUB_LACRD      LYKERGMTSFACVSRLRQIL-------KTKKIGHSGTLDPGVAGVLPICVGN-ATKVVDY
TRUB_STRR6      LKKEAGMTSHDAVFKLRKIL-------GTKKIGHGGTLDPDVVGVLPIAVGK-ATRMVEF
TRUB_STRP2      LKKEAGMTSHDAVFKLRKIL-------GTKKIGHGGTLDPDVVGVLPIAVGK-ATRMVEF
TRUB_STRPN      LKKEAGMTSHDAVFKLRKIL-------GTKKIGHGGTLDPDVVGVLPIAVGK-ATRMVEF
TRUB_STRGC      LKKEAGMTSHDAVFKLRKIL-------GTKKIGHGGTLDPDVVGVLPIAVGK-ATRMVEF
TRUB_STRSV      LRKEAGMTSHDAVFKLRKIL-------KTKKIGHGGTLDPDVVGVLPIAVGK-ATRLVEF
TRUB_STRT2      LKKEAGMTSHDAVFKLRKIL-------HEKKIGHGGTLDPDVTGVLPIAVGK-ATRVIEY
TRUB_STRT1      LKKEAGMTSHDAVFKLRKIL-------HEKKIGHGGTLDPDVTGVLPIAVGK-ATRVIEY
TRUB_STRA1      LKKEAGMTSHDAVFKLRKIL-------HTKKIGHGGTLDPDVVGVLPIAVGK-ATRVIEY
TRUB_STRA3      LKKEAGMTSHDAVFKLRKIL-------HTKKIGHGGTLDPDVVGVLPIAVGK-ATRVIEY
TRUB_STRA5      LKKEAGMTSHDAVFKLRKIL-------HTKKIGHGGTLDPDVVGVLPIAVGK-ATRVIEY
TRUB_STRMU      LKKEAGMTSHDAVFKLRKIL-------KEKKIGHGGTLDPDVIGVLPIAVGK-ATRVLEY
TRUB_STRP1      LKKEAGMTSHDAVFKLRKLL-------QEKKIGHGGTLDPDVVGVLPIAVGK-ATRVIEY
TRUB_STRP8      LKKEAGMTSHDAVFKLRKLL-------QEKKIGHGGTLDPDVVGVLPIAVGK-ATRVIEY
TRUB_STRPF      LKKEAGMTSHDAVFKLRKLL-------QEKKIGHGGTLDPDVVGVLPIAVGK-ATRVIEY
TRUB_STRP6      LKKEAGMTSHDAVFKLRKLL-------QEKKIGHGGTLDPDVVGVLPIAVGK-ATRVIEY
TRUB_STRPB      LKKEAGMTSHDAVFKLRKLL-------QEKKIGHGGTLDPDVVGVLPIAVGK-ATRVIEY
TRUB_STRPC      LKKEAGMTSHDAVFKLRKLL-------QEKKIGHGGTLDPDVVGVLPIAVGK-ATRVIEY
TRUB_STRP3      LKKEAGMTSHDAVFKLRKLL-------QEKKIGHGGTLDPDVVGVLPIAVGK-ATRVIEY
TRUB_STRPM      LKKEAGMTSHDAVFKLRKLL-------QEKKIGHGGTLDPDVVGVLPIAVGK-ATRVIEY
TRUB_STRPG      LKKEAGMTSHDAVFKLRKLL-------QEKKIGHGGTLDPDVVGVLPIAVGK-ATRMIEY
TRUB_STRPD      LKKEAGMTSHDAVFKLRKLL-------QEKKIGHGGTLDPDVVGVLPIAVGK-ATRVIEY
TRUB_LACLM      VYKEAGWTSFDVVAKLRGIL-------KTKKIGHGGTLDPSVTGVLPIAVGK-STRLLEY
TRUB_LACLS      VYKEAGWTSFDVVAKLRCIL-------KTKKIGHGGTLDPSVTGVLPIAVGK-STRLLEY
TRUB_LACLA      VYKEAGWTSFDVVAKLRGIL-------KTKKIGHGGTLDPSVTGVLPVAVGK-STRLLEY
TRUB_LACDB      IDKAAGMTSGDVVYKLRRLL-------KQKKIGHAGTLDPEVTGVLPIALGQ-ATKLIEL
TRUB_LACDA      IDKAAGMTSGDVVYKLRRLL-------KQKKIGHAGTLDPEVTGVLPIALGQ-ATKLIEL
TRUB_LACGA      VNKPRGVTSSDCVYKLRKIL-------QIRKIGHAGTLDPEVNGVLPIAIGQ-ATKLIEL
TRUB_LACJO      VNKPRGVTSSDCVYKLRKIL-------QIRKIGHAGTLDPEVNGVLPIAIGQ-ATKLIEL
TRUB_LACAC      IDKDKGMTSADVVYHLRRAL-------HIRKIGHAGTLDPEVTGVLPIAIGQ-ATKLIEL
TRUB_OENOB      VDKPAGLTSFDVVAKLRKIF-------QQKQVGHTGTLDPSVTGLLVIVLGK-ATKLIDY
TRUB_SYMTH      LLKPPGMTSHDVVAFVRRAL-------GVKKAGHTGTLDPGVAGVLPVCVGR-ATRLAEY
TRUB_MOOTA      VLKPPGLTSHDVVQNLRRLL-------KVKRIGHGGTLDPLAAGVLPVAVGT-ATRLLEY
TRUB_PELTS      VLKPPGMSSHDVVDRIRRIF-------GVKKAGHTGTLDPGAAGVLVVCLGV-ATRLARF
TRUB_CARHZ      LLKPPGMTSHDVVAYVRKKL-------KTGKVGHLGTLDPAAAGVLPVAVGQ-ATRLIEY
TRUB_CALS4      VLKPPGMTSHDVVDFIRKIY-------GIKKVGHTGTLDPDAAGVLPVCMGR-ATKFTSY
TRUB_MYCMO      LRKTKNISSFNFINNFKKTKG-------FKKIGHCGTLDPLATGLLIVATDE--DTKLID
TRUB_MYCH2      LYKPKKISSAKFLRQWSKTNL-------IKKAGHAGTLDPLASGLLLVATED--DTKLLQ
TRUB_MYCPU      IYKEKGISSFKAIKDFAWQNN-------IKKIGHSGTLDPEATGLLLLASDE--DTKLLD
TRUB_WOLSU      GYKPMFMSSNHYLQRLKRRFG-------VKKAGYSGTLDPFAKGVLVVAFGH--YTRLFD
TRUB_HELHP      AYKPPFLSSNACLSRLKKHFG-------MSKAGYLGTLDPFAKGVLVVGFGS--YTRLFP
TRUB_SULNB      VNKPIFRTSNGYMGYVKRKYN-------TKKVGFSGTLDPFATGCLIVATGQ--YTKLFQ
TRUB_NITSB      AYKPPFVSSNAFLHKIKKRYR-------VKKAGFSGTLDPFACGTLIIAFGA--YTKLFR
TRUB_SULDN      AYKPAGIGSNLFLSRIKREYK-------TKKAGFSGTLDPFAKGVLIIGMGS--YTKLFR
TRUB_CAMJJ      AFKPRGLSSNAFLSTLKKKYK-------NKKAGYSGTLDPFAKGVLIVAFGQ--YTKLFR
TRUB_CAMJ8      AFKPRGLSSNAFLSTLKKKYK-------NKKAGYSGTLDPFAKGVLIVAFGQ--YTKLFR
TRUB_CAMJE      AFKPRGLSSNAFLSTLKKKYK-------NKKAGYSGTLDPFAKGVLIVAFGQ--YTKLFR
TRUB_CAMJR      AFKPKGLSSNAFLSTLKKKYK-------NKKAGYSGTLDPFAKGVLIVAFGQ--YTKLFR
TRUB_CAMJD      AFKPRGLSSNSFLSTLKKKYK-------NKKAGYSGTLDPFAKGVLIVAFGQ--YAKLFR
TRUB_CAMC1      ANKPAGMSSNHFLGRLKRKYG-------VKKAGFSGTLDPFASGCLIVAFGS--YTKFFR
TRUB_CAMC5      ANKPTGLSSNQFLNRLKRKYG-------VKKAGFSGTLDPFASGCLIVAFGS--YTKFFR
                  *     :                       *. * **  . * :              

TRUB_UREPA      KLILDNKSYIAEIKFGTSTNTYDAAGEIV-SSTNRMVT--------LTE-----------
TRUB_UREP2      KLILDNKSYIAEIKFGTSTNTYDAAGEIV-SSTNRMVT--------LTE-----------
TRUB_MYCPE      ELILENKKYVAEIQFNYQTSTYDAEGEIT-NYTTRKIH--------EKT-----------
TRUB_MYCMS      YLLNANKAYQVKIKLFTLTDSFDAEGNIIQTQTPFNIS--------LDQ-----------
TRUB_MYCCT      YLLNANKAYQVKIKLFTLTDSYDGEGNIIQTQIPFDIS--------LDQ-----------
TRUB_MESFL      YFLNENKAYEVTMKLFQATDTYDSDGSIIEEQEPFKIE--------QEQ-----------
TRUB_AYWBP      LFDKLSKTYQGTFLFNKHYDTLDVKGKLL-DTKNIPLN--------DFA-----------
TRUB_ONYPE      LFDKLPKTYQGTFLFNKHYDTLDVTGKLL-DTKNTPLT--------DCN-----------
TRUB_ACHLI      LFDELDKQYDGTIVLGKSYDTDDTTGEVI-NEAPVSFT--------EDD-----------
TRUB_CAUVC      LMDA-DKAYRFTIAWGRDTTTLDREGETTGTS---------DVRPTREQ-----------
TRUB_CAUSK      LMDA-DKAYRFTIAWGRSTTTLDREGETTDSS---------DVRPTREQ-----------
TRUB_MARMM      AVEG-SKIYRFTIKWGERTTTLDREGEVVATS---------DVRPTPEE-----------
TRUB_BRUSI      VMDG-TKVYRFTVTWGEERSTDDLEGQPTKTS---------DKRPSREE-----------
TRUB_BRUAB      VMDG-TKVYRFTVTWGEERSTDDLEGQPTKTS---------DKRPSREE-----------
TRUB_BRUA2      VMDG-TKVYRFTVTWGEERSTDDLEGQPTKTS---------DKRPSREE-----------
TRUB_BRUSU      VMDG-TKVYRFTVTWGEERSTDDLEGQPTKTS---------DKRPSREE-----------
TRUB_BRUO2      VMDG-TKVYRFTVTWGEERSTDDLEGQPTKTS---------DKRPSREE-----------
TRUB_BRUC2      VMDG-TKVYRFTVTWGEERSTDDLEGQPTKTS---------DKRPSREE-----------
TRUB_BRUME      AMDG-TKVYRFTVTWGEERSTDDLEGQPTKTS---------DKRPSREE-----------
TRUB_OCHA4      VMDG-TKIYRFTVSWGEERSTDDLEGVATKTS---------DNRPSRAD-----------
TRUB_RHILO      VQDG-AKIYRFTVAWGQERSTDDLEGPVTKSS---------DLRPAEAE-----------
TRUB_CHESB      VMEG-AKVYRFTVAWGEERSTDDLEGPVTKSC---------DKVPVEED-----------
TRUB_RHIME      VMDG-RKIYEFTVAWGEERSTDDLEGEAVRSS---------AARPEEEA-----------
TRUB_SINMW      VMDG-RKIYEFTVAWGEERSTDDLEGEVVRSS---------ADRPAEEA-----------
TRUB_RHIEC      VMDG-RKIYEFTVSWGEERATDDLEGDVTQSS---------ERRPTEQQ-----------
TRUB_RHIL3      VMDG-RKIYEFTVSWGEERATDDLEGDVTKSS---------DKRPSEQQ-----------
TRUB_AGRFC      VMDG-RKIYEFTVTWGEQRATDDLEGEVVESS---------DQRPEEQA-----------
TRUB_BARHE      VMQG-TKTYRFHIAWGEERSTDDLEGEITHTS---------SKRPTREE-----------
TRUB_BARQU      VMQG-TKTYRFQIAWGEERSTDDLEGEITHIS---------SKRPTQEE-----------
TRUB_BART1      VMQG-KKTYRFHIAWGQERSTDDLEGEITKTS---------LKRPTQEE-----------
TRUB_BARBK      VMEG-TKTYHFHVAWGEERSTDDLEGVVTKTS---------SKRPTQEE-----------
TRUB_BRADU      VMDG-RKRYQFTVCWGEERDTDDIEGRVTATS---------ELRPTREA-----------
TRUB_RHOPA      VMDG-RKRYRFTVAWGEERDTDDTEGRAVATS---------PDRPTAEA-----------
TRUB_GLUDA      IMDG-TKRYEFTLRLGEARDTDDAEGAVIETS---------DVRPTDDA-----------
TRUB_GLUOX      IMDA-TKRYRFTLTFGESRTTDDLEGEVLATS---------PNRPTDDQ-----------
TRUB_RHORT      VMDG-TKVYHMVVGWGEARDTDDREGKVIDTS---------DVRPDAQA-----------
TRUB_RUEST      ITDA-MKAYTFTVTLGAATNTDDAEGEVIATS---------AERPTDDD-----------
TRUB_RUEPO      ITDA-LKAYVFTVRLGQATNTDDAEGEVIASS---------DLRPTDEQ-----------
TRUB_ROSDO      VTGA-LKAYEFEIRLGQATNTDDAEGEVIAQS---------DLRPTEDE-----------
TRUB_RHOS4      ITDA-LKCYRFMVRLGLSTRTDDASGEVIATS---------EARPTDAE-----------
TRUB_RHOS1      ITDA-LKCYRFMVRLGLSTRTDDASGEVIATS---------EARPTDAE-----------
TRUB_RHOS5      ITDA-LKCYRFMVRLGVGTRTDDASGEVIATS---------EARPEDPE-----------
TRUB_DINSH      VTDA-LKAYEFTVRLGQATNTDDGEGEVTETS---------DARPSDDE-----------
TRUB_JANSC      MSDD-LKAYTFRVRLGVSTKTDDAEGEVLETS---------DTRPTDTE-----------
TRUB_PARDP      LTDA-LKAYDFTVSWGAETSTDDASGGVVKTS---------DARPDEAA-----------
TRUB_EHRRW      AVDV-QKSYIFTVQWGEQRTTDDASGEIIKKS---------NIVPHFEE-----------
TRUB_EHRRG      AVDV-QKSYIFTVQWGEQRTTDDASGEIIKKS---------NIVPHFEE-----------
TRUB_EHRCJ      AVDV-IKSYLFTVQWGEQRTTDDAEGEIVDKS---------DMIPCVEN-----------
TRUB_EHRCR      AVDV-VKSYLFTVQWGEQRTTDDIEGKIVAKS---------DIVPSSED-----------
TRUB_ANAMM      AVDG-LKSYAVTVQWGSQRSTDDAEGEIIKTS---------SLRPSADS-----------
TRUB_ZYMMO      ALNS-DKVYAFTLAFGAETDSLDREGSITAQS---------DKRPTREE-----------
TRUB_RICB8      LIDA-KKTYIFTVKFGKQTDSGDYAGKVIAIT---------DYIPSKEN-----------
TRUB_RICBR      LIDA-KKTYIFTVKFGKQTDSGDYAGKVIAIT---------DYIPSKEN-----------
TRUB_RICRS      LIDA-RKTYIFTVKFGMQTNSGDCAGKVIATK---------DCVPSQEE-----------
TRUB_RICRO      LIDA-RKTYIFTVKFGMQTNSGDCAGKVIATK---------DCVPSQEE-----------
TRUB_RICCK      LIDA-KKSYIFTVQFGKQTDSGDYAGKVIATK---------DYIPYKEE-----------
TRUB_RICAH      LIDS-RKTYIFTIKFGLQTDSGDYTGTVIATK---------NYIPSQEE-----------
TRUB_RICTY      LIDA-KKTYIFSVKFGAQTDNGDYTGKVIASK---------NYIPSQEE-----------
TRUB_BORAP      FMSL-DKEYVAEFRFGLETDTLDPNGRIVNKT---------DYIPNLED-----------
TRUB_BORBP      FISL-DKEYVAEFRFGLETDTLDSNGRIVNKA---------DYIPSVED-----------
TRUB_BORBU      FTSL-DKEYVAEFRFGLETDTLDPNGRIVSKT---------DYIPNVED-----------
TRUB_TREPA      MTRL-EKSYEARIQFGVQTDTLDPEG-AVVRC---------SLFPTFAR-----------
TRUB_TREDE      ISAE-KKTYEAWVEFGTETDTLDPEG-EPVLT---------APLPSYKN-----------
TRUB_ARTS2      YIVGTSKTYTATIRLGESTVTDDAEGEVVSSHS--------AAAVTEGA-----------
TRUB_PAEAT      YIVGTSKTYTATIRLGETTITDDAEGEVTEART--------AAHITDDA-----------
TRUB_THEFY      YLALTEKVYEATIRLGQSTTTDDAEGELLERRP--------ADHIDEAA-----------
TRUB_STRAW      HLALTEKEYLGTIRLGQNTLTDDAEGEIISSTD--------ASRVTRDA-----------
TRUB_STRCO      HLALTEKEYLGTIRLGQTTLTDDAEGEITGSRD--------ASKVTWEA-----------
TRUB_LEIXX      YIVGAEKEYVGTIRLGAATTTDDIEGEILERAEPAA-----LAAVAESS-----------
TRUB_CUTAK      HLSLHDKDYTATVRLGVGTVTDDAEGDVTVTTD--------ASAIDDRA-----------
TRUB_CORGL      HMVASTKAYDATIRLGAATSTDDAEGEVISTTDA--------SGLDHST-----------
TRUB_CORGB      HMVASTKAYDATIRLGAATSTDDAEGEVISTTDA--------SGLDHRA-----------
TRUB_COREF      HLVATTKAYDATIRLGASTTTDDREGDVVFSADA--------STLDDEQ-----------
TRUB_CORDI      HMVASTKSYTATIRLGAATTTDDREGETITSASPDQ-----LAGITETK-----------
TRUB_CORJK      HVVTHDKRYEATVRLGVATHTDDAQGDVLSTASPQD-----LQALTEQQ-----------
TRUB_MYCTU      LLTAAPKSYAATIRLGQTTSTEDAEGQVLQSVPA--------KHLTIEA-----------
TRUB_MYCBP      LLTAAPKSYAATIRLGQTTSTEDAEGQVLQSVPA--------KHLTIEA-----------
TRUB_MYCBO      LLTAAPKSYAATIRLGQTTSTEDAEGQVLQSVPA--------KHLTIEA-----------
TRUB_MYCTA      LLTAAPKSYAATIRLGQTTSTEDAEGQVLQSVPA--------KHLTIEA-----------
TRUB_MYCA1      LLTAAAKSYSATIRLGQATSTDDAEGDVVRSVDA--------RHLTSQA-----------
TRUB_MYCPA      LLTAAAKSYSATIRLGQATSTDDAEGDVARSVDA--------RHLTSQA-----------
TRUB_MYCLE      LLAGASKEYVATIRLGQTTSTEDAEGELLQCVSA--------RHVTDEA-----------
TRUB_MYCUA      LLIATSKSYAATIRLGQTTSTEDAEGEPLASVSA--------EHVAPEA-----------
TRUB_NOCFA      LLTLTTKAYTATIRLGSATTTDDAEGEVLTTVPA--------GHLGDAE-----------
TRUB_RHOJR      FLALTTKAYTATIRLGQATTTDDAEGEVVASADA--------SGVTDEE-----------
TRUB_BIFLO      AIVAHDKTYEATIRLGLRTTTDDAEGEVLVDGEARSRWQTLSAQLTEGGQSGEPTALPTA
TRUB_DEIRA      FMEHDTKEYLAWVSLGAGTPTLDAEGPIEQQAEVPP--------LDEDH-----------
TRUB_DEIGD      FMEADSKEYLAWIALGGTSPTLDAEGPLTEVVPVSP--------PSEEE-----------
TRUB_THET2      FLSGEDKEYIAWVSFGATTPTLDAEGPISEEAPAR---------FDRKD-----------
TRUB_THET8      FLSGEDKEYIAWVSFGATTPTLDAEGPISEEAPAR---------FDRKD-----------
TRUB_TROWT      YMSNLDKRYIATITLGTQTTTDDSEGEIIYSAPKPS-----LDKITLES-----------
TRUB_TROW8      YMSNLDKRYIATITLGTQTTTDDSEGEIIYSAPKPS-----LDKITLES-----------
TRUB_TRIV2      YLP-SDKAYKATVRFGVQTTTDDLQGEIISSQPCGG--------LSLSE-----------
TRUB_NOSS1      YLP-SDKAYKATVRFGVQTTTDDLQGEIITSQPCRG--------LSLSE-----------
TRUB_TRIEI      FLP-SEKAYFGTVKFGIITTTDDLEGEIVQSAPVPE--------LMLSD-----------
TRUB_ACAM1      YLP-DQKTYQATIQFGLTTTTDDLAGDILSEQSANH--------LAQEV-----------
TRUB_SYNP6      YLP-SGKTYVGTIRFGLQTSTDDLTGDRLAEADTSH--------LSREA-----------
TRUB_SYNE7      YLP-SGKTYVGTIRFGLQTSTDDLTGDRLAEADTSH--------LSREA-----------
TRUB_GLOVI      FLS-EGKVYRATVRFGLSTDTDDLEGNILADAGAAD--------LDLGR-----------
TRUB_THEEB      YLS-DRKAYIGTVRFGMSTTTDDITGEICQEQGASH--------LTLAA-----------
TRUB_SYNY3      YLP-GAKQYQALIRFGVRTDSDDLAGEVLESKNVSY--------LTLAA-----------
TRUB_MICAN      YLP-ENKAYRAKIQLGLSTDTDDITGKAIATCPWPD--------LTLEA-----------
TRUB_PROMT      YLQ-GSKAYRGIIQLGATTNTDDMQGEIIESKAWPL--------ITQNY-----------
TRUB_PROM1      YLQ-GSKAYTGIIQLGATTNTDDMQGEIIESKAWPL--------ITQND-----------
TRUB_PROMA      FLP-SPKTYEGTIKLGISTNTDDLTGETISEHSWDQ--------VKENS-----------
TRUB_SYNPW      YLP-GDKTYRGVIQLGITTNTDDLEGEISSRQPLPA--------LSSAE-----------
TRUB_SYNPX      YLP-GDKTYRGVIQLGSITSSDDLEGELLRQAPWPD--------LQPEE-----------
TRUB_SYNS3      YLP-GEKTYRGVIQLGTSTSTDDLQGEIVAVQNWPD--------LSVEE-----------
TRUB_PROMM      YLP-GAKSYRGSIQLGQRTSSDDQQGDLISKQAWPE--------LNTAE-----------
TRUB_PROMP      YLP-QGKTYIGQIQLGIRTKTDDMQGEILNKKDWPV--------LSHKQ-----------
TRUB_PROM5      YLP-QGKTYIGQIQLGIRTKTDDIQGEIINKKEWPI--------LSNAQ-----------
TRUB_PROM0      YLP-QGKTYIGQIKLGIRTNTDDIHGEIINQKSWPK--------ISDEK-----------
TRUB_PROMS      YLP-QGKTYIGEIKLGIRTSTDDIQGEIISQKSWPK--------ISYKQ-----------
TRUB_PROM9      YLP-QGKTYIGQIKLGIRTNTDDIHGEIINQKCWPK--------ISDEK-----------
TRUB_PROM2      YLP-QSKTYIGKIKLGIRTNTDDIHGEIINQKSWPK--------ISEEK-----------
TRUB_BACFN      EFQYHTKEYVATIQLGATTPSYDLEHEIDATYPTEH--------ITREL-----------
TRUB_BACFR      EFQYHTKEYVATIQLGATTPSYDLEHEIDATYPTEH--------ITREL-----------
TRUB_BACTN      EFQYHTKEYVATLRLGATTPSYDLEHEIDATYPTGH--------ITREL-----------
TRUB_BACV8      EFQYHTKEYIATLQLGATTPSFDLEKEIDATYPTEH--------ITREL-----------
TRUB_PARD8      EFQYQTKEYIATLKLGETTPSFDLEKEIDAVYPTEH--------ITREL-----------
TRUB_FLAJ1      ELQGQAKEYTGTFYIGATTPSYDLETEIDQTFPTEH--------INEVL-----------
TRUB_PELLD      SLEGLDKEYLAVIKLGARTASHDVETPETDHTPAGH--------ITLAM-----------
TRUB_CHLPM      TLEGLDKVYDAVIRLGARTLSHDSESEEYGLRDVTH--------LDEGA-----------
TRUB_CHLCH      QLEQLDKVYDGVIKLGAITASHDTETPEEQLCDVAH--------LSEAE-----------
TRUB_CHLTE      SLELLDKAYEGTIRLGAKTVSHDTESEEYDLRDVPS--------LDERA-----------
TRUB_RHOBA      WVLQHGKRYLADFRLGVSSESGDLESELVTQTDVKL--------PTAAE-----------
TRUB_CUPMC      LLDA-DKTYEAKVRLGATTTTGDAEGEIVVE---------RLVTCDHDA-----------
TRUB_CUPPJ      LLDA-DKTYEAVVRLGQKTTTGDAEGEVVVE---------RPVSCDRAG-----------
TRUB_RALSO      LLEA-DKTYEAVVRLGIRTSTADAEGEVLSE---------RPVAVTPEQ-----------
TRUB_BURPS      LLEA-DKTYEATMRLGVRTTTGDAEGDVLDT---------RDVSCDEAA-----------
TRUB_BURMA      LLEA-DKTYEATMRLGVRTTTGDAEGDVLDT---------RDVSCDEAA-----------
TRUB_BURP1      LLEA-DKTYEATMRLGVRTTTGDAEGDVLDT---------RDVSCDEAA-----------
TRUB_BURP0      LLEA-DKTYEATMRLGVRTTTGDAEGDVLDT---------RDVSCDEAA-----------
TRUB_BURM7      LLEA-DKTYEATMRLGVRTTTGDAEGDVLDT---------RDVSCDEAA-----------
TRUB_BURP6      LLEA-DKTYEATMRLGVRTTTGDAEGDVLDT---------RDVSCDEAA-----------
TRUB_BURL3      LLEA-DKTYEATMRLGQRTATGDAEGEVIDT---------RPVECDRAA-----------
TRUB_VEREI      QLDA-PKTYEAIALPGVTTSTGDAEGAVLQRC--AV----DPAQLAPER-----------
TRUB_DECAR      LLDA-DKTYEAVLKLGVTTDSGDAEGQVTST---------AMVDIQKEQ-----------
TRUB_BORPE      MLEA-DKTYQATLQFGEETDSGDLTGHIVARA--PD----GFAGVEEAA-----------
TRUB_BORBR      MLEA-DKTYQATLQFGEETDSGDLTGHIVARA--PD----GFAGVEEAA-----------
TRUB_BORPA      MLEA-DKTYQAMLQFGEETDSGDLTGHIVARA--PD----GFAGVEEAA-----------
TRUB_BORA1      MLNA-DKTYRATLQFGEETDSGDLTGNIVARA--PE----DFPGVEEAN-----------
TRUB_AROAE      LLDA-DKAYEATVRLGIETDTGDAEGAAIAT---------APVHVTDDS-----------
TRUB_THIDA      LLDA-DKRYRAILQLGVTTRTGDPEGEVLAT---------REVRATCAD-----------
TRUB_CHRVO      LLDA-DKGYRATVRFGVVTTTGDVEGEVVSE---------RPVEFGREQ-----------
TRUB_NEIMB      LLDA-DKAYTATLKLGEASSTGDAEGEIIAT---------ARADISLAE-----------
TRUB_NEIG1      LLDA-DKAYTATLKLGEASSTGDAEGEIIAA---------ARADISLAE-----------
TRUB_NEIMA      LINA-DKAYTATLKLGEASSTGDAEGEIVAT---------ARADISLAE-----------
TRUB_NITMU      LLGA-DKTYEAVLRLGYMSTTGDAEGEISIAAGMES----QYVDLTREK-----------
TRUB_NITEU      LLGV-DKTYIASLRLGYISNTGDAEGEIRQVVGSDV----NPPDF--GQ-----------
TRUB_PSEAB      LLDA-DKGYETVMRMGITTTTGDAEGELLAER--------DVTVG-RDD-----------
TRUB_PSEAE      LLDA-DKGYETVMRMGITTTTGDAEGELLAER--------DVTVG-RDD-----------
TRUB_PSEA7      LLDA-DKGYETVMRMGITTTTGDAEGEMLAER--------EVTVG-RDD-----------
TRUB_PSEF5      LLDS-DKGYETLAQLGKTTTTADAEGEVLQTR--------EVTVG-RAD-----------
TRUB_PSEPF      LLDS-DKGYETLAQLGKTTTTADAEGEVLQER--------PVTVG-QAD-----------
TRUB_PSE14      LLDS-DKSYETLAQLGKTTTTADSEGEVLLTR--------PVTVG-RDD-----------
TRUB_PSEU2      LLDS-DKSYETLAQLGKTTTTADSEGEVLLTR--------PVTVG-RDD-----------
TRUB_PSEP1      LLDS-DKGYETVMQMGQTTNTGDAEGEVLQTR--------DVTVG-RAD-----------
TRUB_PSEPG      LLDS-DKGYETVMQMGQTTNTGDAEGEVLQTR--------DVTVG-RAD-----------
TRUB_PSEE4      LLDS-DKGYETVMQMGQTTSTADAEGEVLQTR--------EVTVG-RAD-----------
TRUB_PSEMY      LLDA-DKGYETVAQLGVTTTTGDAEGEVLERR--------PVTVG-RPE-----------
TRUB_PSEU5      LLDA-DKAYETVMQLGVTTTTADAEGEVLERK--------PVAVT-REQ-----------
TRUB_COXBU      LLEA-DKSYSVKGRLGVRTASGDSESPILTER--------PIPKLTKRA-----------
TRUB_COXBR      LLEA-DKSYSVKGRLGVRTASGDSESPILTEC--------PIPKLTKRA-----------
TRUB_COXBN      LLGA-DKSYSVKGRLGVRTASGDSESPILTER--------PIPKLTKRA-----------
TRUB_NITOC      LLEA-DKRYQVMCRLGVVTTTGDADGEVLETH--------PVNELDRDE-----------
TRUB_METFK      LLDA-DKSYRALVTLGSTTTTGDVEGEIMTQA--------PVTVT-QSE-----------
TRUB_ACIAD      LLDS-TKRYQTVVKLGQVTTTGDVEGKVVQSR--------SVPPLTRDM-----------
TRUB_MARMS      LLDA-DKRYLTCIQLGKRTTTGDREGEVLTED--------SVPTLTDES-----------
TRUB_LEGPC      LLNA-DKSYETIGRLGSKTNTADCTGEVIFCI--------ENYTVSHEE-----------
TRUB_LEGPA      LLNA-DKSYETIGRLGSKTNTADCTGEVIFCI--------ENYTVSHEE-----------
TRUB_LEGPH      LLNA-DKSYETIGRLGIKTNTADCTGEVIFCI--------ENYTVSHEE-----------
TRUB_LEGPL      LLNA-DKSYETIGRLGSKTNTADCTGEVIFCI--------ENYTVSHEE-----------
TRUB_MARHV      MLDS-DKAYITTARLGIRTETGDSEGAVVEEK--------PVPQFSEDE-----------
TRUB_HAHCH      LLDS-DKEYVTCAYLGRTTTTSDADGDIIAES--------PVPGLSVSD-----------
TRUB_SACD2      LLDS-DKEYVSTFRFGEVTDTADSDGEVLESI--------DASKLTKAD-----------
TRUB_XANAC      LLGS-AKAYDAEIVLGVTTDTDDADGESLRER--------AVPDLSEAD-----------
TRUB_XANC5      LLGS-AKAYDAEIVLGVTTDTDDADGQPLRER--------AVPDLSEAD-----------
TRUB_XANOM      LLGS-AKAYDAEIVLGVTTDTDDADGEPLRER--------AVPDVSEAD-----------
TRUB_XANOR      LLGS-AKAYDAEIVLGVTTDTDDADGEPLRER--------AVPDVSEAD-----------
TRUB_XANCP      LLGS-AKAYDAEIVLGVTTDTDDADGQPLRER--------SVPALSEAA-----------
TRUB_XANC8      LLGS-AKAYDAEIVLGVTTDTDDADGQPLRER--------SVPALSEAA-----------
TRUB_XYLFA      LLGS-TKAYDADVLLGTTTTTDDAEGAVLLTR--------PVPTLDAEM-----------
TRUB_XYLFT      LLDS-TKAYDADVLLGTTTTTDDAEGAVLLTR--------PVPTLDAEM-----------
TRUB_METCA      LLDS-DKRYRVLARLGVTTDTGDADGEVRLRT--------PVPALDEPA-----------
TRUB_SERP5      LLDS-DKRYRVIARLGQRTDTSDADGQIVQER--------PVSF-TQAQ-----------
TRUB_PECAS      LLDS-DKRYRVIARLGQRTDTSDADGNVIEER--------AIGF-SATD-----------
TRUB_ECOL5      LLDS-DKRYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_ECOL6      LLDS-DKRYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_ECOLI      LLDS-DKRYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_ECOHS      LLDS-DKRYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_ECOUT      LLDS-DKRYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_SHIF8      LLDS-DKRYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_SHISS      LLDS-DKRYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_ECOLC      LLDS-DKRYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_ECOK1      LLDS-DKRYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_ECO57      LLDS-DKRYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_ECO24      LLDS-DKRYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_SHIDS      LLDS-DKLYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_SHIFL      LLDS-DKRYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_SHIBS      LLDS-DKRYRVIARLGQRTDTSDADGQIVEER--------PVTF-SAEQ-----------
TRUB_CITK8      LLDS-DKRYRVIARLGQRTDTSDADGQIVQER--------PVTF-SAEQ-----------
TRUB_SALCH      LLDS-DKRYRVIARLGQRTDTSDADGQIVQER--------PVTF-SAEQ-----------
TRUB_SALTY      LLDS-DKRYRVIARLGQRTDTSDADGQIVQER--------PVTF-SAEQ-----------
TRUB_SALTI      LLDS-DKRYRVIARLGQRTDTSDADGQIVQER--------PVTF-SAEQ-----------
TRUB_SALPA      LLDS-DKRYRVIARLGQRTDTSDADGQIVQER--------PVTF-SAEQ-----------
TRUB_SALPB      LLDS-DKRYRVIARLGQRTDTSDADGQIVQER--------PVTF-SAEQ-----------
TRUB_SALAR      LLDS-DKRYRVIARLGQRTDTSDADGQIVQER--------PVTF-SAGQ-----------
TRUB_ENT38      LLDS-DKRYRVIAKLGQRTDTSDADGQVVEER--------PVTF-SAEQ-----------
TRUB_KLEP7      LLDS-DKRYRVIAKLGQRTDTSDADGQVVEER--------PLTF-SDEQ-----------
TRUB_CROS8      LLDS-DKRYRVIARLGQRTDTSDADGTVVEER--------PVTF-SEQQ-----------
TRUB_YERPE      LLDS-DKRYRVVARLGQRTDTSDAEGALISER--------EVNL-TQAQ-----------
TRUB_YERPA      LLDS-DKRYRVVARLGQRTDTSDAEGALISER--------EVNL-TQAQ-----------
TRUB_YERPP      LLDS-DKRYRVVARLGQRTDTSDAEGALISER--------EVNL-TQAQ-----------
TRUB_YERP3      LLDS-DKRYRVVARLGQRTDTSDAEGALISER--------EVNL-TQAQ-----------
TRUB_YERPN      LLDS-DKRYRVVARLGQRTDTSDAEGALISER--------EVNL-TQAQ-----------
TRUB_YERPS      LLDS-DKRYRVVARLGQRTDTSDAEGALISER--------EVNL-TQAQ-----------
TRUB_YERE8      LLDS-DKRYRVVARLGQRTDTSDAEGALISER--------EVNV-TQAQ-----------
TRUB_YEREN      LLDS-DKRYRVVARLGQRTNTSHAEGALISER--------EDIC-HTGT-----------
TRUB_PHOLL      LLDS-DKRYRVIARLGQRTDTSDSHGQIISER--------AIQL-SQVQ-----------
TRUB_SODGM      LLDA-DKRYRVIARLGERTDTSDAEGQTVSVR--------PVSL-DKTR-----------
TRUB_VIBVU      LLDS-DKRYRVIAKLGERTDTSDSDGDVVETR--------PVNV-TLET-----------
TRUB_VIBVY      LLDS-DKRYRVIAKLGERTDTSDSDGDVVETR--------PVNV-TLET-----------
TRUB_VIBCB      LLDS-DKRYRVIAKLGERTDTSDSDGEVVETR--------PVDV-NLEK-----------
TRUB_VIBPA      LLDS-DKRYRVIAKLGERTNTSDSDGEVVETR--------PVDV-TLEK-----------
TRUB_VIBC3      LLDS-DKRYRVIAKLGERTDTSDSDGQVVQTR--------PVHV-DYDT-----------
TRUB_VIBCH      LLDS-DKRYRVIAKLGERTDTSDSDGQVVQTR--------PVHV-DYDT-----------
TRUB_ALIF1      LLDS-DKRYRVVAKLGERTNTSDSDGEVVQTR--------EVKV-DRGQ-----------
TRUB_PHOPR      LLDS-DKRYRVIAKLGERTNTSDSDGEVVETR--------EVKV-DRGQ-----------
TRUB_SHEHH      LLDA-DKRYLVTAKLGQRTDTSDSDGEIVQTR--------EVNF-TQEQ-----------
TRUB_SHEPA      LLDA-DKRYLVTAKLGQRTDTSDSDGEIVQTR--------EVNF-TQEQ-----------
TRUB_SHELP      LLDA-DKRYLVTAKLGVRTDTSDSDGEVVQTR--------PINF-TEQQ-----------
TRUB_SHEDO      LLDA-DKRYLVTAKLGVRTDTSDSDGEVVQTR--------DINF-TQAQ-----------
TRUB_SHEFN      LLDS-DKRYLVTAKLGQRTDTSDSDGEVVQTR--------PVNV-TQAL-----------
TRUB_SHESR      LLDS-DKRYLVTAKLGQRTDTSDSDGEVVQTR--------PLEF-TEAQ-----------
TRUB_SHESM      LLDS-DKRYLVTAKLGQRTDTSDSDGEVVQTR--------PIEF-TEAQ-----------
TRUB_SHESA      LLDS-DKRYLVTAKLGQRTDTSDSDGEVVQTR--------PLEF-TEAQ-----------
TRUB_SHESW      LLDA-DKRYLVTAKLGERTDTSDSDGEVVQTR--------PVTF-TEAQ-----------
TRUB_SHEPC      LLDA-DKRYLVTAKLGERTDTSDSDGEVVQTR--------PVTF-TEAQ-----------
TRUB_SHEB9      LLDA-DKRYLVTAKLGERTDTSDSDGEVVQTR--------AIDF-TEAQ-----------
TRUB_SHEB8      LLDA-DKRYLVTAKLGERTDTSDSDGEVVQTR--------AIDF-TEAQ-----------
TRUB_SHEB5      LLDA-DKRYLVTAKLGERTDTSDSDGEVVQTR--------AIDF-TEAQ-----------
TRUB_SHEAM      LLDA-DKRYLVTAKLGQRTDTSDSDGEVVSER--------PLNF-TQEA-----------
TRUB_PSYIN      LLDS-DKRYIVTATLGVRTTTSDSQGDVVSER--------PVEV-TQTQ-----------
TRUB_COLP3      LLDT-DKTYQVTAKLGIRTTTSDAGGEVVSEK--------TVDV-SSEQ-----------
TRUB_PSEA6      LLDA-DKTYIVTAKLGVRTTTSDADGEVVDTR--------QVNV-TEQQ-----------
TRUB_HAEIE      LLDA-DKRYLVTAKLGERTDTSDAEGQVVETR--------EVHV-ETPQ-----------
TRUB_HAEIG      LLDA-DKRYLVTAKLGERTDTSDAEGQVVETR--------EVHV-ETPQ-----------
TRUB_HAEI8      LLDA-DKRYLVTAKLGERTDTSDAEGQVVETR--------EVHV-ETPQ-----------
TRUB_HAEIN      LLDA-DKRYLVTAKLGERTDTSDAEGQVVETR--------EVNL-ETQQ-----------
TRUB_MANSM      LLDA-DKRYQVIAKLGERTDTSDAEGQVVETR--------SVNV-TEQK-----------
TRUB_PASMU      LLDA-DKRYQVTAKLGERTDTSDAEGQVVETR--------DVQV-DVQD-----------
TRUB_ACTP2      LLDS-DKRYQVTAKLGKRTDTSDAEGQVVETR--------AVNV-GEAE-----------
TRUB_HAEDU      LLDS-DKRYIVTAKLGERTDTSDAEGELVESR--------EVSL-TEKD-----------
TRUB_HAES1      LLDA-DKRYQVIAKLGERTDTSDADGQVVQKR--------EVNI-DLAK-----------
TRUB_HISS2      LLDA-DKRYQVIAKLGERTDTSDADGQVVQKR--------EVNI-DLAK-----------
TRUB_PSEHT      LLDT-DKTYVVRAKLGERTTTSDSDGEIVSTK--------DVNV-TREQ-----------
TRUB_IDILO      LLDA-DKAYRVEATLGVRTTTSDAEGEVVEEK--------PVAV-DTAK-----------
TRUB_BUCAI      LMES-NKKYHVIAKLGEKTSTSDSDGIIIKKR--------PILI-NSFK-----------
TRUB_BUCAP      LNAS-DKHYNVIARLGEKTSTSDSDGIIVRKR--------PILF-TPIQ-----------
TRUB_BUCBP      LMNF-KKRYRVIAKLGQKTSTSDSEGQIIHVR--------PITF-TNLQ-----------
TRUB_BLOPB      LLHS-DKRYKVSAQLGVSTDTFDSDGTIISVS--------PVQS-NDYI-----------
TRUB_BLOFL      LLNS-DKRYRVLVKLGESTDTFDASGVIIRIA--------DVQC-NKEK-----------
TRUB_WIGBR      LLNT-NKWYKIKAKLGEKTNTLDSFGKIICIR--------PILNIKKLN-----------
TRUB_FRATT      LLDA-DKEYIATIRLGIETDSGDAEGEIIAKSI-------NIPELSAEY-----------
TRUB_FRAT1      LLDA-DKEYIATIRLGIETDSGDAEGEIIAKSI-------NIPELSAEY-----------
TRUB_FRATW      LLDA-DKEYIATIRLGIETDSGDAEGEIIAKSI-------NIPELSAEY-----------
TRUB_FRATH      LLDA-DKEYIATIRLGIETDSGDAEGEIIAKSI-------NIPELSAEY-----------
TRUB_FRATF      LLDA-DKEYIATIRLGIETDSGDAEGEIIAKSI-------NIPELSAEY-----------
TRUB_FRATO      LLDA-DKEYIATIRLGIETDSGDAEGEIIAKSI-------NIPELSAEY-----------
TRUB_FRATN      LLDA-DKEYIATIRLGIETDSGDAEGEIIAKSP-------NIPELSAEY-----------
TRUB_FRAP2      LLDS-DKEYIATIKLGIETDSGDAEGEIIAKNA-------DIPELTVEY-----------
TRUB_PSYCK      QLDA-DKSYQATILLGSQTDTGDADGQVTA-EA-------PIPAFDDAL-----------
TRUB_PSYA2      QLDA-DKSYQATILLGSQTDTGDADGQVTA-EA-------TISAFDDTM-----------
TRUB_HYDCU      LLDS-DKRYIATLQLGLETDSGDKDGNPLK-TI-------AVPALSKAM-----------
TRUB_GEOSL      LDES-TKVYRATLILGAATDTQDHTGQVVHAG--------DWRHLEPQS-----------
TRUB_GEOMG      LDEA-VKEYRATMVLGAATDTQDCTGRVEKEG--------DWTRLSVEA-----------
TRUB_GEOUR      LDES-IKEYRAVMKLGVATDTQDYTGKVLHES--------DWSHVTTSA-----------
TRUB_PELCD      LMQE-NKVYRASLVLGKTTDTQDSEGQIVATS--------DPGHIDAQS-----------
TRUB_DESAG      LMEGGEKIYSGTLELGRTTDTWDDEGETLSTA--------DWTHVTEED-----------
TRUB_DESVH      LMADGEKVYAGTLRLGETTDTWDAEGTVTATA--------PWHHVTEAD-----------
TRUB_DESPS      FMDG-EKEYIATLCLGVETETQDPEGAEIARK--------QVGFLHAET-----------
TRUB_SYNWW      VEDE-TKEYIATMTLGASSDTQDAWGVITYHT--------P-RKIEPAQ-----------
TRUB_DEHMB      LSSV-SKTYLAEIELGVETDSYDSEGEITFRK--------TCDYVTREM-----------
TRUB_DEHMC      LSSV-SKTYLAEIELGVETDSYDSEGEITFRK--------TCDYVTREM-----------
TRUB_DEHM1      LSSV-RKTYLAEIELGTETDSYDSEGEITSRK--------SCEHITADM-----------
TRUB_CHLMU      MLFE-DKEYSAVAHLGTTTDTYDCDGKIVGR---------SKKVPTMEE-----------
TRUB_CHLTR      MLFE-DKEYAAVAHLGTTTDTYDCDGKIVGR---------SKKVPTMDE-----------
TRUB_CHLFF      LLFE-DKEYAAIAHLGTTTDSYDCDGKIVGR---------SKKVPTYEE-----------
TRUB_CHLAB      LLFE-DKEYAAVAHLGTTTDSYDCDGKIVGR---------SKKIPTYEE-----------
TRUB_CHLPN      LLFE-DKEYEAIAHLGTTTDSYDCDGKVVGR---------SKKIPSLEE-----------
TRUB_PARUW      FLLS-DKEYIAEAYLGVVTDSYDCEGQVLSQ---------SNIIPTLEQ-----------
TRUB_AQUAE      FIGMP-KTYRFTVKFGAETDTYDAQGK-VVET--YE----GEL--NCDK-----------
TRUB_SOLUE      YTRSE-KIYEGLVRFGWSTSSYDRAGEPTSEK--VE----VQL--TAEQ-----------
TRUB_THEMA      YKDLK-KVYWVKMRLGLITETFDITGEVVEER--EC----NVT--EEE------------
TRUB_THEP1      YKDLK-KVYWVKMRLGLITETFDITGEVVEER--EC----NAT--EEE------------
TRUB_THEM4      LQVER-KRYYVKALLGVITETFDITGEIVEER--EC----NIP--DER------------
TRUB_SYNAS      LSLDD-KEYRATMLLGVTTETMDIEGRITDRR--EP----EVD--EVR------------
TRUB_CALS8      FTQTK-KTYIATMQFGIKTDTLDITGK-VQLR--NN----IFI--EQNE-----------
TRUB_BDEBA      ILEGD-KGYRLRAQFGIRTDTLDTTGETLETR--PT----DHL--TREL-----------
TRUB_CLOAB      VMEGK-KIYDAEMKLGEISDTYDREGKILKV---NQ----VTS--SENN-----------
TRUB_CLONN      LMKDF-KVYDATFKLGIITDTYDREGKELSI---SE----VNV--SLDE-----------
TRUB_CLOBL      IMEGT-KTYRVEMKLGTTTDTYDREGTVLEE---KE----INL--TPIE-----------
TRUB_CLOTE      IMNEH-KEYRAKLKLGLITDTYDREGKVLKEE--DA----SKI--LEEE-----------
TRUB_CLOPE      IMENK-KVYRVNLKLGMVTDTYDLEGEVLREE--DA----SHI--TKDE-----------
TRUB_CLOP1      IMENK-KVYRVNLKLGMVTDTYDLEGEVLREE--DA----SHI--TKDE-----------
TRUB_CLOPS      IMENK-KVYRVNLKLGMVTDTYDLEGEVLREE--DA----SHI--TKDE-----------
TRUB_CLOK5      MVESK-KIYLAELRLGITTETYDREGSVVNT---RG----VYL--KKKD-----------
TRUB_ALKOO      LLDGK-KKYRAELTLGIETNTEDIDGEILRQ---RE----VTS--SPDE-----------
TRUB_LACP7      LTDKD-KVYEAVLTLGIITDTEDMTGEVLER---RL----VTA--TYDR-----------
TRUB_CLOD6      ILNKD-KSYICELTLGISTDTYDASGEILKKV--DD----FKF--SNED-----------
TRUB_FUSNN      LEAKD-KVYIADFDIGYATDTYDIEGKKIAE---NI----IEV--SKEN-----------
TRUB_GEOTN      LTGAT-KTYEGEVTLGAATSTEDADGDIIAVQ--TV----DRTIARAE------------
TRUB_GEOKA      LTGTT-KTYEGKVTLGAATTTEDADGDIIAAR--PV----DRPIARAE------------
TRUB_BACHK      LTSET-KTYEGEVTLGFSTTTEDASGEVVETK--HV----DRVITRKE------------
TRUB_BACAH      LTSET-KTYEGEVTLGFSTTTEDASGEVVETK--HV----DRVITRKE------------
TRUB_BACCZ      LTSET-KTYEGEVTLGFSTTTEDASGEVVETK--HV----DRVITRKE------------
TRUB_BACAN      LTSET-KTYEGEVTLGFSTTTEDASGEVVETK--YV----DRVITRKE------------
TRUB_BACC1      LTSET-KTYEGEVTLGFSTTTEDASGEVVETK--HV----DRVITRKE------------
TRUB_BACCR      LTSET-KTYEGEVTLGFSTTTEDASGEVVETK--NV----DRTITRME------------
TRUB_BACCN      LTSET-KTYEGEVTLGFSTTTEDASGEVVEKQ--DV----NRTITRKE------------
TRUB_BACVZ      VTDKS-KTYDAEITLGFSTSTEDQTGETVSVK--PV----KEPLKEAD------------
TRUB_BACSU      LTEKS-KTYDAEITLGFSTTTEDQTGETVETK--PV----NHDIDKAD------------
TRUB_BACLD      LTEKS-KTYDAEVTLGCSTETEDQTGEVTEKK--PV----LAPPDEQT------------
TRUB_BACP2      LTDKS-KTYDAEITIGFSTTTEDQTGEIVEEK--KV----QNPISEEE------------
TRUB_BACHD      MSDYP-KAYEGEVTVGFSTTTEDRSGDTVETK--TI----QQPFVEAV------------
TRUB_BACSK      MSDYD-KTYIGEVTFGVATTTEDAHGEVVEEK--RV----NKPFTRTE------------
TRUB_OCEIH      LTDTK-KVYEATVQLGYSTETEDATGKIVETK--EV----SDFPTNKN------------
TRUB_LISMF      VTDEG-KVYVAEITLGKSTTTEDATGETVMTK--EL------ADISADE-----------
TRUB_LISMO      VTDEG-KVYVAEITLGKSTTTEDATGETVNTK--EL------AEISAAE-----------
TRUB_LISIN      VTDEG-KVYVAEITLGKSTTTEDATGETVATK--EL------AEISAEE-----------
TRUB_LISW6      VTDEG-KVYVAEITLGKSTTTEDATGEIIATK--DL------AEISPEA-----------
TRUB_STAEQ      IMEMG-KTYHAMITLGKSTTTEDQTGDILETR--AV----DKNDINEDT-----------
TRUB_STAES      IMEMG-KTYHAMITLGKSTTTEDQTGDILETR--AV----DKNDINEDT-----------
TRUB_STAAT      VMDMG-KAYEATVSIGRSTTTEDQTGDTLETK--GV----HSADFNKDD-----------
TRUB_STAA3      VMDMG-KAYEATVSIGRSTTTEDQTGDTLETK--GV----HSADFNKDD-----------
TRUB_STAA8      VMDMG-KAYEATVSIGRSTTTEDQTGDTLETK--GV----HSADFNKDD-----------
TRUB_STAAC      VMDMG-KAYEATVSIGRSTTTEDQTGDTLETK--GV----HSADFNKDD-----------
TRUB_STAAE      VMDMG-KAYEATVSIGRSTTTEDQTGDTLETK--GV----HSADFNKDD-----------
TRUB_STAAS      VMDMG-KAYEATVSIGRSTTTEDQTGDTLEKK--GV----HSADFNKDD-----------
TRUB_STAAW      VMDMG-KAYEATVSIGRSTTTEDQTGDTLETK--GV----HSADFNKDD-----------
TRUB_STAAR      VMDMG-KAYEATVSIGRSTTTEDQTGDTLEMK--GV----HSANFNNDD-----------
TRUB_STAA1      VMDMG-KAYEATVSIGRSTTTEDQTGDTLETK--GV----HSADFNKDD-----------
TRUB_STAA2      VMDMG-KAYEATVSIGRSTTTEDQTGDTLETK--GV----HSADFNKDD-----------
TRUB_STAAM      VMDMG-KAYEATVSIGRSTTTEDQTGDTLETK--GV----HSADFNKDD-----------
TRUB_STAAN      VMDMG-KAYEATVSIGRSTTTEDQTGDTLETK--GV----HSADFNKDD-----------
TRUB_STAA9      VMDMG-KAYEATVSIGRSTTTEDQTGDTLETK--GV----HSADFNKDD-----------
TRUB_STAAB      VMDMG-KAYEANVSIGRSTTTEDQTGDTLEMK--GV----HSADFNNDD-----------
TRUB_STAHJ      VMDMG-KSYNATITLGESTTTEDQTGEVIDKI--DV----QANAININE-----------
TRUB_STAS1      IMEMG-KTYKATVSLGITTTTEDQTGEILEQT--AV----NEQDVSAKS-----------
TRUB_LACPL      LVASG-KEYQGSITLGFATTTEDLDGEEIARQ--AV----TEP-FTSDQ-----------
TRUB_LACBA      LMASG-KVYRGSVTLGLATTTEDLDGDVVERQ--PL----ERP-FTADQ-----------
TRUB_LACP3      LMASG-KVYTGEITLGFATTTEDLDGEVVDKT--PL----TQP-FTADQ-----------
TRUB_PEDPA      LMGFG-KVYQGSITLGFSTTTEDLDGEVVETK--KL----DEP-LTDEQ-----------
TRUB_LACSS      LVHSG-KVYTGEITLGLSTTTEDLDGEVVEEQ--QL----TEP-ISTEK-----------
TRUB_LACS1      LMDSG-KVYKGEITLGFATTTEDLEGEVISKV--KL----SEP-FSDEK-----------
TRUB_LACRD      LMQSG-KQYQGELLIGFATTTQDLDGDKIEEK--VV----ADE-IPTSE-----------
TRUB_STRR6      MQDEG-KIYEGEIILGYSTTTEDASGEVVAET--PV----LSS-LDEKL-----------
TRUB_STRP2      MQDEG-KIYEGEIILGYSTTTEDASGEVVAET--PV----LSS-LDEKL-----------
TRUB_STRPN      MQDEG-KIYEGEITLGYSTKTEDASGEVVAET--PV----LSL-LDEKL-----------
TRUB_STRGC      MQDEG-KVYEGEITLGYSTTTEDASGEVVAET--PV----LSP-LDEKL-----------
TRUB_STRSV      MQEEG-KVYEGEITLGCSTTTEDASGDILDRT--PV----TEL-LEEAL-----------
TRUB_STRT2      MTEAG-KVYEGEITIGFSTTTEDASGEVVQTT--PI----TEL--DGAT-----------
TRUB_STRT1      MTEAG-KVYEGEITIGFSTTTEDASGEVVQTT--PI----TEL--DGAT-----------
TRUB_STRA1      MTESG-KIYEGEITLGYATSTEDSSGEVISRT--PL----TQSDLSEDV-----------
TRUB_STRA3      MTESG-KIYEGEITLGYATSTEDSSGEVISRT--PL----TQSDLSEDV-----------
TRUB_STRA5      MTESG-KIYEGEITLGYATSTEDSSGEVISRT--PL----TQSDLSEDV-----------
TRUB_STRMU      MTEAG-KVYEGQITLGFSTTTEDASGELLQWT--PV----DET-LSVEL-----------
TRUB_STRP1      MTEAG-KVYEGQVTLGYSTTTEDASGEVVARS--SL----PAV-LTEEL-----------
TRUB_STRP8      MTEAG-KVYEGQVTLGYSTTTEDASGEVVARS--SL----PAV-LTEEL-----------
TRUB_STRPF      MTEAG-KVYEGQVTLGYSTTTEDASGEVVARS--SL----PAV-LTEEL-----------
TRUB_STRP6      MTEAG-KVYEGQVTLGYSTTTEDASGEVVARS--SL----PAV-LTEEL-----------
TRUB_STRPB      MTEAG-KVYEGQVTLGYSTTTEDASGEVVARS--SL----PAV-LTEEL-----------
TRUB_STRPC      MTEAG-KVYEGQVTLGYSTTTEDASGEVVARS--SL----PAV-LTEEL-----------
TRUB_STRP3      MTEAG-KVYEGQVTLGYSTTTEDASGEVVARS--SL----PAV-LTEEL-----------
TRUB_STRPM      MTEAG-KVYEGQVTLGYSTTTEDASGEVVARS--SL----PAV-LTEEL-----------
TRUB_STRPG      MTEAG-KVYEGQVTLGYSTTTEDASGEVVARS--SL----PAV-LTEEL-----------
TRUB_STRPD      MTEAG-KVYEGQVTLGYSTTTEDASGEVVARS--SL----PAV-LTEEL-----------
TRUB_LACLM      MEAAG-KIYEGQVTIGFSTETEDADGAIVNQT--PV----KNN-LTESE-----------
TRUB_LACLS      MEAAG-KIYEGQVTIGFSTETEDADGAIVNQT--PV----KNN-LTESE-----------
TRUB_LACLA      MEAAG-KIYEGEVTIGFSTETEDADGEIVSKT--PV----ERE-LTESE-----------
TRUB_LACDB      MHERP-KAYVGEGMLGLATDSYDLEGKILAER--AL----SQP-VSDQA-----------
TRUB_LACDA      MHERP-KAYVGEGMLGLATDSYDLEGKILAER--AL----SQP-VSDQA-----------
TRUB_LACGA      MHEKP-KSYIGSGMFGRATDSYDLDGKTIAEE--KI----NTP-FTSNE-----------
TRUB_LACJO      MHEKP-KSYIGSGMFGKATDSYDLDGTTTAEE--KI----VTP-FTSDE-----------
TRUB_LACAC      MHTRP-KKYQGTGLFGYATDSYDIDGKVLKEK--RL----VMP-FTVEE-----------
TRUB_OENOB      LQENQ-KQYRGTLILGLKTDTQDMDGQVTEMQ--FL----KEA-IADFK-----------
TRUB_SYMTH      IAGSD-KAYRAEITFGVATDTQDGFGEVVAEA--DA----SHL--TRGD-----------
TRUB_MOOTA      LQGGD-KAYRAEFILGLKTDTQDLGGRVLARK--PC----PPF--TEKD-----------
TRUB_PELTS      LLGED-KEYRVEITFGMSTSTGDSYGEITDQR--DA----SFL--KEHD-----------
TRUB_CARHZ      LENVAMKEYLAEIVFGITTATWDMEGEILEQK--DA----SFL--TAGD-----------
TRUB_CALS4      LMEHD-KRYRFEITFGFSTDTLDKSGKIVESG--PV----PLF--TLEK-----------
TRUB_MYCMO      YLDQKDKTYVARAKLGFETTTYDSEGEIINQSSNVKFT--------KEK-----------
TRUB_MYCH2      YLDQKTKTYLAKIQFGFWSTTYDAEGQIYGVEQPIKVT--------KDN-----------
TRUB_MYCPU      YVDKKFKSYRATMILGLQSQSFDSQGKIIN-SSNLKVD--------NLT-----------
TRUB_WOLSU      HLNQEPKVYRATLWLGLHSDSLDIE-NILGVEVIPPYS--------KER-----------
TRUB_HELHP      HLQKVPKAYRATLWLGAKSASLDIE-HIESIEIIPEYN--------QSD-----------
TRUB_SULNB      YLNKTPKSYKATLWLGANSPSLDIE-KVDSIREVAPFS--------QKT-----------
TRUB_NITSB      FLQKYPKRYRTTIWLGASSPSLDIE-KIESIQDVPPLD--------ERT-----------
TRUB_SULDN      FLAKAPKVYRATLWLGAKSDTLDTE-MIEEVEILEEFD--------EAD-----------
TRUB_CAMJJ      FLKKTPKTYKATLWLGVYSLSLDDQ-NIKEIKNIKEFD--------LAN-----------
TRUB_CAMJ8      FLKKTPKTYKATLWLGVYSLSLDDQ-NIKEIKNIKEFD--------LAN-----------
TRUB_CAMJE      FLKKTPKTYKATLWLGVYSLSLDDQ-NIKEIKNIKEFD--------LPN-----------
TRUB_CAMJR      FLKKTPKTYKATLWLGVYSLSLDDQ-NIKEIQNIKEFD--------LAN-----------
TRUB_CAMJD      FLKKTPKTYKATLWLGVYSLSLDDQ-NIKKIQNIKEFD--------LAI-----------
TRUB_CAMC1      FLDKSPKVYEATIWLGASSPSMDNE-NITEISNVKELN--------LEK-----------
TRUB_CAMC5      FLDKTPKIYEATMWIGASSPSGDNE-NITDVKILKPFA--------DES-----------
                      * *           . .                                     

TRUB_UREPA      ------VTKIVKDFYKNDYWQKPPQFSALKINGQKAYVLARQKV--DFEIAPRLVKIFKY
TRUB_UREP2      ------VTKIVKDFYKNDYWQKPPQFSALKINGQKAYVLARQKV--DFEIAPRLVKIFKY
TRUB_MYCPE      ------LKEELKFLNSTYWYQQPPVYSAVKIKGKKLYEYARANQ--EVSVPFKKVYINKV
TRUB_MYCMS      ------INKVISKYNNYTYNQYPPIYSSIKVDGKKLYEYALTNQ--NVEIKSRKVTIYKT
TRUB_MYCCT      ------INKVISKYNNYSYEQYPPIYSSIKVNGKKLYQYALANQ--DVEIKSRKVTIFKT
TRUB_MESFL      ------VEKVIAKFNGLAYEQEPPMYSAIKIDGKKLYEYARENQ--VVKVNKRLIKINSL
TRUB_AYWBP      ------IQTSFASFHQKKYWQIPPMFSAVKIKGQKMYRLARQNQ--VVDIPPREVFIHHF
TRUB_ONYPE      ------IQKSFASFHQKKYLQIPPMFSAVKIKGKKMYRLARKNQ--VVDIPPREVFIHHF
TRUB_ACHLI      ------LKAILNRI-VPTYKQIPPSYSAIKKAGVKAYEAARSGK--PLDLPAREVSIYNF
TRUB_CAUVC      ------VEAALPAFIGEVD-QIPPNFSAIKVDGERAYDLARDGV--EFELPTRKVSIFDL
TRUB_CAUSK      ------VEAVLAPFIGEID-QIPPNYSAIKVDGERAYDLAREGV--EFELKTRKVKVHAL
TRUB_MARMM      ------VAAVLPDFTGEIQ-QIPPAFSAIKVDGERAYDLARSGE--DVQLEARPVQIISL
TRUB_BRUSI      ------VEALLPDYTGVIS-QVPPQFSAIKIDGERAYDLAREGE--TVEIPAREVEIDRL
TRUB_BRUAB      ------VEALLPDYTGVIS-QVPPQFSAIKIDGERAYDLAREGE--TVEIPAREVEIDRL
TRUB_BRUA2      ------VEALLPDYTGVIS-QVPPQFSAIKIDGERAYDLAREGE--TVEIPAREVEIDRL
TRUB_BRUSU      ------VEALLPDYTGVIS-QVPPQFSAIKIDGERAYDLAREGE--TVEIPAREVEIDRL
TRUB_BRUO2      ------VEALLPDYTGVIS-QVPPQFSAIKIDGERAYDLAREGE--TVEIPAREVEIDRL
TRUB_BRUC2      ------VEALLPDYTGVIS-QVPPQFSAIKIDGERAYDLAREGE--TVEIPTREVEIDRL
TRUB_BRUME      ------VEALLPDYTGVIS-QVPPQFSAIKIDGERAYDLAREGE--TVEIPAREVEIDRL
TRUB_OCHA4      ------VEALLPNYTGVIS-QVPPQFSAIKIDGERAYDLAREGE--TVEIPSREVEIDRL
TRUB_RHILO      ------VKALLPKYTGVIM-QTPPQFSAIKIAGERAYDLAREGE--TVDIPAREIEIGRL
TRUB_CHESB      ------IRALLPRYTGLIM-QTPPQFSAVKIGGERAYDLAREGE--VVEIAAREVEIGRL
TRUB_RHIME      ------IRALLPKYTGVIA-QVPPQFSAIKIGGERAYDLARDGE--TVEIPAREVEVFRL
TRUB_SINMW      ------IRALLPKYTGVIA-QVPPQFSAIKIGGERAYDLAREGE--TVDIPAREVEVFRL
TRUB_RHIEC      ------IRDILPRYIGTIS-QVPPQFSAIKIAGERAYDLARDGE--AVEIPSREVEIFRL
TRUB_RHIL3      ------IRDILPGYIGTIS-QVPPQFSAIKIAGERAYDLAREGE--TIEIPSREVDIFRL
TRUB_AGRFC      ------IRDILPNYTGVIM-QTPPQFSAIKIAGERAYDLARDGE--TVEIPAREVEIHRL
TRUB_BARHE      ------ILALLPQYTGVIL-QTPPQFSAIKIAGNRAYDLAREGE--VVEIPPRQVEIETF
TRUB_BARQU      ------ILALLPQYTGVIL-QTPPQFSAIKITGNRAYDLAREGK--VVEIPPRQVEIETF
TRUB_BART1      ------ILALLPQYTGIIL-QTPPQFSAIKIAGNRAYDLAREGE--VIEIPPREVEIETF
TRUB_BARBK      ------IFALLPKYTGVIL-QTPPQFSAIKIAGNRAYDLAREGE--IFEIPPRQVKIDSL
TRUB_BRADU      ------ILALLPRFTGVIE-QIPPRYSAIKIQGERAYDLARDGE--VVELAPRPVEIHRL
TRUB_RHOPA      ------IRALLPRFTGVIE-QVPPQYSAVKIQGERAYDLARDGE--VVPLVPRPVEIHEL
TRUB_GLUDA      ------FRAALPAFRGDIM-QVPPIYSAIKVAGERAYDMAREGR--APDLPPRPARVDRF
TRUB_GLUOX      ------IRAVLPALTGNVM-QVPPVFSALRVGGERAYDMARAGR--PPELPPRPARIDSI
TRUB_RHORT      ------ITAMLARFTGEIE-QVPPIYSAVKVEGRRSYDLARADQ--AVELKSRKILIKDL
TRUB_RUEST      ------IKEALLGFIGEIQ-QVPPKFSAVKIDGQRAYKLARDGE--EVELSARPLWVEEL
TRUB_RUEPO      ------IKDALAPFLGDIM-QVPPKFSAVKIDGQRAYKLARDGE--DVELAARPLWVEEL
TRUB_ROSDO      ------IKEALSAFIGDIE-QVPPQFSAVKVDGERAYKRARDGE--EMTLAARPLYVDSL
TRUB_RHOS4      ------IEAALAAFRGEIQ-QVPPQFSAVKVEGERAYDLARDGE--RLDLAARPLWVESL
TRUB_RHOS1      ------IAAALAAFRGEIQ-QVPPQFSAVKVEGERAYDLARDGE--RLDLAARPLWVESL
TRUB_RHOS5      ------IEAALAAFRGEIM-QVPPQFSAVKVEGERAYDLAREGE--RLDLAARPLWVESL
TRUB_DINSH      ------IRAALPPFEGDIL-QVPPQFSAVKIDGERAYARARAGQ--EMEIAARPLYVDSL
TRUB_JANSC      ------IEAALPAFVGDIQ-QVPPQFSAVKVDGERAYDIARGGG--EMELAARDLYVESL
TRUB_PARDP      ------IRAALPEFTGEIM-QVPPAVSAVRVDGARAYDLAREGE--VVELAARPLWVESL
TRUB_EHRRW      ------INKIIPNFIGMIE-QVPPNFSAIHVDGVRAFKLARNGQ--EFELSSRYVNVVRL
TRUB_EHRRG      ------INKIIPNFIGMIE-QVPPNFSAIHVDGVRAFKLARNGQ--EFELSSRYVNVVRL
TRUB_EHRCJ      ------IKKIIPDFIGLLK-QVPPSFSAVHVNGVRAFELARSGQ--DVNLSSRFVDVLEL
TRUB_EHRCR      ------IKKAIPNFIGLLR-QVPPNFSAVHVNGVRAFKLARNGQ--DVSLTSRDVNVLKL
TRUB_ANAMM      ------IREALGQFVGNIR-QVPPAFSAVRVRGVRAYRLARRGE--AVSLPPKEVCIVSI
TRUB_ZYMMO      ------VESVLSCFRGEIH-QIPPVYSALKINGKRACDRVRAGE--TVTVKGRDITIHEL
TRUB_RICB8      ------AYAICSKFIGTIT-QIPPAFSALKVNGVRAYKLARDGK--EVELKPRNITIYDL
TRUB_RICBR      ------AYAICSKFIGTIT-QIPPAFSALKVNGVRAYKLARDGK--EVELKPRNITIYDL
TRUB_RICRS      ------AYAVCSKFIGSVT-QIPPAFSALKVNGVRAYKLAREEK--KVELKPRNITIYDL
TRUB_RICRO      ------AYAVCSKFIGSVT-QIPPAFSALKVNGVRAYKLAREEK--KVELKPRNITIYDL
TRUB_RICCK      ------AYAVCSKFIGNIT-QIPPVFSALKVNGVRTYKLARVGT--AVELKPRNITIYDL
TRUB_RICAH      ------AYTVCSKFIGKVT-QIPPAFSALKVNGVRAYKFAREGK--EVELKPRNITIYNL
TRUB_RICTY      ------AYAVCSKFIGNIK-QIPPMFSAIKVNGIRAYKLAREGK--VVELKPRNVTIYDL
TRUB_BORAP      ------IDLKLKDFVGEIY-QSPPRFSSVHINGSRAYKLALNGK--FFEIKKRRVNVYDI
TRUB_BORBP      ------IDLKLKDFVGEIY-QSPPRFSSIHIDGIRAYKLALNGK--FFEIKKRRVNVYDI
TRUB_BORBU      ------IDLKLKDFVGEIY-QSPPRFSSVHIDGSRAYKLALNGK--FFEIKKRKVTVYNI
TRUB_TREPA      ------VRAALPHFTGSID-QVPPEYSALKFGGVRASDRVRRGE--AVCMKARRVFVFDL
TRUB_TREDE      ------LTESIPSFLGKIL-QRPPEFSAIKINGKRASDRIRSGE--KIKIAEREIEIFKI
TRUB_ARTS2      ------IRAAVAALTGEIQ-QVPSSVSAIKVNGERAYARVRSG--EDVKLAARPVTIHRF
TRUB_PAEAT      ------VAVGVAALTGPIQ-QVPSSVSAIKVNGERSYARVRSG--EEVKLAARPVTIHRF
TRUB_THEFY      ------VHAGTRALTGVIH-QVPPQVSAVKVRGQRAYRRARAG--ETVELKAREVTVHEF
TRUB_STRAW      ------IDAGVAKLSGAIM-QVPSKVSAIKIDGVRSYKRAREG--EDFEIPARPVTVSSF
TRUB_STRCO      ------IDAGVAELSGDIM-QVPSKVSAIKIKGVRSYKRAREG--EEFEIPARPVTVSSF
TRUB_LEIXX      ------IAEGIAALTGEIE-QVPSAVSAVKVDGKRAYARVRAG--EEVVLPARAVTVSAF
TRUB_CUTAK      ------IHAAMVRQTGEIQ-QVPAAVSAIKVNGRRAYAKVRAG--EDVVLRPRAVTVSRF
TRUB_CORGL      ------ILAEIVNLTGDIM-QKPTKVSAIKIDGKRAHERVRDG--EEVDIPARPVTVSVF
TRUB_CORGB      ------ILAEIANLTGDIM-QKPTKVSAIKIDGKRAHERVRDG--EEVDIPARPVTVSVF
TRUB_COREF      ------ITTAVTSLTGEIM-QKPASVSAIKIDGKRAHERVRDG--EVVDIPARPVTVSVF
TRUB_CORDI      ------ISDAVKQFRGSIM-QRPAAVSAIKIDGKRAHQRVREG--EKVEIPARPVTISRY
TRUB_CORJK      ------VREAFAAQRGDIM-QRPTSVSSIKIDGKRAHELVREG--HDVVLPERPVTIFSL
TRUB_MYCTU      ------IDAAMERLRGEIR-QVPSSVSAIKVGGRRAYRLARQG--RSVQLEARPIRIDRF
TRUB_MYCBP      ------IDAAMERLRGEIR-QVPSSVSAIKVGGRRAYRLARQG--RSVQLEARPIRIDRF
TRUB_MYCBO      ------IDAAMERLRGEIR-QVPSSVSAIKVGGRRAYRLARQG--RSVQLEARPIRIDRF
TRUB_MYCTA      ------IDAAMERLRGEIR-QVPSSVSAIKVGGRRAYRLARQG--RSVQLEARPIRIDRF
TRUB_MYCA1      ------IEAAVGGLRGDIH-QVPSTVSAIKVAGKRAYKLVREG--QAVELPARPVRIDRF
TRUB_MYCPA      ------IEAAVGGLRGDIH-QVPSTVSAIKVAGKRAYKLVREG--QAVELPARPVRIDRF
TRUB_MYCLE      ------IATAIGRLRGDIK-QVPSAVSAIKVDGRRAYRLVREG--HVVELQARPVRIDRF
TRUB_MYCUA      ------IAAAILDLTGDIR-QVPSAVSAIKVDGRRAYQLAREG--QTVELAARPVRIDRF
TRUB_NOCFA      ------VAAGVAALTGDIQ-QVPATVSAIKIGGERAYARHRAG--EQVELAARPVTVSRF
TRUB_RHOJR      ------IAAQVHTLTGDIQ-QIPSSVSAIKVDGRRAHALIRAG--EEFELAPRSVTVSRF
TRUB_BIFLO      SWQDLLTRTIATNFTGDIE-QVPNTFSAIKINGQRAYDLAREG--KDVELKPRPVTISEF
TRUB_DEIRA      ------LREVLKGFLGPQQ-QIPPQYSAIQIGGQRAYAVARAG--GQLDLPARDVEIHEL
TRUB_DEIGD      ------ARAVLAGFVGPQA-QVPPQYSAIQVGGQRAYAVARAG--GALDLPARNIVIHAL
TRUB_THET2      ------LEAALPRFLEVRE-QVPPLYSAIKVGGKRAYEAAREG--KPLALGPRPVRYLEV
TRUB_THET8      ------LEAALPRFLEVRE-QVPPLYSAIKVGGKRAYEAAREG--KPLALGPRPVRYLEV
TRUB_TROWT      ------IGRAAEKLSGTIK-QIPSAYSAIKVSGNRAYNLARQG--IIPKLNAREVRVHWK
TRUB_TROW8      ------IGRAAEKLSGTIK-QIPSAYSAIKVSGNRAYNLARQG--IIPKLNAREVRVHWK
TRUB_TRIV2      ------VKTSLSQFIGKIE-QIPPIYSAIQVEGKRLYDLARKG--ETIEVPARTVEVFSI
TRUB_NOSS1      ------VKTALPQFIGKIE-QIPPIYSAIQVEGKRLYDLARKG--EIIEVPARTVEVFSI
TRUB_TRIEI      ------IEKVLPNFLGKIE-QVPPSYSAIQVEGKRLYDLARQG--KTVEVPTRIVEVFNI
TRUB_ACAM1      ------VEKALPQFLGSIE-QRPPAYSAIQVKGQRLYDLARQG--KDVTAPLRQVEVFDI
TRUB_SYNP6      ------IEAALPQFLGHIQ-QQPPQVSAVQVQGQRLYQLARRGE-APTELPWRTVEIQSI
TRUB_SYNE7      ------IEAALPQFLGHIQ-QQPPQVSAVQVQGQRLYQLARRGE-APTELPWRTVEIQSI
TRUB_GLOVI      ------VQVHLQAFRGTIS-QVPPRYSAIHQEGERLYDLARRGV-AIAEIAPRTVEIQAL
TRUB_THEEB      ------IQEQLPQFIGEIE-QLPPAYSAIQVAGQRLYARARAG--EVVSVPPRIVTVYRI
TRUB_SYNY3      ------VEQILPTFLGEIE-QIPPQYSAIQVNGKRLYELARAG--IPQAVPSRMVTINDL
TRUB_MICAN      ------VKPHLAEFIGNIA-QIPPMYSAIHKDGRRLYELARKG--EIIAVEPRQVKIDQI
TRUB_PROMT      ------INYLLENFRGEIL-QKPPIFSSVHIKGERAYKKARKG--EKFDLIPKKVTINKL
TRUB_PROM1      ------INYLLENFRGEIL-QKPPIFSSVHIKGERAYKKARKG--EKFDLIPKKVTINKL
TRUB_PROMA      ------ILNCLNKFQGEIK-QCPPIFSSVHINGERAYKKARRG--EFFELPPKLIKIYRI
TRUB_SYNPW      ------LEQALAPFRGLIQ-QRPPQVSAVHVDGERAHARARRG--EQMDLPERAITIHHL
TRUB_SYNPX      ------LEVALAPFRGPIQ-QRPPQVSAVHVDGERAHARARRG--EQMVLPPRPVTIHRL
TRUB_SYNS3      ------MDQALNPFRGTIE-QCPPQVSAVHVNGERAYARARRG--EVIDLPARPVTIHSL
TRUB_PROMM      ------IEAYLEPFRGRIQ-QRPPQVSAVHVQGERAHARARRG--ETMEIPARTITIDRL
TRUB_PROMP      ------LDKYLNNFRGIIQ-QVPPIVSSVHVNGERAYKKAFKN--EEFELKPKEVEIEEL
TRUB_PROM5      ------LDKFLNKFRGIIQ-QIPPKVSSVHVNGERAYKKFFKN--EEFELKPREVKIEEL
TRUB_PROM0      ------LDQYLNRFRGIIK-QIPPKVSSVHINGERAYKKSFRN--EVFELAPREVKIDEL
TRUB_PROMS      ------LDQYFNRFRGIIK-QIPPKVSSVHVNGERAYKKSFRN--EIFELAPREVKIDEL
TRUB_PROM9      ------LDQYLNKFRGLIK-QIPPKVSSVHVNGERAYKKSFNN--ENFELAPREVKIDEL
TRUB_PROM2      ------LDQYLKRFRGIIK-QVPPKVSSVHVNGERAYKKSFRN--EIFELAPREVKIKEL
TRUB_BACFN      ------VEKTLKTFVGEIQ-QIPPAFSACKVDGARAYDLARKGQ-EV-ELKPKLLVIDEI
TRUB_BACFR      ------VEKTLKTFVGEIQ-QIPPAFSACKVDGARAYDLARKGQ-EV-ELKPKLLVIDEI
TRUB_BACTN      ------VEETLTHFLGAIE-QVPPAFSACMVDGKRAYELARKGE-EV-ELKAKQLVIDEI
TRUB_BACV8      ------VEEALQRFIGRIE-QIPPVFSACKVDGKRAYDLARKGE-DV-ELKAKTLIIDEI
TRUB_PARD8      ------VEEVLKTFVGTIQ-QIPPVFSACKVEGKRAYELARKGE-EV-ELKSKTLVIDEL
TRUB_FLAJ1      ------IHETVKQFLGEID-QKPPIFSAIKKDGVRLYEHARAGE-SI-EIESRKTTIHEF
TRUB_PELLD      ------VRAAALAFVGPRL-QQPPMHSASWHEGKRLYALARKGE-EVKERKAKEIVIHQF
TRUB_CHLPM      ------VKRAASELEGKRM-QQAPMHSATWHKGKRLYELARKGT-VVTDRKSKEIVVHSF
TRUB_CHLCH      ------LHAVAATFIGNRL-QQPPMHSAAWHNGRRLYEHARKGE-VIRERKAREIVVHRF
TRUB_CHLTE      ------IREAATSMIGERM-QQPPMHSAVWHNGKRLYELARQGH-EVKERKARQIEIHQF
TRUB_RHOBA      ------IEQVLKDFHGVVE-QTPPAHSAIKVDGERAHKRARRGE-DF-EMPKRRILIDSV
TRUB_CUPMC      ------LDAAVARFTGEIE-QVPPMYSALKKDGKPLYEYARAGQ--TVERAARQVTIHAI
TRUB_CUPPJ      ------LDAAIARFLGEID-QVPPMHSALKKDGRPLYEYARAGQ--TVERPARRVTIHAI
TRUB_RALSO      ------LRAAIGRFVGEID-QVPPMHSALKKDGKPLYEYARAGQ--TVERAARRVTIRAI
TRUB_BURPS      ------VRAALARFVGEIV-QVPPMYSALKRDGKPLYEYARAGQ--TVEREGRTVTIRAL
TRUB_BURMA      ------VRAALARFVGEIV-QVPPMYSALKRDGKPLYEYARAGQ--TVEREGRTVTIRAL
TRUB_BURP1      ------VRAALARFVGEIV-QVPPMYSALKRDGKPLYEYARAGQ--TVEREGRTVTIRAL
TRUB_BURP0      ------VRAALARFVGEIV-QVPPMYSALKRDGKPLYEYARAGQ--TVEREGRTVTIRAL
TRUB_BURM7      ------VRAALARFVGEIV-QVPPMYSALKRDGKPLYEYARAGQ--TVEREGRTVTIRAL
TRUB_BURP6      ------VRAALARFVGEIV-QVPPMYSALKRDGKPLYEYARAGQ--TVEREGRTVTIRAL
TRUB_BURL3      ------VEAALVRFTGEIV-QVPPMYSALKRDGKPLYEYARAGQ--TVEREGRNVTILAL
TRUB_VEREI      ------LSAVQRQFTGPIS-QLPPMHSALKKDGRALYTYARAGI--ALERAARAVVIHAL
TRUB_DECAR      ------VSEVLPRFVGDIQ-QIPPMHSALKRNGRPLYELARQGI--EVEREPRAVTIFAI
TRUB_BORPE      ------LRDVLSRFVGTIE-QIPPMYSALKRDGKPLYEYARAGI--ELDRPPRQVTIRHI
TRUB_BORBR      ------LRDVLSRFVGTIE-QIPPMYSALKRDGKPLYEYARAGI--ELDRPPRQVTIRHI
TRUB_BORPA      ------LRDVLSRFVGTIE-QIPPMYSALKRDGKPLYEYARAGI--ELDRPPRQVTIRHI
TRUB_BORA1      ------LREVLSRFQGSIE-QIPPMYSALKRDGKPLYEYARAGI--ELERPPRRVMIYRI
TRUB_AROAE      ------IRQALAALTGEIE-QVPPMYSALKRDGKPLYEYARAGI--EVERAARPVTIHSL
TRUB_THIDA      ------IRAALPAFVGEIE-QIPPMHSALKHQGRPLYEYARAGV--EIARAPRRVHIRAL
TRUB_CHRVO      ------LEAALARFRGEIS-QVPPMYSALKHQGKPLYEYARAGI--EVPREARQVTIRKL
TRUB_NEIMB      ------FQTACQALTGNIR-QVPPMFSALKHEGKPLYEYARKGI--VIERKARYITVYAI
TRUB_NEIG1      ------FQTACQALTGNIR-QVPPMFSALKHEGKPLYEYARKGI--VIERKPRDITVYSI
TRUB_NEIMA      ------FQTACQALTGNIR-QVPPMFSALKHEGKPLYEYARKGI--VIERKARDITVYAI
TRUB_NITMU      ------IEAVRKSFIGVIT-QVPPMYSAIKHRGKPMYTFARAGV--EIERQPRAITIHDL
TRUB_NITEU      ------VTGILQTFLGRSS-QIPPMFSALKQHGKPLYRYAREGI--TVERKAREIVIHAA
TRUB_PSEAB      ------LEQALPRFRGDIE-QVPPMYSALKKDGQPLYKLARAGE--VVEREARSVTITRL
TRUB_PSEAE      ------LEQALPRFRGDIE-QVPPMYSALKKDGQPLYKLARAGE--VVEREARSVTITRL
TRUB_PSEA7      ------LEQALPRFRGDIE-QVPPMYSALKKDGQPLYKLARAGE--VVEREARSVTITRL
TRUB_PSEF5      ------IEAVLPEFRGEIK-QIPPMYSALKRDGQPLYKLARAGE--VVEREPRSVTIARL
TRUB_PSEPF      ------IEAVLPKFRGQIS-QIPPMYSALKRDGQPLYKLARAGE--VVEREPRSVTIARL
TRUB_PSE14      ------IEAVLPHFRGQIS-QIPPMYSALKRDGQPLYKLARAGE--VVEREPRSVTIARL
TRUB_PSEU2      ------IEAALPHFRGQIS-QIPPMYSALKRDGQPLYKLARAGE--VVEREPRSVTIARL
TRUB_PSEP1      ------IEALLPRFRGPIS-QIPPMYSALKRDGQPLYKLARAGE--VVEREARSVTINRL
TRUB_PSEPG      ------IEALLPRFRGPIS-QIPPMYSALKRDGQPLYKLARAGE--VVEREARSVTINRL
TRUB_PSEE4      ------IEAVIPRFRGDIL-QVPPMYSALKRDGQPLYKLARAGE--VVEREARSVTIGRL
TRUB_PSEMY      ------IEALLPRFRGEIK-QIPPMYSALKKDGQPLYKLARAGE--VVEREARSVTIARL
TRUB_PSEU5      ------LEALLPQFRGDIL-QVPPMYSALKRDGQPLYKLARAGE--VVEREPRSVNIARL
TRUB_COXBU      ------LEKTLFAFRGVID-QTPSMYSALKHKGQPLYKLARQGI--EVERKTRQVTIYEL
TRUB_COXBR      ------LEKTLFAFRGVID-QTPSMYSALKHKGQPLYKLARQGI--EVERKTRQVTIYEL
TRUB_COXBN      ------LEKTLSAFRGVID-QTPSMYSALKHKGQPLYKLARQGI--EVERKTRQVTIYEL
TRUB_NITOC      ------VAKFLSGFSGPQE-QVPPMYSAIKHQGQRLYKLARQGI--EVERKSRQVTIHTI
TRUB_METFK      ------LEAILQDMVGDIL-QVPPMYSALKHEGKALYAYAREGV--EIPRKPRPVTIHAI
TRUB_ACIAD      ------LELVLDGFRGDIQ-QVPPMYSALKRDGRPLYELARQGI--EIEREARPVTIHAL
TRUB_MARMS      ------LEEILNGFRGEIE-QIPPMYSALKHEGKPLYEYARQGI--VIERKRRRVTISNL
TRUB_LEGPC      ------MIATLEKYKGKIK-QIPSMFSALKHKGTPLYRLAREGI--EIERKARDIVISQL
TRUB_LEGPA      ------MIATLEKYKGKIK-QIPSMFSALKHKGTPLYRLAREGI--EIERKARDIVISQL
TRUB_LEGPH      ------MIATLEKYKGKIK-QIPSMFSALKHKGTPLYRLAREGI--EIERKARDIVISQL
TRUB_LEGPL      ------LIATLEKYKGKTK-QIPSMFSALKHKGTPLYRLAREGI--EIERKARDIVISQL
TRUB_MARHV      ------VEAVLARFRGDIQ-QVPSMYSALKHQGRPLYEYAREGI--EIERPARPVTIYEL
TRUB_HAHCH      ------LESVLGKFRGNLK-QIPSMYSALKHKGTPLYKLARQGI--EVEREARDIIIHEL
TRUB_SACD2      ------VLKAIKAYIGDID-QVPPMYSALKRNGQPLYKLARQGI--EVEREPRPVTVYEF
TRUB_XANAC      ------LQAALAPFIGRIQ-QQAPIYSALKQGGEPLYAKARRGE--RIEAPVREVDVQAI
TRUB_XANC5      ------LQAALAPFIGRIQ-QQAPIYSALKQGGEPLYAKARRGE--RIEAPVREVDVQAI
TRUB_XANOM      ------LQVALAAFIGRIQ-QQAPIYSALKQGGEPLYAKARRGE--VIDAPVREVEVQAI
TRUB_XANOR      ------LQVALAAFIGRIQ-QQAPIYSALKQGGEPLYAKARRGE--VIDAPVREVEVQAI
TRUB_XANCP      ------LQAALAPFIGRIQ-QQAPIYSALKQGGEPLYAKARRGE--VIEAPVREVEVHAI
TRUB_XANC8      ------LQAALAPFIGRIQ-QQAPIYSALKQGGEPLYAKARRGE--VIEAPVREVEVHAI
TRUB_XYLFA      ------VDAVIPQLIGRIR-QRAPIYSALKQGGEPLYAKARRGE--VVNAPVREVEVHAI
TRUB_XYLFT      ------VDALIPQLIGRIR-QRAPIYSALKQGGEPLYAKARRGE--VVNAPVREVEVHAI
TRUB_METCA      ------LLTVLAGFTGPIL-QVPPMFSALKHRGKRLYELARKGV--EVERPPRPVTVFEI
TRUB_SERP5      ------LDAALDSFRGDIK-QVPSMYSALKYQGKKLYEYARQGI--EVPREARSITVYEL
TRUB_PECAS      ------LELALESFRGTTQ-QVPSMYSALKYQGRKLYEYARQGL--TVPREAREITVYEL
TRUB_ECOL5      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_ECOL6      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_ECOLI      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_ECOHS      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_ECOUT      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_SHIF8      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_SHISS      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_ECOLC      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_ECOK1      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_ECO57      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_ECO24      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_SHIDS      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_SHIFL      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_SHIBS      ------LAAALDTFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITIYEL
TRUB_CITK8      ------LAAALETFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_SALCH      ------LASALETFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_SALTY      ------LASALETFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_SALTI      ------LASALETFRGDIE-QIPSMYSALKYQGRKLYEYARQGI--EVPREARPITVYEL
TRUB_SALPA      ------LASALETFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_SALPB      ------LASALETFRGDIE-QIPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_SALAR      ------LASALETFRGDIE-QIPSMYSALKYQGKKLYEYARLGI--EVPREARPITVYEL
TRUB_ENT38      ------LDAALESFRGETQ-QVPSMYSALKYQGKKLYEYARQGI--DVPREARPITVYEL
TRUB_KLEP7      ------LAAALDSFRGETQ-QVPSMYSALKYQGKKLYEYARQGI--EVPREARPITVYEL
TRUB_CROS8      ------LQDALESFRGDTL-QVPTMFSALKYQGKPLYEYARQGI--EVPREARPITVYEL
TRUB_YERPE      ------IDTALESFRGESQ-QIPSMYSALKHQGKPLYEYARQGI--EVEREARSITVYEL
TRUB_YERPA      ------IDTALESFRGESQ-QIPSMYSALKHQGKPLYEYARQGI--EVEREARSITVYEL
TRUB_YERPP      ------IDTALESFRGESQ-QIPSMYSALKHQGKPLYEYARQGI--EVEREARSITVYEL
TRUB_YERP3      ------IDTALESFRGESQ-QIPSMYSALKHQGKPLYEYARQGI--EVEREARSITVYEL
TRUB_YERPN      ------IDTALESFRGESQ-QIPSMYSALKHQGKPLYEYARQGI--EVEREARSITVYEL
TRUB_YERPS      ------IDTALESFRGESQ-QIPSMYSALKHQGKPLYEYARQGI--EVEREARSITVYEL
TRUB_YERE8      ------MDAALDSFRGSSQ-QVPSMYSALKHQGKPLYEYARQGI--EVEREARSITVYEL
TRUB_YEREN      ------DDAALDSHRGSSQ-QVPSMYSALKHQGKPLYEYARQGI--EVDREARSITVYEL
TRUB_PHOLL      ------LDAALDKFRGDTM-QIPSMYSALKYQGKPLYEYARQGI--EVEREARPITVYEL
TRUB_SODGM      ------LEAALDHFRGESS-QVPSMFSALKHQGRPLYEYARKGI--TVEREARPIHVYDL
TRUB_VIBVU      ------LEACIEKFRGESD-QVPSMFSALKYQGKPLYEYARKGI--EVPRESRKITVYEI
TRUB_VIBVY      ------LEACIEKFRGESD-QVPSMFSALKYQGKPLYEYARKGI--EVPRESRKITVYEI
TRUB_VIBCB      ------LEACIDTFRGESD-QVPSMFSALKYQGKPLYEYARKGI--EVPRESRKITVYEI
TRUB_VIBPA      ------LEACIEKFRGESD-QVPSMFSALKYQGKPLYEYARKGI--EVPRESRKITVYEI
TRUB_VIBC3      ------LLACIAKFRGETD-QVPSMFSALKYQGRPLYEYARQGI--EVPREARKITVYEI
TRUB_VIBCH      ------LLACIAKFRGETD-QVPSMFSALKYQGRPLYEYARQGI--EVPREARKITVYEI
TRUB_ALIF1      ------LERCIAKFRGTTD-QIPSMFSALKYQGRPLYEYAREGI--EVPRESRKITVYSI
TRUB_PHOPR      ------LERCIAKFRGTTD-QIPSMFSALKYQGRPLYEYAREGI--EIPRESRKITVHSI
TRUB_SHEHH      ------LDTALEHFRGETM-QVPSMYSALKHKGQPLYKYAREGI--EVPREARPINVFEL
TRUB_SHEPA      ------LDTALEYFRGETM-QVPSMYSALKYQGQPLYKYAREGI--EVPREARPINVFEL
TRUB_SHELP      ------LEEALEHFRGETM-QVPSMYSALKYQGQPLYKYAREGK--EVPREARPIKVFEL
TRUB_SHEDO      ------LETALEHFRGDTM-QVPSMFSALKHQGQPLYKYAREGI--EVPREARPITVFEL
TRUB_SHEFN      ------LDEKLAFFRGTTQ-QIPSMYSALKYQGQPLYKYAREGI--EVPRESRPITVFEL
TRUB_SHESR      ------LMSALEHFRGDTQ-QVPSMYSALKYQGQPLYKYAREGI--EVPREARPITVFEL
TRUB_SHESM      ------LMSALEHFRGDTL-QVPSMYSALKYQGQPLYKYAREGI--EVPREARPITVFEL
TRUB_SHESA      ------LMSALEHFRGDTQ-QVPSMYSALKYQGQPLYKYAREGI--EVPREARPITVFEL
TRUB_SHESW      ------LLSALEHFRGDTQ-QVPSMYSALKYQGQPLYKYAREGI--EVPRESRPITVFEL
TRUB_SHEPC      ------LLSALEHFRGDTQ-QVPSMYSALKYQGQPLYKYAREGI--EVPRESRPITVFEL
TRUB_SHEB9      ------LLTALDFFRGETQ-QVPSMYSALKYQGQPLYKYAREGI--EVPRESRPITVFEL
TRUB_SHEB8      ------LLTALDFFRGETQ-QVPSMYSALKYQGQPLYKYAREGI--EVPRESRPITVFEL
TRUB_SHEB5      ------LLTALDFFRGETQ-QVPSMYSALKYQGQPLYKYAREGI--EVPRESRPITVFEL
TRUB_SHEAM      ------LDAALDSFRGDTL-QVPSMFSALKYQGQPLYKYAREGK--EVPREARPITVFEL
TRUB_PSYIN      ------LDQALDTFRGDIM-QVPSMFSALKHKGQPLYKYAREGI--TIEREARPITVYEI
TRUB_COLP3      ------LAKALDSFRGTTK-QVPSMYSALKHQGQPLYKYAREGI--EVPREARDITVFNL
TRUB_PSEA6      ------LIDACETFKGPIK-QVPSMFSALKHQGKPLYHYARQGI--VIEREARDITIFSL
TRUB_HAEIE      ------ILTALEQFRGDIL-QVPTMFSALKHNGKPLYEYARQGI--TVEREARPITIFEL
TRUB_HAEIG      ------ILTALEQFRGDIL-QVPTMFSALKHNGKPLYEYARQGI--TVEREARPITIFEL
TRUB_HAEI8      ------ILTALEQFRGDIL-QVPTMFSALKHNGKPLYEYARQGI--TVEREARPITIFEL
TRUB_HAEIN      ------ILTALEQFRGDIL-QVPTMFSALKHNGKPLYEYARQGI--TVEREARPITIFEL
TRUB_MANSM      ------ILDSLPHFRGDIM-QVPTMFSALKHKGKPLYEYARAGI--VVEREARPISIFEL
TRUB_PASMU      ------ILAALPHFRGNLM-QVPTMFSALKHQGKPLYEYARAGI--TVEREARPITIFDL
TRUB_ACTP2      ------IITALEQFRGDIL-QVPTMFSALKHNGKPLYEYARQGI--TVEREARPITIFEL
TRUB_HAEDU      ------ILAILPQFTGDLL-QVPTMFSALKHQGKPLYEYARQSI--TIEREARPITIFEL
TRUB_HAES1      ------ILTALEQFRGEIM-QVPTMFSALKYQGKALYEYARAGI--TIEREARPISIFEL
TRUB_HISS2      ------ILTALEQFRGEIM-QVPTMFSALKYQGKALYEYARAGI--TIEREARPISIFEL
TRUB_PSEHT      ------LIKEIAAFVGESD-QYPSMYSALKYQGRPLYKYAREGI--EVPRKCRKINVFSL
TRUB_IDILO      ------VADAIKQFIGEQD-QSPSIYSALKHEGRPLYYYARQGI--EVPKKTRTITVHSI
TRUB_BUCAI      ------IKSALKELTGLIE-QIPPMYSAIKHNGVPLYKYARQGL--NIKRSIRKVLIHDI
TRUB_BUCAP      ------LSLALKALTGSVN-QIPSMYSAVKYKGIPLYKYARQGI--NVKRNIRCVFIYKI
TRUB_BUCBP      ------LQKVLKSFHGKIK-QIPSMYSAIKYHGHALYKYARQGI--VISRKVRDAIIYEL
TRUB_BLOPB      ------LEQCLESFIGIRN-QIPPMFSSLKYRGVPLYKYARKGI--YFPRKPRSIHIYNL
TRUB_BLOFL      ------IEECLKSFLGTSL-QIPPMFSSLKYQGLPLYKYARRGV--NIPRKSRTIHVYSL
TRUB_WIGBR      ------IEKILSEFQGEIY-QKPPMFSSLKHLGKPLYKYARQGI--YIPREKRKVYVHYI
TRUB_FRATT      ------LETVLAKFRGDVV-QIPPMYSALKYNGQPLYKLAREGK--TVEVKSRNIKIYEL
TRUB_FRAT1      ------LETVLAKFRGDVV-QIPPMYSALKYNGQPLYKLAREGK--TVEVKSRNIKIYEL
TRUB_FRATW      ------LETVLAKFRGDVV-QIPPMYSALKYNGQPLYKLAREGK--TVEVKSRNIKIYEL
TRUB_FRATH      ------LEIVLAKFSGDVV-QIPPMYSALKYNGQPLYKLAREGK--TVEVKSRNIKIYEL
TRUB_FRATF      ------LEIVLAKFSGDVV-QIPPMYSALKYNGQPLYKLAREGK--TVEVKSRNIKIYEL
TRUB_FRATO      ------LEIVLAKFSGDVV-QIPPMYSALKYNGQPLYKLAREGK--TVEVKSRNIKIYEL
TRUB_FRATN      ------LETVLAKFRGDVV-QIPPMYSALKYNGQPLYKLAREGK--TVEVKSRNIKIYEL
TRUB_FRAP2      ------LETVLAKFRGDIV-QIPPMYSALKHNGQPLYKLAREGK--AIEVKPRNINIYEL
TRUB_PSYCK      ------LDKVAQQFLGAQQ-QIPPMYSALKKDGKKLYEYARAGI--EVDRPPRDIVLKAI
TRUB_PSYA2      ------LDKIAQQFLGAQQ-QIPPMYSALKKDGKKLYEYARAGI--EVDRPPRDIILKAI
TRUB_HYDCU      ------LETVFSQFEGDVM-QVPPMYSALKHQGKPLYEYARKGI--HIERAARPIHIYEL
TRUB_GEOSL      ------VRDVVSSFTGKLS-QLPPMFSALKRDGVPLYKLARTGR--EVERERREIEVFSL
TRUB_GEOMG      ------VREVFGAYIGKCK-QIPPMYSAVKQGGVPLYRLARKGH--EVEREPRDIEIHSL
TRUB_GEOUR      ------LNEICRMFVGKLS-QVPPMFSALKQNGVPLYKLARQGA--EVPRQPREIEIYSL
TRUB_PELCD      ------VADVCHSMVGSYD-QMPPMYSALKKDGVPLYKLARQGV--EVSRKPRRITIFDL
TRUB_DESAG      ------VVRAVDLWTGSSE-QQVPAYSAAKHKGQPLYKLAREGK--ETPVKTRRIEISQA
TRUB_DESVH      ------VRAIVDSWLGSSE-QEVPPYSAAKHQGQPLYKLSRAGR--ETPVKTKTVEISLA
TRUB_DESPS      ------IETCLAGFKGTQM-QVPPAYSALKHQGKPLYYYARKGI--EVKKDAREITVHEI
TRUB_SYNWW      ------VEKVLALFRGKSR-QVPPMYSAVHHEGKRLYELARQGL--EVERKAREIEIFEL
TRUB_DEHMB      ------IYKTLMDFQGEII-QIPPMYSAVKHRGMRLYNLARQGI--EVERIPRVATIYGI
TRUB_DEHMC      ------IYKTLMDFQGEII-QIPPMYSAVKHRGMRLYNLARQGI--EVERIPRVATIYGI
TRUB_DEHM1      ------VRNALPDFLGEIT-QIPPMYSAVKHRGVRLYNLARQGI--EVERNPRKAAIYGI
TRUB_CHLMU      ------VLECTSYFQGEIQ-QVPPMFSAKKVQGKKLYEYARQGL--SIERSFATVRVD-L
TRUB_CHLTR      ------VLTCTSYFQGEIQ-QVPPMFSAKKVQGKKLYEYARQGL--SIERRFATVTVN-L
TRUB_CHLFF      ------ILEAALYFQGEIQ-QIPPMFSAKKINGKKLYEYARQGL--SIERRQSTVQVS-L
TRUB_CHLAB      ------ILEASQYFQGEIQ-QIPPMFSAKKVNGKKLYEYARKGL--SIERRQSTVQVS-L
TRUB_CHLPN      ------VLSAAEYFQGEIQ-QLPPMFSAKKVQGKKLYEYARKGL--SIERHHSTVQVH-L
TRUB_PARUW      ------IKEAFSLFQGKIE-QVPPMFSAKKQQGKKLYELARQGI--VVERQPVKISIH-T
TRUB_AQUAE      ------LKEVLNEFRGEIL-QTPPPFSAKKIKGRRAYELARKGK--KVELKPVKITVYSL
TRUB_SOLUE      ------LEHALENFRGEFL-QRPPAVSAKKVEGKRSYELARKNM--AVELEPVKVHVYEL
TRUB_THEMA      ------IREAIFSFVGEYD-QVPPAYSAKKYKGERLYKLAREGK--IINLPPKRVKIFKI
TRUB_THEP1      ------IREAIFSFVGEYD-QVPPAYSAKKHKGERLYKLAREGK--IINLPPKRVKIFKI
TRUB_THEM4      ------IIDVVKSFVGKYK-QVPPAYSAKKYKGERLYKLAREGK--IISLPPVDVEIYGI
TRUB_SYNAS      ------IREALQFFTGPIS-QEPPRYSAVKFKGRPLYSWARKGV--DIALPPRTVQVYSS
TRUB_CALS8      ------IEDCLKDLKGEVE-LSVPIYSAKKVKGRKLYEYAREGI--DIEIPKIKSIIYSI
TRUB_BDEBA      ------ILSEALKLQGEME-VEVPIYSAIKVQGKKLYEYARGEQ--EVTIPKKVMKFWDI
TRUB_CLOAB      ------IVEAIMSFQGEIL-QVPPMYSALKVNGIKLYDLARQGI--EIERASRKIHIYAI
TRUB_CLONN      ------IECAVNSFLGDSF-QVPPMYSALKVNGKRLYELAREGK--SIEREARPITIYDI
TRUB_CLOBL      ------VEKTIKKYIGDID-QVPPMYSALKINGQKLYDLARKGI--EIEREARKIHIYDI
TRUB_CLOTE      ------VVNCINSFKGEII-QIPPMYSAIKIKGERLYNLARKGI--EVEREGRKINIYNI
TRUB_CLOPE      ------ILNCINSFVGTID-QVPPMYSALKQNGVRLYELARQGI--EVHREARKITIYSI
TRUB_CLOP1      ------ILNCINSFLGTID-QVPPMYSALKQNGVRLYELARQGI--EVHREARKITIYSI
TRUB_CLOPS      ------ILNCINSFVGTID-QVPPMYSALKQNGVRLYELARQGI--EVHREARKITIYSI
TRUB_CLOK5      ------IIEEILSFQGEIE-QVPPMYSALKVNGRRLYELARKGI--EIERKKRKITIYSI
TRUB_ALKOO      ------IREAVLSFIGEYK-QIPPMYSAIKIKGKKLYELARQGV--EIERAERTVTIYHI
TRUB_LACP7      ------VLEVVEQFTRTYD-QIPPMYSAIKVNGQKLYELARQGK--VIERKPRTVTIHAI
TRUB_CLOD6      ------IERAFDTQRGEIN-QLPPIYSALKVNGKRMCDLVRSGRQSEITLKTRRVNIKDI
TRUB_FUSNN      ------LEQSLKKFIGNIK-QVPPMYSAIKIDGNKLYHLARKGI--EVERPERDITIEYI
TRUB_GEOTN      ------IEAVFRSLTGDIE-QTPPMYSAVKVNGKKLYEYARAGI--EVERPTRRVTIYEL
TRUB_GEOKA      ------IEAVFDSLTGEIE-QTPPMYSAVKVGGKKLYEYARAGI--EVERPTRRVTIYEL
TRUB_BACHK      ------VEGALAALTGTIE-QMPPMFSAVKVNGKKLYEYARAGQ--EVERPVRTITIHEF
TRUB_BACAH      ------VEGALAALTGTIE-QMPPMFSAVKVNGKKLYEYARAGQ--EVERPVRTITIHEF
TRUB_BACCZ      ------VEEALVTLTGTIE-QMPPMFSAVKVNGKKLYEYARAGQ--EVERPVRTITIHEF
TRUB_BACAN      ------VEEALATLTGTIE-QMPPMFSAVKVNGKKLYEYARAGQ--EVERPVRTITIHEF
TRUB_BACC1      ------VEEVLAALTGTIE-QMPPMFSAVKVNGKKLYEYARAGQ--EVERPVRTITIHEF
TRUB_BACCR      ------VEKVLAELTGTIE-QMPPMFSAVKVNGKKLYEYARAGQ--EVERPVRTITIHEF
TRUB_BACCN      ------IEAVLAELTGTLE-QVPPMYSAVKVNGKKLYEYARAGQ--EVKRPVRIITIHEF
TRUB_BACVZ      ------IKAVLDELKGPQE-QVPPMYSAVKVNGKKLYEYARAGI--EVERPKRNITIEDI
TRUB_BACSU      ------VEKVLNSLKGKQE-QIPPMYSAVKVNGKKLYEYARAGI--EVERPKRMITIEDI
TRUB_BACLD      ------VQSVLRSLEGTIE-QVPPMYSAVKVGGKKLYEYARAGI--EVERPKRTITIHHI
TRUB_BACP2      ------IDAALKQFQGTIE-QIPPMFSAVKIGGKKLYEYAREGI--EIERPSREISIHRI
TRUB_BACHD      ------VDQVLATFVGEIK-QIPPMYSAVKVRGKRLYEYARAGI--TVERPERTVTIFSL
TRUB_BACSK      ------IEALLQAFIGKIE-QTPPYYSAVKVNGKRLYEYARAGI--EVERPTRTVEIKAL
TRUB_OCEIH      ------LEEVLQTFIGRTK-QIPPMYSAVKVNGKKLYEYARANE--SVERPVREIEIFEL
TRUB_LISMF      ------LQAALTKLTGKIT-QIPPMFSAVKVNGKKLYEYARAGI--EVERPSRQVDIYSL
TRUB_LISMO      ------LQAALTKLTGKIT-QIPPMFSAVKVNGKKLYEYARAGI--EVERPSRQVDIYSL
TRUB_LISIN      ------LQAALTKLTGKIT-QIPPMFSAVKVNGKKLYEYARAGI--EVERPSRQVDIYSL
TRUB_LISW6      ------LQSVLTKLTGKIT-QIPPMFSAVKVNGKKLYEYARAGI--EVERPSRQVDIYSL
TRUB_STAEQ      ------IDQVLQQFEGHIQ-QIPPMYSSVKVNGRKLYEYARNNE--TVERPKRQVFIKDI
TRUB_STAES      ------IDQVLQQFEGHIQ-QIPPMYSSVKVNGRKLYEYARNNE--TVERPKRQVFIKDI
TRUB_STAAT      ------IDRLLESFKGIIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAA3      ------IDRLLESFKGIIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAA8      ------IDRLLESFKGIIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAAC      ------IDRLLESFKGIIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAAE      ------IDRLLESFKGIIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAAS      ------IDRLLESFKGIIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAAW      ------IDRLLESFKGIIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAAR      ------IDRLLESFKGIIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAA1      ------IDRLLENFKGVIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAA2      ------IDRLLENFKGVIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAAM      ------IDRLLENFKGVIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAAN      ------IDRLLENFKGVIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAA9      ------IDRLLENFKGVIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAAB      ------IDRLLENFKGVIE-QIPPMYSSVKVNGKKLYEYARNNE--TVERPKRKVNIKDI
TRUB_STAHJ      ------VDAVLKQFEGIIE-QVPPMYSSVKVNGKKLYEYARKGE--TVERPIRKVNIDSI
TRUB_STAS1      ------IDDVLQQFKGELI-QIPPMYSSVKVNGKKLYEYARNNQ--VVERPERKVNIYQI
TRUB_LACPL      ------VDAALAQMTGAIT-QIPPMFSAVKVNGRRLYDYARSGE--TVERPERHITISSF
TRUB_LACBA      ------VAAAAQALTGTIQ-QTPPMYSAVKVNGRKLYEYARAGE--TVERPTRTITVDRF
TRUB_LACP3      ------LDAALTAWTGNIT-QIPPMFSAVKVNGRRLYEYARAGE--TVKRPERQATVSQF
TRUB_PEDPA      ------INQTLTAMTGTLI-QIPPMYSAVKVKGRKLYEYARAGE--TVERPQRQIKVYDF
TRUB_LACSS      ------IKETLASFLGESI-QIPPMFSAVKVNGRRLYDYARAGD--PVERPQRKITITQF
TRUB_LACS1      ------INEILSSFIGDII-QVPPIYSAIKVNGKKLYEYARAGE--KVDIPERRVHIEYF
TRUB_LACRD      ------ILSAMNSLTGTII-QIPPMYSAVKVNGKKLYEYARAGE--TVERPKRQVTISKF
TRUB_STRR6      ------VDEAIASLTGPIT-QIPPMYSAVKVNGRKLYEYARAGQ--EVERPERQVIIYQF
TRUB_STRP2      ------VDEAIASLTGPIT-QIPPMYSAVKVNGRKLYEYARAGQ--EVERPERQVIIYQF
TRUB_STRPN      ------VDEAIASLTGPIT-QIPPMYSAVKVNGRKLYEYARAGQ--EVERPERQVTIYQF
TRUB_STRGC      ------VDEAIASLTGPIT-QIPPMYSAVKVNGRKLYEYARAGQ--EVKRPERQVTIYQF
TRUB_STRSV      ------IDEAMESMTGEIR-QIPPMYSAVKVNGRKLYEYARAGQ--EVERPERQVTIYSF
TRUB_STRT2      ------VDQAMASFEGEIT-QIPPMYSAVKINGKKLYEYARAGE--EVERPQRQVKITEF
TRUB_STRT1      ------VDQAMASFEGEIT-QIPPMYSAVKINGKKLYEYARAGE--EVERPQRQVKITEF
TRUB_STRA1      ------VDHAMKSFTGPIT-QVPPMYSAVKVNGKKLYEYARSGE--EVERPKRQITISEF
TRUB_STRA3      ------VDHAMKSFTGPIT-QVPPMYSAVKVNGKKLYEYARSGE--EVERPKRQITISEF
TRUB_STRA5      ------VDHAMKSFTGPIT-QVPPMYSAVKVNGKKLYEYARSGE--EVERPKRQITISEF
TRUB_STRMU      ------IDQAMTCFMGQIT-QVPPMYSAVKVNGKKLYEYARAGQ--EVERPQRQVRIYDF
TRUB_STRP1      ------VDQTMTTFLGKIT-QTPPMYSAVKVNGRKLYEYARAGE--SVERPRREVTISLF
TRUB_STRP8      ------VDQTMTTFLGKIT-QTPPMYSAVKVNGRKLYEYARAGE--SVERPRREVTISLF
TRUB_STRPF      ------VDQTMTTFLGKIT-QTPPMYSAVKVNGRKLYEYARAGE--SVERPRREVTISLF
TRUB_STRP6      ------VDQTMTTFLGKIT-QTPPMYSAVKVNGRKLYEYARAGE--SVERPRREVTISLF
TRUB_STRPB      ------VDQTMTTFLGKIT-QTPPMYSAVKVNGRKLYEYARAGE--SVERPRREVTISLF
TRUB_STRPC      ------VDQTMTTFLGKIT-QTPPMYSAVKVNGRKLYEYARAGE--SVERPRREVTISLF
TRUB_STRP3      ------VDQTMTTFLGKIT-QTPPMYSAVKVNGRKLYEYARAGE--SVERPRREVTISLF
TRUB_STRPM      ------VDQTMTTFLGKIT-QTPPMYSAVKVNGRKLYEYARTGE--SVERPRREVTISLF
TRUB_STRPG      ------VDQTMTTFLGKIT-QTPPMYSAVKVNGRKLYEYARAGE--SVERPRREVTISLF
TRUB_STRPD      ------VDQTMTTFLGKIT-QTPPMYSAVKVNGRKLYEYARAGE--SVERPRREVTISQF
TRUB_LACLM      ------IDSAMSHFVGKIK-QIPPMYSAVKINGKKLYEYARAGQ--TIERPAREITIKSF
TRUB_LACLS      ------IDSAMSRFVGKIK-QIPPMYSAVKINGKKLYEYARAGQ--TIERPAREITIKSF
TRUB_LACLA      ------IDSVMKNFIGKIK-QIPPMYSAVKINGKKLYEYARAGQ--TVDRPTREITIKSF
TRUB_LACDB      ------IKAAMEKLIGEIV-QQPPIYSAVRVNGKRLYEYAREGI--PVERPKRTVQVFRY
TRUB_LACDA      ------IKAAMEKLIGEIV-QQPPIYSAVRVNGKRLYEYAREGI--PVERPKRTVQVFLY
TRUB_LACGA      ------IIAGMEKLTGKLE-QVPPIYSAVRVNGKRLYEYARENI--PVERPKRKVNVYSY
TRUB_LACJO      ------IISGMKKLTGKID-QVPPIYSAVRVNGKRLYEYARENI--PVERPKRKVNIYSY
TRUB_LACAC      ------IQRGMNTFKGKIE-QVPPIYSAVKVNGKHLYEYAREGI--KVERPKRQVEIFQY
TRUB_OENOB      ------KKAAFDSFLGSSD-QLPPMYSAVKVGGKHLYELARKGE--TIERKSRKIKVMEF
TRUB_SYMTH      ------VAYALTRFHGPIE-QVPPMVSAVKVGGKRLYELARKGV--EVEREPRRVFIHRL
TRUB_MOOTA      ------LQAATRPFTGTIR-QVPPMVSAVHYQGRRLYELAREGL--EVERPARQVTIHEF
TRUB_PELTS      ------IIRVLPEFTGEVR-QVPPMTSAIKWRGKKLYELAREGL--VVERQERAVYIKSL
TRUB_CARHZ      ------IEKVLGHFHGEIE-QTPPLASAVKVSGKPLYRYQRQGE--KVEPPKRKVFIDSI
TRUB_CALS4      ------LQEVLSQFKGEIQ-QIPPIYSAKKVKGKKLYEYARKGE--EVEIPPIKVTVYEL
TRUB_MYCMO      ------LIEVLNSFIGLTK-QMPPKYSAKKLNGIRAYDLARQNI--DFELNEVEINITKI
TRUB_MYCH2      ------LEQALNRLSESQK-QVPPVFSSKKVSGKSAYHYARQGK--QIELKPISIKISKT
TRUB_MYCPU      ------IEKTIKNFVGPFV-QIPPIFSAKKINGKRAYEYARQGS--EISMKAQEVFVKSI
TRUB_WOLSU      ------VEEIMGALEGEIS-YTPPKYCAKRIGGRRAYDMARNKE--EVELPILTMRVGRL
TRUB_HELHP      ------IEKILFSLKGTFD-YTPPAFSAKHINGQRAYKLAREGK--VFTLQQIQMSIYNI
TRUB_SULNB      ------IEEVLQSFKGELT-YYPPRFSAKKVNGKRAYELAREGK--EIDLKQITSTIYEI
TRUB_NITSB      ------IKDIINSFVGEFT-YIPPLFSAKKVGGKRAYHFAARGK--QIDLKPVTSTIEEI
TRUB_SULDN      ------VLKAIKSLEGSLE-YEPPIFSAKQINGQRAYDLARAGV--EFSLNKINSTIYET
TRUB_CAMJJ      ------LQQIIDQMQGIIS-YTPPQFSAKRINGTRAYELAKKGI--EANLKPCQMEVFDC
TRUB_CAMJ8      ------LQQIIDQMQGIIS-YTPPQFSAKRINGTRAYELAKKGI--EANLKPCQMEVFDC
TRUB_CAMJE      ------LQQIIDQMQGIIS-YTPPQFSAKRINGTRAYELAKKGI--EVNLKPCQMEVFDC
TRUB_CAMJR      ------LKQIIDQMQGIIS-YTPPQFSAKRINGTRAYELAKKGI--EANLKPCQMEVFDC
TRUB_CAMJD      ------LKQIIDQMQGIIS-YTPPQFSAKRINGTRAYELAKKGI--EANLKPCQMEVFDC
TRUB_CAMC1      ------LEAIRGELIGKIS-YIPPKFSAKHVNGTRAYKLARSGE--EFELKPEIMEIYES
TRUB_CAMC5      ------LEIARKSLLGRLK-YIPPKFSAKNINGTRAYKLARTGE--EFSLKEQEMEVFSC
                                          .:    *                           

TRUB_UREPA      QIMDFNYE---------------------------------KQILKISLHVSKGFYVRSF
TRUB_UREP2      QIMDFNYE---------------------------------KQILKISLHVSKGFYVRSF
TRUB_MYCPE      ELISFDSI---------------------------------SQKTFVSLDVSKGFYIRSF
TRUB_MYCMS      SLLSYDQK---------------------------------NYEIFLDVKCSKGTYIRSL
TRUB_MYCCT      KLLNYDQK---------------------------------NYEIFLDVKCSKGTYIRSL
TRUB_MESFL      SLDKYE-----------------------------------NNEISMTVYCSKGTYIRSL
TRUB_AYWBP      E-KKSLFC---------------------------------HDQVDFLVHVSKGTYIRSL
TRUB_ONYPE      E-KTSLFC---------------------------------RDQVDFLAHVSKGTYIRSL
TRUB_ACHLI      ---TYQIN---------------------------------KQTIDFSTHVSKGTYIRSI
TRUB_CAUVC      KVVDQP----------------------------------DADHVTLTMECGKGTYVRAV
TRUB_CAUSK      RVTAAP----------------------------------DVDHLELEMECGKGTYVRAI
TRUB_MARMM      QLLDCP----------------------------------DADMAVLEMRCGKGAYVRSM
TRUB_BRUSI      EIVGFP----------------------------------DADRTEFEVECSKGTYVRSL
TRUB_BRUAB      EIVGFP----------------------------------DADRTEFEVECSKGTYVRSL
TRUB_BRUA2      EIVGFP----------------------------------DADRTEFEVECSKGTYVRSL
TRUB_BRUSU      EIVGFP----------------------------------DADRTEFEVECSKGTYVRSL
TRUB_BRUO2      EIVGFP----------------------------------DADRTEFEVECSKGTYVRSL
TRUB_BRUC2      EIVGFP----------------------------------DADRTEFEVECSKGTYVRSL
TRUB_BRUME      EIVGFP----------------------------------DADRTEFEVECSKGTYVRSL
TRUB_OCHA4      EIVGIP----------------------------------DADRTEFEVECSKGTYVRSL
TRUB_RHILO      DIIEH-----------------------------------HADHTVFEVECGKGTYVRSL
TRUB_CHESB      DLISIP----------------------------------EPKKAVFEVECGKGTYVRSL
TRUB_RHIME      SLIGSA-----------------------------------PNLAHFEIECGKGTYVRSL
TRUB_SINMW      SLIGSA-----------------------------------PSLAQFEIECGKGTYVRSL
TRUB_RHIEC      TLLGCR----------------------------------DANTAHFEVECGKGTYVRAL
TRUB_RHIL3      TLLACP----------------------------------DADSAHFEVECGKGTYVRAL
TRUB_AGRFC      TLLACP----------------------------------DADTAHFEVECGKGTYVRAL
TRUB_BARHE      KLIEMI----------------------------------TKDHSIFEITCGKGTYVRSL
TRUB_BARQU      KLIETP----------------------------------TRERSVFEITCGKGTYVRSL
TRUB_BART1      KLVETP----------------------------------TKEHSVFEITCGKGTYVRSL
TRUB_BARBK      ELIGTT----------------------------------DQGYSIFEMTCGKGTYVRSL
TRUB_BRADU      TLVDQP----------------------------------DNDRAVFEAECGKGTYVRAL
TRUB_RHOPA      TLVEHG----------------------------------DDGRSVFEAECGKGTYVRAL
TRUB_GLUDA      DLVARP----------------------------------DADTAIFAVESGKGVYMRSL
TRUB_GLUOX      TLVERP----------------------------------DANTAVFDVQSGKGVYMRSL
TRUB_RHORT      TLLETS----------------------------------TPDFGHFRIVSGKGAYMRSL
TRUB_RUEST      VMLDRP----------------------------------DADHVVLEMTCGKGGYVRSI
TRUB_RUEPO      LMLDRP----------------------------------DPDHVLLEMTCGKGGYVRSI
TRUB_ROSDO      LLIDRP----------------------------------DADHVLLEMVCGKGGYVRSI
TRUB_RHOS4      EILSRP----------------------------------DADHVELEMVCGKGGYVRSI
TRUB_RHOS1      EILSRP----------------------------------DADHVELEMVCGKGGYVRSI
TRUB_RHOS5      ELISRP----------------------------------DADHVELEMVCGKGGYVRSI
TRUB_DINSH      TFIARP----------------------------------DPDHVTLEMVCGKGGYVRSI
TRUB_JANSC      SVIGRP----------------------------------DADHVDLEFVCGSGGYVRSI
TRUB_PARDP      ELLG-A----------------------------------ARDSAELRMVCGKGGYVRSI
TRUB_EHRRW      KLLSFSR---------------------------------ENNTADFYLLCKKGVYVRSI
TRUB_EHRRG      KLLSFSR---------------------------------ENNTADFYLLCKKGVYVRSI
TRUB_EHRCJ      KLLSFDV---------------------------------ENNKADFYLSCRKGVYVRSI
TRUB_EHRCR      KLLSADQ---------------------------------ENNKADFYLLCKKGVYVRSI
TRUB_ANAMM      DLLSADE---------------------------------ESNTADFLIVCKKGVYIRSF
TRUB_ZYMMO      TLDDFS-----------------------------------PDQATFIAKVSKGTYIRSL
TRUB_RICB8      KCLNYDE---------------------------------QNATATYYAECSKGTYIRTL
TRUB_RICBR      KCLNYDE---------------------------------QNATATYYAECSKGTYIRTL
TRUB_RICRS      KCLNFDE---------------------------------KNATATYYTECSKGTYIRTL
TRUB_RICRO      KCLNFDE---------------------------------KNATATYYTECSKGTYIRTL
TRUB_RICCK      KCLNFDE---------------------------------KNATATYYTECSKGTYIRTL
TRUB_RICAH      KCLNFDK---------------------------------KNAIAIYYTECSKGTYIRTL
TRUB_RICTY      KCLNFDK---------------------------------EKAIATYYTECSKGTYIRTL
TRUB_BORAP      QRLSYDFSSSL---------------------------------LSLKISCSKGTYIRSI
TRUB_BORBP      QRLSYDFSSSS---------------------------------LSLKITCSKGTYIRSI
TRUB_BORBU      QRLSYDFSSSL---------------------------------LSLKISCSKGTYIRSI
TRUB_TREPA      QVLGCEADLGEFKKTQAGRGAAIADLDL-----------TRVRAVTLYVRCSAGFYVRAL
TRUB_TREDE      ELKGIITDSGLEFTEKDFTNINAE---------------LKIRYAHIVVECSKGTYIRSL
TRUB_ARTS2      DVHAVR-PERA----------------------------GAVLDVDVTVECSSGTYIRAL
TRUB_PAEAT      DVHSIT-RIDG----------------------------GRVVDVDVTVECSSGTYIRAL
TRUB_THEFY      TVTGFR-RVDSPD--------------------------GAFVDVDARVTCSSGTYIRSL
TRUB_STRAW      AVYDVRDAVAEDG--------------------------TPVLDLVVSVVCSSGTYIRAL
TRUB_STRCO      AVYDVRDAVADDG--------------------------TPVLDLVVSVTCSSGTYIRAL
TRUB_LEIXX      RLLSERREQD-------------------------------AIDLEVRVVCSSGTYIRSL
TRUB_CUTAK      EAIAIRRHGQ-------------------------------VIDVDVEATCSSGTYVRAL
TRUB_CORGL      DVLDYHVDGE-------------------------------FYDLDVRVHCSSGTYIRAL
TRUB_CORGB      DVLDYRVDSE-------------------------------FYDLDVRVHCSSGTYIRAL
TRUB_COREF      DVLEQRREGG-------------------------------FVDLDVRVHCSSGTYIRSL
TRUB_CORDI      DILEIRRDAA-------------------------------FIDIDVEVDCSSGTYIRSL
TRUB_CORJK      EVLDVVVDDAT-----------------------------SCIDARISVHCSSGTYIRAI
TRUB_MYCTU      ELLAARRR-------------------------------DQLIDIDVEIDCSSGTYIRAL
TRUB_MYCBP      ELLAARRR-------------------------------DQLIDIDVEIDCSSGTYIRAL
TRUB_MYCBO      ELLAARRR-------------------------------DQLIDIDVEIDCSSGTYIRAL
TRUB_MYCTA      ELLAARRR-------------------------------DQLIDIDVEIDCSSGTYIRAL
TRUB_MYCA1      EVRDLRAA-------------------------------GECVDVDVEVDCSSGTYVRAL
TRUB_MYCPA      EVRGLRAA-------------------------------GACVDVDVEVDCSSGTYVRAL
TRUB_MYCLE      EVLAVRPGPEVGL--------------------------ADVIDLDVEVECSSGTYIRAL
TRUB_MYCUA      ELMDLRRG-------------------------------ADVIDIDVEVDCSSGTYIRAL
TRUB_NOCFA      EVLARRDV-------------------------------AGFVDLDVVVECSSGTYVRAL
TRUB_RHOJR      EVVARRTE-------------------------------GAFVDVDVEVECSSGTYVRAL
TRUB_BIFLO      TVLDIRSGFVAGEQAA------------EPLREDANTGAIPALDVDVRISCSSGTYIRAL
TRUB_DEIRA      ELIGMFPSVQAAPRTFDPQS--WTPAAA-GLTFTLPEPLGEFPTLLLRAHVGSGTYLRSL
TRUB_DEIGD      ELLGISNRMAESPRTFARSSEGWTPDPT-GRTFTLPEPLGEFPTLLVRASVSSGTYLRSL
TRUB_THET2      ELLAFDP--EPIPHPIAPSARGWRLAERRGRPVRLPRPLGAYPTAVVRLVVGPGTYVRAF
TRUB_THET8      ELLAFDP--EPIPHPIAPSARGWRLAERRGRPVRLPRPLGAYPTAVVRLVVGPGTYVRAF
TRUB_TROWT      FLGDFENN-----------------------------------QVHVQITCSSGTYVRAL
TRUB_TROW8      FLGDFENN-----------------------------------QVHVQITCSSGTYVRAL
TRUB_TRIV2      DVLDWREGDF--------------------------------PELDVAIACGSGTYIRAI
TRUB_NOSS1      DVLDWREGDF--------------------------------PELDVAIACGSGTYIRAI
TRUB_TRIEI      KILDWRSGDF--------------------------------PEVDLAIACGTGTYIRAI
TRUB_ACAM1      QILDWQGGEK--------------------------------SELQVEIACGPGTYIRSI
TRUB_SYNP6      RILQWRSGSQ--------------------------------AELSVEIHCGAGTYIRSL
TRUB_SYNE7      RILQWRSGSQ--------------------------------AELSVEIHCGAGTYIRSL
TRUB_GLOVI      TVLDWYPGHY--------------------------------PELQIEIACSTGTYIRSI
TRUB_THEEB      EVLHWQPGRY--------------------------------PELTLHITCGSGTYIRAL
TRUB_SYNY3      KILGWRSGNQ--------------------------------PELDLQVTCGEGTYIRAL
TRUB_MICAN      TVLDWLEGEF--------------------------------PQIELDIHCGSGTYIRSL
TRUB_PROMT      NLISWSQDK---------------------------------GELLVDVDCSTGTYIRSL
TRUB_PROM1      NLISWSQNK---------------------------------GELLVDVDCSTGTYIRSL
TRUB_PROMA      KLINWNKKD---------------------------------GTIDLEVHCSPGTYIRSL
TRUB_SYNPW      HLLNWCPEQ---------------------------------GQLRVEVHCSAGTYIRSL
TRUB_SYNPX      QLLHWDPNQ---------------------------------GQLTLEVHCSAGTYIRSL
TRUB_SYNS3      SLEHWDFEQ---------------------------------GKLTLEVHCSAGTYIRSL
TRUB_PROMM      QLLNWNQQL---------------------------------GQIDFNVHCSSGTYIRSL
TRUB_PROMP      VLNKWDQIN---------------------------------GILEIKVSCSSGTYIRSI
TRUB_PROM5      VLKKWDQIN---------------------------------GILEIKISCSTGTYIRSI
TRUB_PROM0      TLMKWDQIN---------------------------------GILEIKVKCSAGTYIRAI
TRUB_PROMS      ILMNWDQIN---------------------------------GIIEIKIKCSAGTYIRSI
TRUB_PROM9      ILMKWDQIN---------------------------------GIIELKINCSAGTYIRAI
TRUB_PROM2      TLMKWDQIN---------------------------------GIITIKIKCSSGTYIRAI
TRUB_BACFN      ELLECNL-----------------------------------PEIKIRVVCSKGTYIRAL
TRUB_BACFR      ELLECNL-----------------------------------PEIKIRVVCSKGTYIRAL
TRUB_BACTN      ELLECRLDDPE-------------------------------PTIRIRVVCSKGTYIRAL
TRUB_BACV8      ELLECNL-----------------------------------PEIKIRVVCSKGTYIRAL
TRUB_PARD8      ELLECDL-----------------------------------PVIKIRVVCSKGTYIRAL
TRUB_FLAJ1      EITRIAL-----------------------------------PEIDFRVVCSKGTYIRSL
TRUB_PELLD      EVTHMQG-----------------------------------PLVYCRLLVSKGSYIRVI
TRUB_CHLPM      DVLRVEL-----------------------------------PLAYCRIHVSKGAYIRVL
TRUB_CHLCH      TITNVAL-----------------------------------PFVSFELHVSKGAYIRVI
TRUB_CHLTE      EITGIEL-----------------------------------PYVHFYIRVSKGAYIRVI
TRUB_RHOBA      KLISYEP-----------------------------------PMMRLDVRCGSGTYLRTL
TRUB_CUPMC      TLLDVDLP---------------------------------AAMFTMRVTCSKGTYIRTL
TRUB_CUPPJ      DVLDCALPL--------------------------------APSFTMRVKCSKGTYIRTL
TRUB_RALSO      DVLATDLDA-------------------------------AAPTVTLRVCCSKGTYIRTL
TRUB_BURPS      ALVSCALPD-----------------------------------VTFRVTCSKGTYVRTL
TRUB_BURMA      ALVSCALPD-----------------------------------VTFRVTCSKGTYVRTL
TRUB_BURP1      ALVSCALPD-----------------------------------VTFRVTCSKGTYVRTL
TRUB_BURP0      ALVSCALPD-----------------------------------VTFRVTCSKGTYVRTL
TRUB_BURM7      ALVSCALPD-----------------------------------VTFRVTCSKGTYVRTL
TRUB_BURP6      ALVSCALPD-----------------------------------VTFRVTCSKGTYVRTL
TRUB_BURL3      ALLACDLPD-----------------------------------VTFRVTCSKGTYVRTL
TRUB_VEREI      ELSLVQHAP-------------------------------AQTAIKIAVTCSKGCYIRTL
TRUB_DECAR      DCLDFSGDL-----------------------------------LTLRVACSKGTYIRVL
TRUB_BORPE      ELLSFSGMQ-----------------------------------AQIDVACSKGTYIRTL
TRUB_BORBR      ELLSFSGMQ-----------------------------------AQIDVACSKGTYIRTL
TRUB_BORPA      ELLSFSGMQ-----------------------------------AQIDVACSKGTYIRTL
TRUB_BORA1      ELLSFTGHQ-----------------------------------AEIDVACSKGTYIRTL
TRUB_AROAE      ELLGVEGDS-----------------------------------LRIRVDCSKGTYVRTL
TRUB_THIDA      DLFKCAPPR-----------------------------------AVVDVQCSAGTYVRTL
TRUB_CHRVO      ELLSFDGVS-----------------------------------AEIDVLCTKGTYIRTL
TRUB_NEIMB      DIAEFDAPK-----------------------------------AVIDVRCSKGTYIRTL
TRUB_NEIG1      DIAEFDAPK-----------------------------------AVISVRCSKGTYIRTL
TRUB_NEIMA      DIAEFDAPK-----------------------------------AVIDVRCSKGTYIRTL
TRUB_NITMU      SIEAYQGNE-----------------------------------MRIRVTCGSGTYIRTL
TRUB_NITEU      SLDTLSGFE-----------------------------------MTITVRCSSGTYVRTL
TRUB_PSEAB      DLLSFEPPC-----------------------------------ATLAVSCSKGTYVRTL
TRUB_PSEAE      DLLSFEPPC-----------------------------------ATLAVSCSKGTYVRTL
TRUB_PSEA7      DLLSFEPPC-----------------------------------ATLAVSCSKGTYVRTL
TRUB_PSEF5      ELLAFEGDT-----------------------------------ARLAVDCSKGTYIRTL
TRUB_PSEPF      ELLAFEGDT-----------------------------------ARLAVDCSKGTYIRTL
TRUB_PSE14      ELLACEGDT-----------------------------------ARLSVDCSKGTYIRTL
TRUB_PSEU2      ELLACEGDT-----------------------------------ARLSVDCSKGTYIRTL
TRUB_PSEP1      ELLECEGTR-----------------------------------ARLSVGCSKGTYIRTL
TRUB_PSEPG      ELLECEGTR-----------------------------------ARLSVGCSKGTYIRTL
TRUB_PSEE4      ELLECEGTR-----------------------------------ARLSVGCSKGTYIRTL
TRUB_PSEMY      ELLALEGEQ-----------------------------------ARLSVDCSKGTYIRTL
TRUB_PSEU5      ELLALEGDK-----------------------------------ARLAVACSKGTYIRTL
TRUB_COXBU      TLLDWDNES-----------------------------------IELYVHCSKGTYIRTL
TRUB_COXBR      TLLDWDNES-----------------------------------IELYVHCSKGTYIRTL
TRUB_COXBN      TLLDWDNES-----------------------------------IELYVHCSKGTYIRTL
TRUB_NITOC      KLTELVNNE-----------------------------------LGFEVFCSKGTYIRTL
TRUB_METFK      ALERFDGKQ-----------------------------------FEMVVSCSKGTYIRTL
TRUB_ACIAD      KLVDFDTES-----------------------------------LTLDVTCSKGTYIRVL
TRUB_MARMS      TLVSRTEDT-----------------------------------LTLDIQCSKGTYIRTI
TRUB_LEGPC      KLEQFDGEC-----------------------------------FTLTVSCSKGTYIRNL
TRUB_LEGPA      KLEQFDGEC-----------------------------------FTLTVSCSKGTYIRNL
TRUB_LEGPH      NLEQFDGEC-----------------------------------FTLTVSCSKGTYIRNL
TRUB_LEGPL      KLEQFDGEC-----------------------------------FTLTVSCSKGTYIRNL
TRUB_MARHV      KLLAVRE-----------------------------------QELDLAVTCTKGTYIRSL
TRUB_HAHCH      ELLDYTP-----------------------------------PFLRLRVLCSKGTYIRNL
TRUB_SACD2      ELLAFRPGA--------------------------------VAEADVRVFCSKGTYIRSL
TRUB_XANAC      EVLGYGA-----------------------------------PRLRLRVTCGSGTYIRSL
TRUB_XANC5      DVLGYSA-----------------------------------PGLRLRVTCGSGTYIRSL
TRUB_XANOM      EVLGYSA-----------------------------------PRLTLRVTCGSGTYIRSL
TRUB_XANOR      EVLGYSA-----------------------------------PRLTLRVTCGSGTYIRSL
TRUB_XANCP      TLTSYAS-----------------------------------PRLRLRVTCGSGTYIRSL
TRUB_XANC8      TLTSYAS-----------------------------------PRLRLRVTCGSGTYIRSL
TRUB_XYLFA      ELLVLAT-----------------------------------PRLQLRVTCGSGTYIRSL
TRUB_XYLFT      ELLFLAT-----------------------------------PRLQLRVTCGSGTYIRSL
TRUB_METCA      ELAGRGA-----------------------------------DYLELDVHCSKGTY----
TRUB_SERP5      QFIRWE-----------------------------------GDELELEIHCSKGTYIRTI
TRUB_PECAS      QFIRWE-----------------------------------GDELELEIHCSKGTYIRTI
TRUB_ECOL5      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_ECOL6      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_ECOLI      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_ECOHS      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_ECOUT      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_SHIF8      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_SHISS      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_ECOLC      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_ECOK1      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_ECO57      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_ECO24      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_SHIDS      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_SHIFL      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_SHIBS      LFIRHE-----------------------------------GNELELEIHCSKGTYIRTI
TRUB_CITK8      LFIRHE-----------------------------------GDELELEVHCSKGTYIRTI
TRUB_SALCH      LFIRHE-----------------------------------GNELELEVHCSKGTYIRTI
TRUB_SALTY      LFIRHE-----------------------------------GNELELEVHCSKGTYIRTI
TRUB_SALTI      LFIRHE-----------------------------------GNELELEVHCSKGTYIRTI
TRUB_SALPA      LFIRHE-----------------------------------GNELELEVHCSKGTYIRTI
TRUB_SALPB      LFIRHE-----------------------------------GNELELEVHCSKGTYIRTI
TRUB_SALAR      LFIRHE-----------------------------------GNELELEVHCSKGTYIRTI
TRUB_ENT38      LFIRHE-----------------------------------GDELELEVHCSKGTYIRTI
TRUB_KLEP7      LFIRRE-----------------------------------GDELELEIHCSKGTYIRTI
TRUB_CROS8      LFIRHE-----------------------------------GDELELEVHCSKGTYIRTI
TRUB_YERPE      LFIRWE-----------------------------------GNDLELEIHCSKGTYIRTI
TRUB_YERPA      LFIRWE-----------------------------------GNDLELEIHCSKGTYIRTI
TRUB_YERPP      LFIRWE-----------------------------------GNDLELEIHCSKGTYIRTI
TRUB_YERP3      LFIRWE-----------------------------------GNDLELEIHCSKGTYIRTI
TRUB_YERPN      LFIRWE-----------------------------------GNDLELEIHCSKGTYIRTI
TRUB_YERPS      LFIRWE-----------------------------------GNDLELEIHCSKGTYIRTI
TRUB_YERE8      LFIRWE-----------------------------------GNDLELEIHCSKGTYIRTI
TRUB_YEREN      LFIRWE-----------------------------------GNDLELEIHCSKGTYIRTI
TRUB_PHOLL      QFIRWE-----------------------------------NDELELEIHCSKGTYIRTI
TRUB_SODGM      QLHRWD-----------------------------------LTKVELEIHCSKGTYIRTI
TRUB_VIBVU      TLHRFE-----------------------------------GEEVEMEVHCSKGTYIRTI
TRUB_VIBVY      TLHRFE-----------------------------------GEEVEMEVHCSKGTYIRTI
TRUB_VIBCB      ILHRFE-----------------------------------GDEVEMEVHCSKGTYIRTI
TRUB_VIBPA      ILHRFE-----------------------------------GDEVEMEVHCSKGTYIRTI
TRUB_VIBC3      ELHRFE-----------------------------------GDEVEMEVHCSKGTYIRTI
TRUB_VIBCH      ELHRFE-----------------------------------GDEVEMEVHCSKGTYIRTI
TRUB_ALIF1      ELLRFE-----------------------------------GHEVEMEVHCSKALTFVRL
TRUB_PHOPR      ELLRFE-----------------------------------GHEVEMEVHCSKGTYIRTI
TRUB_SHEHH      NFISLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_SHEPA      NFISLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_SHELP      NFIKLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_SHEDO      NFIKLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_SHEFN      NFIKLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_SHESR      NFISLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_SHESM      NFISLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_SHESA      NFIGLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_SHESW      NFISLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_SHEPC      NFISLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_SHEB9      NFIGLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_SHEB8      NFIGLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_SHEB5      NFIGLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_SHEAM      NFIKLE-----------------------------------GDELTLDIHCSKGTYIRTI
TRUB_PSYIN      NQLRFE-----------------------------------GNEVELDIHVSKGTYIRTI
TRUB_COLP3      ELLRFE-----------------------------------HDEVELNIHVSKGTYIRTI
TRUB_PSEA6      KITRFE-----------------------------------GDEVDMEVHCSKGTYIRSL
TRUB_HAEIE      NFIEYH-----------------------------------APFLTLEVHCSKGTYIRTL
TRUB_HAEIG      NFIEYH-----------------------------------APFLTLEVHCSKGTYIRTL
TRUB_HAEI8      NFIEYH-----------------------------------APFLTLEVHCSKGTYIRTL
TRUB_HAEIN      NFIEYN-----------------------------------APFLTLEVHCSKGTYIRTL
TRUB_MANSM      NFISYE-----------------------------------APYLTLEVHCSKGTYIRTL
TRUB_PASMU      QFIAYD-----------------------------------APYLTLEVHCSKGTYIRTL
TRUB_ACTP2      RFIEYA-----------------------------------APYLTLEVHCSKGTYIRTL
TRUB_HAEDU      KFISYE-----------------------------------APYLTLEVHCSKGTYIRTL
TRUB_HAES1      KFIDYQ-----------------------------------IPYLTLEVHCSKGTYIRTL
TRUB_HISS2      KFIDYQ-----------------------------------IPYLTLEVHCSKGTYIRTL
TRUB_PSEHT      TFDEFDE---------------------------------VNNVIQMTAHVSKGTYIRTI
TRUB_IDILO      ELLNIQ-----------------------------------DNKVTLQVSCSKGTYIRTL
TRUB_BUCAI      SSIHQ-----------------------------------EKNLIEFKIFCSKGTYVRTL
TRUB_BUCAP      DLVDQ-----------------------------------KDNWIELNVHCSKGTYIRTL
TRUB_BUCBP      KVLGYSY---------------------------------KHKYLELDIICSKGTYIRTL
TRUB_BLOPB      SLIKK-----------------------------------TENIIELDVHCSTGTYIRSI
TRUB_BLOFL      YCLNQ-----------------------------------LNSIIELEIHCSKGTYVRSI
TRUB_WIGBR      KLLSF-----------------------------------SKKYFSLTIKCSKGTYVRSI
TRUB_FRATT      ELLEFNI-----------------------------------DSLKIRVKCSKGTYIRSL
TRUB_FRAT1      ELLEFNI-----------------------------------DSLKIRVKCSKGTYIRSL
TRUB_FRATW      ELLEFNI-----------------------------------DSLKIRVKCSKGTYIRSL
TRUB_FRATH      ELLEFNI-----------------------------------DSLKIRVKCSKGTYIRSL
TRUB_FRATF      ELLEFNI-----------------------------------DSLKIRVKCSKGTYIRSL
TRUB_FRATO      ELLEFNI-----------------------------------DSLKIRVKCSKGTYIRSL
TRUB_FRATN      ELLEFDI-----------------------------------DSLKIRVKCSKGTYIRSL
TRUB_FRAP2      ELLEFNT-----------------------------------DSLKIRVKCSKGTYIRSL
TRUB_PSYCK      ELKAIDE-----------------------------------QQIQLTVTCSKGTYVRVL
TRUB_PSYA2      ELKAIDE-----------------------------------QQIQLTVTCSKGTYVRVL
TRUB_HYDCU      KLIDFEN-----------------------------------TVVRFEVLCSKGTYVRTL
TRUB_GEOSL      VVDSI----------------------------------D-LPLVTFTLSCSRGTYVRTL
TRUB_GEOMG      IIDRM----------------------------------E-LPRIEFTVSCSRGTYVRTL
TRUB_GEOUR      VIEAV----------------------------------N-LPEVAFTVRCSRGTYVRTL
TRUB_PELCD      QLLAV----------------------------------E-PPNITFDVHCSKGTYVRTI
TRUB_DESAG      ETLAV----------------------------------E-LPFVRFRVHCSSGTYIRSL
TRUB_DESVH      EVVWC----------------------------------D-LPHVRFRVRCSSGTYIRSL
TRUB_DESPS      ERLGEGDLEG-----------------------------D-HPSLVIRVRCSKGSYIRTL
TRUB_SYNWW      ELLNA-DWEQ-----------------------------E-LPQLSLRVSCSRGTYIRTL
TRUB_DEHMB      ELLNY----------------------------------T-SPVLRVRIECGHGTYIRSL
TRUB_DEHMC      ELLNY----------------------------------T-SPVLRVRIECGHGTYIRSL
TRUB_DEHM1      EFLGF----------------------------------A-SPVLRLRIECGHGTYIRSI
TRUB_CHLMU      RLIKY----------------------------------E-YPRLHFVVKCSKGTYIRSI
TRUB_CHLTR      RLVKY----------------------------------E-YPRLHFVVQCSKGTYIRSI
TRUB_CHLFF      QITKY----------------------------------E-YPLLYFSVQCSKGTYIRSI
TRUB_CHLAB      QITKY----------------------------------E-YPLLHFSIQCSKGTYIRSI
TRUB_CHLPN      QITKY----------------------------------E-YPLLHFVVSCSKGTYIRSI
TRUB_PARUW      ELLSY----------------------------------N-YPYLNFRIECSKGTYIRSI
TRUB_AQUAE      ELLSCNPR---------------------------------EKEAEFLAEISSGGYVRSL
TRUB_SOLUE      TLLALE-----------------------------------GNLARLRAHCSGGTYMRSI
TRUB_THEMA      WDVNIE-----------------------------------GRDVSFRVEVSPGTYIRSL
TRUB_THEP1      WDVNVE-----------------------------------GRDVSFRAEVSPGTYIRSL
TRUB_THEM4      DKIIVK-----------------------------------KPHFSFEVEVSKGTYIRSL
TRUB_SYNAS      ILEEIA-----------------------------------LPYVTFRVACSKGTYIRTL
TRUB_CALS8      EMINYC-----------------------------------YPYMTFKVECSHGTYIRSL
TRUB_BDEBA      EPVEIG-----------------------------------SDWAEFDIKCSKGSYIRTW
TRUB_CLOAB      KILSIDI-----------------------------------PFVKFRVECSKGTYIRSL
TRUB_CLONN      NILHIDI-----------------------------------PYVKFRVKCSKGTYIRSL
TRUB_CLOBL      CILSIDL-----------------------------------PYVIFDVKCSKGTYIRSL
TRUB_CLOTE      EVLKVNL-----------------------------------PYVEFKVNCSKGTYIRSL
TRUB_CLOPE      ENIKIESN----------------------------------DNIQMDVCCSKGTYIRSL
TRUB_CLOP1      ENIKIESN----------------------------------DNIQMDVCCSKGTYIRSL
TRUB_CLOPS      ENIKIESN----------------------------------DNIQMDVCCSKGTYIRSL
TRUB_CLOK5      DIVNIEL-----------------------------------PYVSFKVTCSKGTYIRSL
TRUB_ALKOO      EIIEI-----------------------------------FKEKVIFDVLCSKGTYIRTL
TRUB_LACP7      DILGVTPLEEQ---------------------------PEIVHEVRMRVSCSKGTYIRSL
TRUB_CLOD6      KILSIK-----------------------------------GNKVMFYVECSKGTYVRSI
TRUB_FUSNN      NLLDFKD-----------------------------------NKAKIETKVSKGCYIRSL
TRUB_GEOTN      ELLDEREQF-----------------------------VGETVSFRFRVMCSKGTYVRTL
TRUB_GEOKA      ELLDEREQF-----------------------------FGETVSFRFRVTCSKGTYVRTL
TRUB_BACHK      VLLDDREVF-----------------------------EGETISFRFRVTCSKGTYVRTL
TRUB_BACAH      VLLDDREVF-----------------------------EGETISFRFRVTCSKGTYVRTL
TRUB_BACCZ      VLLDDREVF-----------------------------EGETISFRFRVTCSKGTYVRTL
TRUB_BACAN      VLLDDREVF-----------------------------EGENISFRFRVTCSKGTYVRTL
TRUB_BACC1      VLLDEREVF-----------------------------EGENISFRFRVTCSKGTYVRTL
TRUB_BACCR      VLLDDREVF-----------------------------EGENISFRFRVTCSKGTYVRTL
TRUB_BACCN      TLLDNRETF-----------------------------EGANISFRFRVTCSKGTYVRTL
TRUB_BACVZ      ALTSP-VTY-----------------------------NEDTASFRFTVTCSKGTYVRTL
TRUB_BACSU      ALTTE-IKH-----------------------------HGETASFRFTVTCSKGTYVRTL
TRUB_BACLD      ELTSE-IRH-----------------------------EGDKARFRFVVTCSKGTYVRTL
TRUB_BACP2      ERTTP-ALF-----------------------------ENGTVSFRFTVLCSKGTYVRTL
TRUB_BACHD      ERMSD-IVY-----------------------------EEGVCRFRFNVSCSKGTYVRTL
TRUB_BACSK      TLTEI-TTA-----------------------------KPGCFSFAFSVTCTKGTYIRTL
TRUB_OCEIH      TLTSV---------------------------------DEKNHSFDIRIVCSKGTYIRTL
TRUB_LISMF      TRLNGEATL-----------------------------NEANPTFQLEISCGKGTYIRTL
TRUB_LISMO      IRLDGDTAL-----------------------------NQSNPTFQLEIACGKGTYIRTL
TRUB_LISIN      VRLDGVSPL-----------------------------TESNPTFKLEISCGKGTYIRTL
TRUB_LISW6      TRLDGLASL-----------------------------NESNPTFQLEISCGKGTYIRTL
TRUB_STAEQ      HRISEVTFQ------------------------------EQTCHFEVEVTCGKGTYIRTL
TRUB_STAES      HRISEVTFQ------------------------------EQTCHFEVEVTCGKGTYIRTL
TRUB_STAAT      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAA3      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAA8      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAAC      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAAE      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAAS      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAAW      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAAR      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAA1      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAA2      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAAM      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAAN      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAA9      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAAB      GRISELDFK------------------------------ENECHFKIRVICGKGTYIRTL
TRUB_STAHJ      ARTSELQFE------------------------------DGKCHFNIEVKCGKGTYIRTL
TRUB_STAS1      NRISDLRFV------------------------------DDTCQFDMIVECGKGTYIRTL
TRUB_LACPL      KQRQASTYDS----------------------------ATQTQTIYFTVACSKGTYVRTL
TRUB_LACBA      DLQGAGTFDA----------------------------TAGTQTIDFEIACSKGTYVRTL
TRUB_LACP3      TRTDEPVFSA----------------------------TDGTQRFRFEVHVSKGTYIRTL
TRUB_PEDPA      VQTRPSIFDA----------------------------EKGQQTIYFKVSCGKGTYVRTL
TRUB_LACSS      DLQGEPEFDA----------------------------KTGRQTFRFIAGCSKGTYIRTL
TRUB_LACS1      KQIFPSKFDK----------------------------EKGQQTIYFEVGCGKGTYVRTL
TRUB_LACRD      ELL-SSKYDK----------------------------KNKQQRIRFNVECSKGTYIRTL
TRUB_STRR6      ERTSPISY------------------------------DGQLARFTFRVKCSKGTYIRTL
TRUB_STRP2      ERTSPISY------------------------------DGQLARFTFRVKCSKGTYIRTL
TRUB_STRPN      ERTSPISY------------------------------DGQLARFTFRVKCSKGTYIRTL
TRUB_STRGC      ERTSPISY------------------------------EGQLARFTFRVKCSKGTYIRTL
TRUB_STRSV      KRTSPISY------------------------------EDEQARFRFRVKCSKGTYVRTL
TRUB_STRT2      VRTSPIEL------------------------------ENGTARFTFRVACSKGTYVRTL
TRUB_STRT1      VRTSPIEL------------------------------ENGTARFTFRVACSKGTYVRTL
TRUB_STRA1      RRTSPLYF------------------------------EKGICRFSFYVSCSKGTYVRTL
TRUB_STRA3      RRTSPLYF------------------------------EKGICRFSFYVSCSKGTYVRTL
TRUB_STRA5      RRTSPLYF------------------------------EKGICRFSFYVSCSKGTYVRTL
TRUB_STRMU      KRTSDLVF------------------------------EDECCHFDFRVSCSKGTYIRTL
TRUB_STRP1      ERTSPLNFT-----------------------------EDGLCRFSFKVACSKGTYVRTL
TRUB_STRP8      ERTSPLNFT-----------------------------EDGLCRFSFKVACSKGTYVRTL
TRUB_STRPF      ERTSPLNFT-----------------------------EDGLCRFSFKVACSKGTYVRTL
TRUB_STRP6      ERTSPLNFT-----------------------------EDGLCRFSFKVACSKGTYVRTL
TRUB_STRPB      ERTSPLNFT-----------------------------EDGLCRFSFKVACSKGTYVRTL
TRUB_STRPC      ERTSPLNFT-----------------------------EDGLCRFSFKVACSKGTYVRTL
TRUB_STRP3      ERTSPLNFT-----------------------------EDGLCRFSFKVACGKGTYVRTL
TRUB_STRPM      ERTSPLNFT-----------------------------EDGLCRFSFKVACSKGTYVRTL
TRUB_STRPG      ERTSPLNFT-----------------------------EDGLCRFSFKVACSKGTYVRTL
TRUB_STRPD      ERTSPLNFT-----------------------------EDDLCRFSFKVACSKGTYVRTL
TRUB_LACLM      VRTSPIDWNK----------------------------EEGLVTFSFKVECSKGTYVRTL
TRUB_LACLS      VRTSPIDWNK----------------------------EEGLVTFSFKVECSKGTYVRTL
TRUB_LACLA      VRTSPMMTDE----------------------------AAGLVSFSFKVECSKGTYVRTL
TRUB_LACDB      DLTAPSQFDP----------------------------EKGRQTFTYEVECSKGTYVRSL
TRUB_LACDA      DLTAPSQFDP----------------------------EKGRQTFTYEVECSKGTYVRSL
TRUB_LACGA      ELTQDPEYDP----------------------------LEKTESFNFAIRCSKGTYVRSL
TRUB_LACJO      ELTQDPEYDP----------------------------LEKTESFNFAIRCSKGTYVRSL
TRUB_LACAC      DLLNDPSFDK----------------------------EKGQESFDFEITCSKGTYVRSL
TRUB_OENOB      QQVGGSKFDA----------------------------SKGQEYINFVATVSKGTYIRTL
TRUB_SYMTH      QLLDFRP--------------------------------GPRPVAYIDVVCSKGTYVRTL
TRUB_MOOTA      RLIRAWPD-------------------------------GPYYRALIDITCSRGTYIRTL
TRUB_PELTS      EFIRGSGWG------------------------------TPSPRALMHLSCSKGTYVRSL
TRUB_CARHZ      ELLEFLAD-------------------------------KPQPAVRLYIRCSRGTYIRSI
TRUB_CALS4      ELIKYDAP----------------------------------HHLLLDVKCSKGTYVRAL
TRUB_MYCMO      KLLSYNED---------------------------------ENYFDFEVVVSRGTYIRSL
TRUB_MYCH2      ILINFDEK---------------------------------LQNCVIMWQVSRGCYIRSL
TRUB_MYCPU      EIEKID-----------------------------------FPKVIFKAKVSRGTYIRSL
TRUB_WOLSU      SLLHYT-----------------------------------HPFVHFEAEVSKGSYIRSL
TRUB_HELHP      TLLSYH-----------------------------------HPFVHFEVSVSEGAYVRSI
TRUB_SULNB      TLINYN-----------------------------------HPFIHFEATVSEGTYIRSL
TRUB_NITSB      SFVHYR-----------------------------------HPFITFEATVSEGTYIRSL
TRUB_SULDN      KLVSYC-----------------------------------HPFVTFEAIVSEGTYIRSL
TRUB_CAMJJ      KILSYN-----------------------------------HPFLNIEITVSEGAYIRSY
TRUB_CAMJ8      KILSYN-----------------------------------HPFLNIEITVSEGAYIRSY
TRUB_CAMJE      KILSYN-----------------------------------HPFLNIEITVSEGAYIRSY
TRUB_CAMJR      KILSYN-----------------------------------HPFLNIEITVSEGAYIRSY
TRUB_CAMJD      KILSYN-----------------------------------HPFLNIEITVSEGAYIRSY
TRUB_CAMC1      EILNYS-----------------------------------HPFLTLRLSVSEGSYIRSY
TRUB_CAMC5      EILSYR-----------------------------------HPFLTFRISLSEGGYVRSY
                                                                     .      

TRUB_UREPA      AVDLATKINNL-AHLLTLIRTQSGPFEIKDAIE---------------------------
TRUB_UREP2      AVDLATKINNL-AHLLTLIRTQSGPFEIKDAIE---------------------------
TRUB_MYCPE      ANDIGLRLNNY-GYLLNLKRVEVGNYK---------------------------------
TRUB_MYCMS      AVDICKDLNTI-GYVVYLNRTLSGNFKLENAID---------------------------
TRUB_MYCCT      AIDICKDLNTI-GYVVELNRTLSGNFDINSAID---------------------------
TRUB_MESFL      IVDIAKELNTI-AHVTSLNRIESGNFIIKNSVN---------------------------
TRUB_AYWBP      ARDLALQLNTY-GALLRLQRTAIGTHLLQNAKT---------------------------
TRUB_ONYPE      ARDLALQLNTY-GALLRLQRTAIGTHLLQNAKT---------------------------
TRUB_ACHLI      ARDIGLGLNTF-GALSVLNRTNIDAYSQNMSKT---------------------------
TRUB_CAUVC      VRDLAKALGTC-GHVADLRRTRVGGFSEASAIA---------------------------
TRUB_CAUSK      VRDLAAALGAC-GHVDQLRRTRVGRFTEQTAIG---------------------------
TRUB_MARMM      ARDIAHALGTE-GHVAALRRIRVGGFVEAESTR---------------------------
TRUB_BRUSI      ARDMGRDLGCY-GHISDLRRVEVAPFTDEDMVT---------------------------
TRUB_BRUAB      ARDMGRDLGCY-GHISDLRRVEVAPFTDEDMVT---------------------------
TRUB_BRUA2      ARDMGRDLGCY-GHISDLRRVEVAPFTDEDMVT---------------------------
TRUB_BRUSU      ARDMGRDLGCY-GHISDLRRVEVAPFTDEDMVT---------------------------
TRUB_BRUO2      ARDMGRDLGCY-GHISDLRRVEVAPFTDEDMVT---------------------------
TRUB_BRUC2      ARDMGRDLGCY-GHISDLRRVEVAPFTDEDMVT---------------------------
TRUB_BRUME      ARDMGRDLGCY-GHISDLRRVEVAPFTDEDMVT---------------------------
TRUB_OCHA4      ARDMGRDLGCY-GHISELRRIEVAPFTEEDAVT---------------------------
TRUB_RHILO      ARDMGRDLGCF-GHISDLRRVEVEPFTSEDFVT---------------------------
TRUB_CHESB      ARDMGRDLGCF-GHVADLRRTEVYPFETQQLVP---------------------------
TRUB_RHIME      ARDMGRDLGCF-GHIASLRRTFVAPFGEEDMVP---------------------------
TRUB_SINMW      ARDMGRDLGCF-GHIASLRRTFVAPFGEEDMVP---------------------------
TRUB_RHIEC      ARDFGRELGCY-GHISGLRRTFVAPFSEDAMVP---------------------------
TRUB_RHIL3      ARDFGRELGCY-GHVSGLRRTFVAPFAEGAMVP---------------------------
TRUB_AGRFC      ARDMGRDLGCF-GHISELRRTMVAPFGEDMMVP---------------------------
TRUB_BARHE      ARDMGRDLGCY-AHIADLRRIAVAPFCENDLIT---------------------------
TRUB_BARQU      ARDMGRDLGCY-GHIADLRRTTVAPFCEDDLIT---------------------------
TRUB_BART1      ARDMGRDLGCY-GHIADLRRIAVAPFCEEDLVT---------------------------
TRUB_BARBK      ARDMGHDLGCY-GYIADLRRTAVAPFCENDLIT---------------------------
TRUB_BRADU      ARDMGRILGTY-GHICALRRTLVGPFGENDMIP---------------------------
TRUB_RHOPA      ARDMGRLLGCY-GHICALRRTVVGPFDESDMIP---------------------------
TRUB_GLUDA      ARDIARACGTV-GHVAALRRLRVGPFSEADAIL---------------------------
TRUB_GLUOX      ARDIALACGTV-GHISVLRRTKCGPFDLSHALT---------------------------
TRUB_RHORT      ARDLALALGTV-GHVVALRRLACGPFTAETAIS---------------------------
TRUB_RUEST      ARDLGEKLGCL-GHVRELRRIWSGPFDAEDGVT---------------------------
TRUB_RUEPO      ARDLGAALGCY-GHVRELRRIWSGPFEAEDGIT---------------------------
TRUB_ROSDO      ARDLGAALGCL-AHVRSLRRIWSGPFDAKNAAD---------------------------
TRUB_RHOS4      ARDLGEALGCH-GHVAWLRRTWSGPFEAEDGIS---------------------------
TRUB_RHOS1      ARDLGEALGCY-GHVAWLRRTWSGPFEAEDGIS---------------------------
TRUB_RHOS5      ARDLGQALGCH-GHVEWLRRTWSGPFEAEDGIS---------------------------
TRUB_DINSH      ARDLGRALGCF-GHVKSLRRTWSGPFELSDATP---------------------------
TRUB_JANSC      ARDLGQVLGCF-GHVLWLRRTWVGAFDIEDAVG---------------------------
TRUB_PARDP      ARDLGRKLGCL-GHVAQLRRIWSGPFEAGDGFA---------------------------
TRUB_EHRRW      ARDLGIRLGCF-GYVAKLRRVRVGYFKQKNAIT---------------------------
TRUB_EHRRG      ARDLGIRLGCF-GYVAKLRRVRVGYFKQKNAIT---------------------------
TRUB_EHRCJ      ARDLGIKLGCL-GYVTKLQRVRVGCFRKKNAIT---------------------------
TRUB_EHRCR      ARDLGIELGCL-GYVRKLQRVRVGCFRKKNAIT---------------------------
TRUB_ANAMM      ARDLGASLGCF-GYVSFLRRKSVGPFSEENSVT---------------------------
TRUB_ZYMMO      ARDIAHKLNCY-GHVSYLRRLKSGPFTSEQAIS---------------------------
TRUB_RICB8      AEDLALSLQSL-GFVIELRRTQVGIFKEENSIR---------------------------
TRUB_RICBR      AEDLALSLQSL-GFVIELRRTQVGIFKEENSIR---------------------------
TRUB_RICRS      AEDLALSLQSL-GFVIELRRTQVGIFKEENAIR---------------------------
TRUB_RICRO      AEDLALSLQSL-GFVIELRRTQVGIFKEENAIR---------------------------
TRUB_RICCK      AEDLALSLQSL-GFVIELRRTQVGIFKEKNAIR---------------------------
TRUB_RICAH      AEDLALSLQSL-GFVIELRRTQVGIFKAENAIR---------------------------
TRUB_RICTY      TEDLALSLQSL-GFVIELRRTQVGIFKEENAIH---------------------------
TRUB_BORAP      ARDLAYSLNSC-AYVSSLKRTKVGIFRLEDSTL---------------------------
TRUB_BORBP      ARDLAYSLNSC-AYVSNLKRTKIGMFRLKDSTL---------------------------
TRUB_BORBU      ARDLAYSLNSC-AYVSNLKRTKVGMFRLKDSTL---------------------------
TRUB_TREPA      ARDIAAACGSC-AYVSHLRRTRIGPFDLAQAAG---------------------------
TRUB_TREDE      VRDLARKASSC-AYVRALRRTAVGNFKLEDAAG---------------------------
TRUB_ARTS2      ARDLGEAL-GTGGHLTALRRTQVGPYTLDQART---------------------------
TRUB_PAEAT      ARDLGNAL-GIGGHLTALRRTQVGPYSLDQART---------------------------
TRUB_THEFY      ARDLGADL-GVGGHLTALRRTRVGPYTVEQAAT---------------------------
TRUB_STRAW      ARDLGADL-GVGGHLTALRRTRVGPYKLDAART---------------------------
TRUB_STRCO      ARDLGAGL-GVGGHLTALRRTRVGPYKLDGART---------------------------
TRUB_LEIXX      ARDLGARL-GVGGHLAALRRTRVGGYDVRRAHE---------------------------
TRUB_CUTAK      ARDVGADL-GVGGHLTALRRTRVGPFDLTAACVDI-------------------------
TRUB_CORGL      ARDLGNAL-QVGGHLTALRRTEVGPFTLNDATP---------------------------
TRUB_CORGB      ARDLGNAL-QVGGHLTALRRTEVGPFTLNDATP---------------------------
TRUB_COREF      ARDLGAAL-GVGGHLTALRRTEVGPFTLEDAIP---------------------------
TRUB_CORDI      ARDLGEEL-GVGGHLTALRRTQVGPFTLDNAVT---------------------------
TRUB_CORJK      ARDVGEAL-GVGGHLTQLRRTSVGPFDVSEART---------------------------
TRUB_MYCTU      ARDLGDAL-GVGGHVTALRRTRVGRFELDQARS---------------------------
TRUB_MYCBP      ARDLGDAL-GVGGHVTALRRTRVGRFELDQARS---------------------------
TRUB_MYCBO      ARDLGDAL-GVGGHVTALRRTRVGRFELDQARS---------------------------
TRUB_MYCTA      ARDLGDAL-GVGGHVTALRRTRVGRFELDQARS---------------------------
TRUB_MYCA1      ARDLGAAL-GVGGHLTALRRTRVGRFGLEQAYG---------------------------
TRUB_MYCPA      ARDLGAAL-GVGGHLTALRRTRVGRFGLEQAYG---------------------------
TRUB_MYCLE      ARDLGDAF-GVGGHLTSLRRTRVGRFELDQAWS---------------------------
TRUB_MYCUA      ARDLGAAL-DVGGHLTSLRRTRVSHFDLSQAAS---------------------------
TRUB_NOCFA      ARDLGAAL-GVGGHLTALRRTRVGPFTLDHART---------------------------
TRUB_RHOJR      ARDLGIALIGVGGHLTSLRRTRVGPFTLEHART---------------------------
TRUB_BIFLO      ARDLGKEL-GVGGYLTRLRRTRVGRFALPDDASGLIAPEAMLDTRTHTVTAHTDQKTFTN
TRUB_DEIRA      ARDLGAAL-GVPAHLGGLVRTRAGRYSLRDAVS---------------------------
TRUB_DEIGD      ARDVGAAL-GVPAHLAGLVRTRVGRYDLADSVS---------------------------
TRUB_THET2      ARDLGEML-GTKAFLSGLVRTRVGRVGLERAVA---------------------------
TRUB_THET8      ARDLGEML-GTKAFLSGLVRTRVGRVGLERAVA---------------------------
TRUB_TROWT      ARDMGKFL-GVGGHLSYLKRLSIGPFHLHEIYREINKKEATMSERTPS------------
TRUB_TROW8      ARDMGKFL-GVGGHLSYLKRLSIGPFHLHEIYREINKKEATMSERTPS------------
TRUB_TRIV2      ARDLGAIF-HTGGTLAALIRTHSSGFNLTDSLT---------------------------
TRUB_NOSS1      ARDLGAVF-HTGGTLAALIRTHSSGFNLTDSLT---------------------------
TRUB_TRIEI      ARDLGRTL-SIGGTLAALTRIESSGFSEENSLT---------------------------
TRUB_ACAM1      ARDLGEVL-GTGATLAQLTRTLSCGFALADSLT---------------------------
TRUB_SYNP6      ARDLGAVL-GVGGTLAELRRTASSGFDLNQSTP---------------------------
TRUB_SYNE7      ARDLGAVL-GVGGTLAELRRTASSGFDLNQSTP---------------------------
TRUB_GLOVI      ARDLGTAL-GTGATLARLLRTRSGPFALEASLP---------------------------
TRUB_THEEB      ARDLGTAL-GVGGTLAALQRIESGGLRIEESHS---------------------------
TRUB_SYNY3      ARDLGDRL-GTGATLAGLVRQQSGGMALDNSVG---------------------------
TRUB_MICAN      ARDLGKVL-AVGGTLASLTRTESCGFQLADSIN---------------------------
TRUB_PROMT      ARDIGDKI-GCGGYLKSLRRTKAYNFIENHSVK---------------------------
TRUB_PROM1      ARDIGDKI-GCGGYLKSLRRTKAYNFIENHSVK---------------------------
TRUB_PROMA      ARDIGKKL-GCGGALAKLNRTMALGFNIDQAIE---------------------------
TRUB_SYNPW      ARDLGQNL-GCGGCLASLRRTQALGFQDAQAIP---------------------------
TRUB_SYNPX      ARDLGEQL-GCGGCLAQLRRTQALGFLESQAQA---------------------------
TRUB_SYNS3      ARDLGQAL-GCGGCLDSLRRTQALGFVEAHAIA---------------------------
TRUB_PROMM      ARDLGELI-GCGACLGWLKRTQALGFHEQQAVP---------------------------
TRUB_PROMP      ARDLGGSL-DSEGCLLKLKRISACGFHEKNSIK---------------------------
TRUB_PROM5      ARDLGGVL-DSEGCLLNLKRISACGFHEKNSIK---------------------------
TRUB_PROM0      ARDLGEIL-NSEGCLLQLKRISACGFDEQNSIK---------------------------
TRUB_PROMS      ARDIGETL-NSAGCLLQLKRISACGFDEQNSIK---------------------------
TRUB_PROM9      ARDLGEIL-NSEGCLLQLKRISACGFHEKNSIK---------------------------
TRUB_PROM2      ARDLGGIL-NSEGCLLQLKRISACGFDEQSSIK---------------------------
TRUB_BACFN      ARDIGEAL-QSGAHLTGLIRTRVGDVKLEQCLD---------------------------
TRUB_BACFR      ARDIGEAL-QSGAHLTGLIRTRVGDVKLEQCLD---------------------------
TRUB_BACTN      ARDIGEAL-QSGAHLTELIRTRVGDVRLEDCLD---------------------------
TRUB_BACV8      ARDIGEAL-NSGAHLTGLIRTRVGDVRLEDCLS---------------------------
TRUB_PARD8      ARDIGKAL-GSGAHLIGLERTRIGEVTLDMCMS---------------------------
TRUB_FLAJ1      AYDFGKAM-NSGSHLTVLRRTKIGDYDVKNAID---------------------------
TRUB_PELLD      ADELGMAL-GVGAYLAGLRRTAVGPYRVEDAMS---------------------------
TRUB_CHLPM      ADELGEAL-GVGGYLAGLRRIAIGSYQVESAMR---------------------------
TRUB_CHLCH      ADEFGAAL-GVGGYLAALRRTAIGEWQLTNALS---------------------------
TRUB_CHLTE      AHELGELL-GVGGYLKSLKRVAIGQYQLSDAMS---------------------------
TRUB_RHOBA      GMDVAAAC-GCAAVMTKLIRNEVGRFTLDDTLD---------------------------
TRUB_CUPMC      AEDVGEALGCG-AHLIGLRRTAVGDLTLEGAVT---------------------------
TRUB_CUPPJ      AEDIGEALGCG-AHLTGLRRIAVGDLTLDGAVT---------------------------
TRUB_RALSO      GEDLGEALGCG-AHLVALRRTQVGSLTLDGAVT---------------------------
TRUB_BURPS      AEDIGEALGCG-AHLTMLRRTGVGPLTLEHAVT---------------------------
TRUB_BURMA      AEDIGEALGCG-AHLTMLRRTGVGPLTLEHAVT---------------------------
TRUB_BURP1      AEDIGEALGCG-AHLTMLRRTGVGPLTLEHAVT---------------------------
TRUB_BURP0      AEDIGEALGCG-AHLTMLRRTGVGPLTLEHAVT---------------------------
TRUB_BURM7      AEDIGEALGCG-AHLTMLRRTGVGPLTLEHAVT---------------------------
TRUB_BURP6      AEDIGEALGCG-AHLTMLRRTGVGPLTLEHAVT---------------------------
TRUB_BURL3      AEDIGEALGCG-AHLTMLRRTGVGALTLEHAVT---------------------------
TRUB_VEREI      AEDIGAALGCG-AHLSALRRTDSGGIGIERCIS---------------------------
TRUB_DECAR      AADIGKALGCG-AHLAALRRIVVGDIRLGNSVT---------------------------
TRUB_BORPE      AQDIGRALGCH-AHLAALRRTHVGPFSLDRAVT---------------------------
TRUB_BORBR      AQDIGRALGCH-AHLAALRRTHVGPFSLDRAVT---------------------------
TRUB_BORPA      AQDIGRALGCH-AHLAALRRTHVGPFSLDRAVT---------------------------
TRUB_BORA1      AQDIGRALGCY-AHLFALRRTQVGPFSLDRAVT---------------------------
TRUB_AROAE      AIDLGRLLGCG-GHLTELRRTRIGPFNVDEAVT---------------------------
TRUB_THIDA      AEDLGNALGCG-AHLTALTRTASGGFLLEQAHT---------------------------
TRUB_CHRVO      GCDIGEALGCG-AHLTALRRTATGGFSLDESHR---------------------------
TRUB_NEIMB      SEDIAKHIGTF-AHLTALRRTETAGFTIAQSHT---------------------------
TRUB_NEIG1      SEGIAKHIGTF-AHLTALRRTETAGFTIAQSHT---------------------------
TRUB_NEIMA      SEDIAKHIGTF-AHLTALRRTETAGFTIAQSHT---------------------------
TRUB_NITMU      AEDLGHALGCGGAYLTALRRSALGGFDLPQAYT---------------------------
TRUB_NITEU      AEDIGKALGYGGAYLTALSRISVGHFELSQACD---------------------------
TRUB_PSEAB      VEDLGQVLGCG-AHVAALRRTQAGPFALAQAIT---------------------------
TRUB_PSEAE      VEDLGQVLGCG-AHVAALRRTQAGPFALAQAIT---------------------------
TRUB_PSEA7      VEDLGQVLGCG-AHVAALRRTQAGPFVLAQAIT---------------------------
TRUB_PSEF5      VEDIGEKLGCG-AYVAELRRTQAGPFSLAQTVT---------------------------
TRUB_PSEPF      VEDIGEQLGCG-AYVAELRRTQAGPFTLAQTVT---------------------------
TRUB_PSE14      VEDIGEKLGCG-AYVAELRRTQAGPFTLAQTVT---------------------------
TRUB_PSEU2      VEDIGEKLGCG-AYVAELRRTQAGPFTLAQTVT---------------------------
TRUB_PSEP1      VEDIGEALGCG-AYVAELRRTQAGPFALAQTVT---------------------------
TRUB_PSEPG      VEDIGEALGCG-AYVAELRRTQAGPFALAQTVT---------------------------
TRUB_PSEE4      VEDIGEALGCG-AYVAELRRTQAGPFALAQTVT---------------------------
TRUB_PSEMY      VEDLGQLLGCG-AHVAELRRTKAGPFELARTVT---------------------------
TRUB_PSEU5      VEDLGQQLGCG-AHVAELRRTQAGPFDLSQTVT---------------------------
TRUB_COXBU      LDDVGEALGCG-AHVVALRRLRVAHYHEDQMIK---------------------------
TRUB_COXBR      LDDVGEALGCG-AHVVALRRLRVAHYHEDQMIK---------------------------
TRUB_COXBN      LDDVGEALGCG-AHVVALRRLRVAHYHEDQMIK---------------------------
TRUB_NITOC      AEDIGRALGCG-AHVIALRRTQVGSFGASDMIS---------------------------
TRUB_METFK      AEDIGSRLGCG-AHLGGLRRLTTAHFNLKNAVT---------------------------
TRUB_ACIAD      GEDIGEALGCG-GHLTALHRVQTGHFELVPEYT---------------------------
TRUB_MARMS      GEDIGEALGCG-AHLHSLHRISTAGYLPENMMT---------------------------
TRUB_LEGPC      VEDIGDTLKAG-AHMTKLHRLYTAGFENNRMYT---------------------------
TRUB_LEGPA      VEDIGDTLKAG-AHMTKLHRLYTAGFENNRMYT---------------------------
TRUB_LEGPH      VEDIGDTLKAG-AHMTKLHRLYTAGFENNRMYT---------------------------
TRUB_LEGPL      VEDIGDTLKAG-AHMTKLHRLYTAGFENNRMYT---------------------------
TRUB_MARHV      VEDIGEVLGCG-AHVSALRRTLASGYTLANAHD---------------------------
TRUB_HAHCH      VEDIGQVLGCG-AHVMELRRTRCGPFSLADSVE---------------------------
TRUB_SACD2      ASDIGADLELG-GHVAKLRRTQAGPFTIDQSIT---------------------------
TRUB_XANAC      ARDLGEALGCG-AHIASLRRLWVEPFRAPQMIT---------------------------
TRUB_XANC5      ARDLGEVLGCG-AHIASLRRLWVEPFRAPQMIT---------------------------
TRUB_XANOM      ARDLGEVLGCG-AHIASLRRLWVEPFRAPQMIT---------------------------
TRUB_XANOR      ARDLGEVLGCG-AHIASLRRLWVEPFRAPQMIT---------------------------
TRUB_XANCP      ARDLGEVLGCG-AHIAALRRVWVEPFRTPEMIT---------------------------
TRUB_XANC8      ARDLGEVLGCG-AHIAALRRVWVEPFRTPEMIT---------------------------
TRUB_XYLFA      VRDLGEILGCG-AHITALRRRWVAPFQIPKMLT---------------------------
TRUB_XYLFT      VRDLGEILGCG-AHINALRRRWVAPFQIPKMLT---------------------------
TRUB_METCA      ------------------------------------------------------------
TRUB_SERP5      TDDLGELLGCG-AHVIYLRRLQVATYPTERMVT---------------------------
TRUB_PECAS      IDDLGEQLGCG-AHVIYLRRLQVAIYPTERMVT---------------------------
TRUB_ECOL5      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERMVT---------------------------
TRUB_ECOL6      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERMVT---------------------------
TRUB_ECOLI      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERMVT---------------------------
TRUB_ECOHS      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERMVT---------------------------
TRUB_ECOUT      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERMVT---------------------------
TRUB_SHIF8      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERMVT---------------------------
TRUB_SHISS      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERMVT---------------------------
TRUB_ECOLC      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERMVT---------------------------
TRUB_ECOK1      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERMVT---------------------------
TRUB_ECO57      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERMVT---------------------------
TRUB_ECO24      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERMVT---------------------------
TRUB_SHIDS      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERMVT---------------------------
TRUB_SHIFL      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERIVT---------------------------
TRUB_SHIBS      IDDLGEKLGCG-AHVIYLRRLAVSKYPVERMVT---------------------------
TRUB_CITK8      IDDLGEKLGCG-AHVIFLRRLAVSKYPVDRMVT---------------------------
TRUB_SALCH      IDDLGEKLGCG-AHVTYLRRLTVSKYPVDRMVT---------------------------
TRUB_SALTY      IDDLGEKLGCG-AHVTYLRRLTVSKYPVDRMVT---------------------------
TRUB_SALTI      IDDLGEKLGCG-AHVTYLRRLTVSKYPVDRMVT---------------------------
TRUB_SALPA      IDDLGEKLGCG-AHVTYLRRLTVSKYPVDRMVT---------------------------
TRUB_SALPB      IDDLGEKLGCG-AHVTYLRRLTVSKYPVDRMVT---------------------------
TRUB_SALAR      IDDLGEKLGCG-AHVIYLRRLTVSKYPVERMVT---------------------------
TRUB_ENT38      IDDLGEKLGCG-AHVIYLRRLAVSKYPVDRMVT---------------------------
TRUB_KLEP7      IDDLGEKLGCG-AHVIFLRRLAVSKYPVERMVT---------------------------
TRUB_CROS8      IDDLGEKLGCG-AHVIYLRRLTVSKYPVERMVT---------------------------
TRUB_YERPE      IDDLGELLGCG-AHVSYLRRLQVATYPSERMVT---------------------------
TRUB_YERPA      IDDLGELLGCG-AHVSYLRRLQVATYPSERMVT---------------------------
TRUB_YERPP      IDDLGELLGCG-AHVSYLRRLQVATYPSERMVT---------------------------
TRUB_YERP3      IDDLGELLGCG-AHVSYLRRLQVATYPSERMVT---------------------------
TRUB_YERPN      IDDLGELLGCG-AHVSYLRRLQVATYPSERMVT---------------------------
TRUB_YERPS      IDDLGELLGCG-AHVSYLRRLQVATYPSERMVT---------------------------
TRUB_YERE8      IDDLGELLGCG-AHVSYLRRLQVATYPSDRMVT---------------------------
TRUB_YEREN      IDDLGELLGCG-AHVSYLRRLQVATYPSDRMVT---------------------------
TRUB_PHOLL      IDDLGELLGCG-AHVIYLRRLQVANYPNDRMVT---------------------------
TRUB_SODGM      IDDLGERLGCG-AHVMALRRLAVARYPIERMVT---------------------------
TRUB_VIBVU      VDDLGEMLGCG-AHVTMLRRTGVAKYPYENMVT---------------------------
TRUB_VIBVY      VDDLGEMLGCG-AHVTMLRRTGVAKYPYENMVT---------------------------
TRUB_VIBCB      VDDLGEMLGCG-AHVTMLRRTGVAKYPYEKMVT---------------------------
TRUB_VIBPA      VDDLGEMLGCG-AHVTMLRRTAVAKYPYEKMVT---------------------------
TRUB_VIBC3      VDDLGEMLGCG-AHVTMLRRVGVANYPYERMVT---------------------------
TRUB_VIBCH      VDDLGEMLGCG-AHVTMLRRVGVANYPYERMVT---------------------------
TRUB_ALIF1      PTILGEMLGCG-AHVTYLRRTGVSNYPYENMVT---------------------------
TRUB_PHOPR      TDDLGEMLGCG-AHVVYLRRTGVSDYPMENVVT---------------------------
TRUB_SHEHH      TDDLGEMLGCG-AHVIMLRRTQVAGYPYDKMVS---------------------------
TRUB_SHEPA      TDDLGEMLGCG-AHVIMLRRTQVAGYPYDKMVS---------------------------
TRUB_SHELP      TDDLGEMLGCG-AHVIMLRRTGVAGYPYDKMVT---------------------------
TRUB_SHEDO      TDDLGEMLGCG-AHVIMLRRTQVADYPYDKMVS---------------------------
TRUB_SHEFN      IDDLGEMLGCG-AHVVMLRRTQVAEYPYEKMVT---------------------------
TRUB_SHESR      IDDLGEMLGCG-AHVIMLRRTQVAHYPYDKMVT---------------------------
TRUB_SHESM      IDDLGEMLGCG-AHVIMLRRTQVAHYPYDKMVT---------------------------
TRUB_SHESA      IDDLGEMLGCG-AHVIMLRRTQVAHYPYDKMVT---------------------------
TRUB_SHESW      IDDLGEMLGCG-AHVIMLRRTQVAQYPYAKMVT---------------------------
TRUB_SHEPC      IDDLGEMLGCG-AHVIMLRRTQVAQYPYAKMVT---------------------------
TRUB_SHEB9      IDDLGEMLGCG-AHVIMLRRTQVAQYPYARMVS---------------------------
TRUB_SHEB8      IDDLGEMLGCG-AHVIMLRRTQVAQYPYARMVS---------------------------
TRUB_SHEB5      IDDLGEMLGCG-AHVIMLRRTQVAQYPYARMVS---------------------------
TRUB_SHEAM      IDDLGEKLGCG-AHVIMLRRTAVAGYPYERMVT---------------------------
TRUB_PSYIN      VDDLGELLGCG-AHVSVLRRTQVADYPYDKMVT---------------------------
TRUB_COLP3      VDDLGELLGCG-AHVAHLRRSAVGNYPVEKMIT---------------------------
TRUB_PSEA6      VDDLGQLLGCC-AYVSKLHRTAVADYPSDKMVT---------------------------
TRUB_HAEIE      VDDLGEVLGCG-AHVTMLRRTAVADYPVAEMMP---------------------------
TRUB_HAEIG      VDDLGEVLGCG-AHVTMLRRTAVADYPVAEMML---------------------------
TRUB_HAEI8      VDDLGEVLGCG-AHVTMLRRTAVADYPVAEMIP---------------------------
TRUB_HAEIN      VDDLGEVLGCG-AHVTMLRRTAVADYPVAEMMP---------------------------
TRUB_MANSM      VDDLGEYLGCG-AHVSMLRRTAVSDYPADKMLT---------------------------
TRUB_PASMU      VDDLGEYLGCG-AHVTVLRRTAVANYPVEAMMN---------------------------
TRUB_ACTP2      VDDLGEVLGCG-AHVTVLRRLAVANYPIEAMMS---------------------------
TRUB_HAEDU      IDDLGEKLGCG-AHVAILRRLAVADYPADAMMN---------------------------
TRUB_HAES1      VDDLGEVLGCG-AHVTRLRRIAVADYPYNKMMT---------------------------
TRUB_HISS2      VDDLGEVLGCG-AHVTRLRRIAVADYPYNKMMT---------------------------
TRUB_PSEHT      VDDLGEKLGCG-AHVVMLHRTAVGQYPAEKMVS---------------------------
TRUB_IDILO      VDDLGQLLGCG-AHVSMLHRNAVADIAEAAMVT---------------------------
TRUB_BUCAI      VEDLGEKLGCG-AHVIFLRRLEMASYLHSQLVT---------------------------
TRUB_BUCAP      IEDLGEKLFCG-AHVIRLRRLKIGLLSYSKLVK---------------------------
TRUB_BUCBP      IEDVGEKLNCG-AHVISLRRLQVGNYTSFQMID---------------------------
TRUB_BLOPB      VNDIGEYLGCG-AHVIELRRLSVGQYISSSMIN---------------------------
TRUB_BLOFL      VNDIGEYLGCG-AHIISLRRLMVGQYIASMMVN---------------------------
TRUB_WIGBR      VDDIGEKLFCG-AHIVKLRRTKLFNYKESHMID---------------------------
TRUB_FRATT      AIDIGKTLGCG-GHLIALQRTQSGPFKLSEAFR---------------------------
TRUB_FRAT1      AIDIGKTLGCG-GHLIALQRTQSGPFKLSEAFR---------------------------
TRUB_FRATW      AIDIGKTLGCG-GHLIALQRTQSGPFKLSEAFR---------------------------
TRUB_FRATH      AIDIGKTLGCG-GHLIALQRTQSGPFKLSEAFR---------------------------
TRUB_FRATF      AIDIGKTLGCG-GHLIALQRTQSGPFKLSEAFR---------------------------
TRUB_FRATO      AIDIGKTLGCG-GHLIALQRTQSGPFKLSEAFR---------------------------
TRUB_FRATN      AIDIGKTLGCG-GHLIALQRTQSGPFKLSEAFR---------------------------
TRUB_FRAP2      AIDIGKALGCG-GHLIALQRTQSGPFRIETALD---------------------------
TRUB_PSYCK      AEDIAKAMGTL-GHLTALRRLQVGDFKIDETIA---------------------------
TRUB_PSYA2      AEDIAKAIGTL-GHLTALSRLQVGDFKIDETIT---------------------------
TRUB_HYDCU      GEDIAKALGTV-GHLTGLHRTQTGALTGDEMAT---------------------------
TRUB_GEOSL      AHDMGERLGCG-AHLTELRRLSSGPFNLDRAIS---------------------------
TRUB_GEOMG      AHDMGERLGCG-AHLSALRRTRSGPFDLSRAVT---------------------------
TRUB_GEOUR      ANDIGGKLGCG-AHLLQLHRSLSGPFSINNAIT---------------------------
TRUB_PELCD      CHDIGVKLGCG-AHLTALRRLRSAPFDVKEAVT---------------------------
TRUB_DESAG      AHSLGNRLGCG-AVLTELIREYSHPFSLDEAHD---------------------------
TRUB_DESVH      AHSLGIRLGCG-AVLTELTREYSHPFGLDMAHT---------------------------
TRUB_DESPS      GSDIGKVLGCG-AHLTDLRRTKSGFFNVEDALT---------------------------
TRUB_SYNWW      CHDIGQELGCG-AYLSSLRRSRSGCFKIEEAVS---------------------------
TRUB_DEHMB      AFDLGRKLGCG-AYLKSLVREAYGQFNLTNSLD---------------------------
TRUB_DEHMC      AFDLGRKLGCG-AYLKSLVREAYGQFNLANSLD---------------------------
TRUB_DEHM1      AFDLGRKLGCG-AYLKTLVRESYGPFHLTTSLD---------------------------
TRUB_CHLMU      AHELGNMLGCG-AYLEELRRLRSGNFSIDQCID---------------------------
TRUB_CHLTR      AHELGNMLGCG-AYLEELRRLRSGSFSIDQCID---------------------------
TRUB_CHLFF      AHELGNMLGCG-AYLEELRRLRSGSFSIDQCID---------------------------
TRUB_CHLAB      AHELGNMLGCG-AYLEELRRLRSGSFSIDQCID---------------------------
TRUB_CHLPN      AHELGTMLGCG-AYLEQLRRLRSGRFSIDECID---------------------------
TRUB_PARUW      AYDLGTKLGCG-AHLSNLTRTRSGAFCLENCLN---------------------------
TRUB_AQUAE      AYDIGKKLGIG-GYMKELRRLKIDEISVEEAVS---------------------------
TRUB_SOLUE      AHDLGQALGCG-AHLQELRRLASGEFELDQART---------------------------
TRUB_THEMA      CMDIGYKLGCG-ATAVELVRESVGPHTIEESLN---------------------------
TRUB_THEP1      CMDIGYKLGCG-ATAVELVRESVGSYTIEESLN---------------------------
TRUB_THEM4      CMDIGYKLGCG-ATAKELKRLSVGTFDIRDAIN---------------------------
TRUB_SYNAS      CADLGERLGCG-ACMSVLRRLRCGCFTLETAVS---------------------------
TRUB_CALS8      AEEIAKKLSTV-ATLVQLRRAKNGVFDIKAAFS---------------------------
TRUB_BDEBA      IDLLGKALGCG-AAMSGLRRTWSSPYKIDQAQT---------------------------
TRUB_CLOAB      CYDIGNKLGCG-ALMYNLTRVSSGNFNSSFSIP---------------------------
TRUB_CLONN      CYDIGSNLKCG-ATMWDLERVQSGAFTKENSIE---------------------------
TRUB_CLOBL      CFDIGKDLDSG-AVMWNLQRLEASPFNIKEAIK---------------------------
TRUB_CLOTE      CYDIGNKLGMG-ATMWELERTKTGNFSIENSIN---------------------------
TRUB_CLOPE      CYDIGEKLNVG-ATMTALERIQNGTFTKEEAIN---------------------------
TRUB_CLOP1      CYDIGEKLNVG-ATMTALERIQNGTFTKEEAIN---------------------------
TRUB_CLOPS      CYDIGEKLNVG-ATMTALERIQNGPFIKEEAIN---------------------------
TRUB_CLOK5      CNDIGNNLNCG-GTMWNLKRLSTGNFNIADSIA---------------------------
TRUB_ALKOO      CKDIGEVLGCG-GVMSFLLRTASSDFSLDTAIT---------------------------
TRUB_LACP7      CRDIGEALQCG-GCMKSLIRTQVSIFTLENTLR---------------------------
TRUB_CLOD6      CHDIGEYLGCG-AHMSFLNRTSSGKFDLDNSIT---------------------------
TRUB_FUSNN      IYDIGQDLGTY-ATMTALQRKQVGEYSLENSYS---------------------------
TRUB_GEOTN      AVTIGERLGYP-AHMSDLIRTASGPFQLADCVT---------------------------
TRUB_GEOKA      AVMIGERLGYP-AHMSDLIRTASGPFRLEDCVT---------------------------
TRUB_BACHK      AVMIGEKLGFP-SHMSHLVRTASGEFLLEDCIS---------------------------
TRUB_BACAH      AVMIGEKLGFP-SHMSHLVRTASGEFLLEDCIS---------------------------
TRUB_BACCZ      AVMIGEKLGFP-SHMSHLVRTASGEFLLEDCIS---------------------------
TRUB_BACAN      AVMIGEKLGFP-SHMSHLVRTASGEFLLEDCIS---------------------------
TRUB_BACC1      AVMIGEKLGFP-SHMSHLVRTASGEFVLEDCIS---------------------------
TRUB_BACCR      AVMIGEKLGFP-SHMSHLVRTASGEFLLEDCIS---------------------------
TRUB_BACCN      AVMIGEKLGFP-AHMSDLVRTASGEFQLHDCVS---------------------------
TRUB_BACVZ      AVTIGEKLGYP-AHMSHLIRTASGDFSLDECFT---------------------------
TRUB_BACSU      AVMIGEKLGYP-AHMSHLIRTASGDFSLDECFT---------------------------
TRUB_BACLD      AVTIGEKLGYP-AHMSNLVRTASGPFTLDECLT---------------------------
TRUB_BACP2      AVDIGKKLGFP-AHMSHLIRTGSGDFTLDECIT---------------------------
TRUB_BACHD      AVDIGKALGYP-AHMSDLVRTKSGPFSLEECFT---------------------------
TRUB_BACSK      AVDIGKKAGYP-AHMSKLTRTASGPFTQADAIP---------------------------
TRUB_OCEIH      CVDIGKALGYP-AHMSLLTRTKTGAFSEKNTVT---------------------------
TRUB_LISMF      AVMIGELLGYP-AHMSKLERTRSGFFKKEDCLT---------------------------
TRUB_LISMO      AVMIGELLGYP-AHMSKLERTRSGFFKKEDCLT---------------------------
TRUB_LISIN      AVMIGELLGYP-AHMSKLERTRSGFFKKEDCLT---------------------------
TRUB_LISW6      AVMIGELLGYP-AHMSKLERTRSGFFKKEDCFT---------------------------
TRUB_STAEQ      ATDIGLKLGFP-AHMSRLTRIASGGFQLESSLT---------------------------
TRUB_STAES      ATDIGLKLGFP-AHMSRLTRIASGGFQLESSLT---------------------------
TRUB_STAAT      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAA3      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAA8      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAAC      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAAE      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAAS      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAAW      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAAR      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAA1      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAA2      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAAM      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAAN      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAA9      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAAB      ATDIGVKLGFP-AHMSKLTRIESGGFVLKDSLT---------------------------
TRUB_STAHJ      ATDIGKQLGYP-AHMSLLTRINSGGFDIKDSIT---------------------------
TRUB_STAS1      ATDIGKALGLP-AHMSKLTRTQSGGFDINESLT---------------------------
TRUB_LACPL      AVDVGKVLGVP-AVMSDLTRLKSGGFTLDETVT---------------------------
TRUB_LACBA      AVDLGQQLGVP-AVMATLTRLKSGGFTLSQTVT---------------------------
TRUB_LACP3      AVDVGKTLGVA-AVMSQLTRVKSGGFTLKQAVS---------------------------
TRUB_PEDPA      AVDFGRHFGLP-AVMSDLSRLASGGFKIEECLT---------------------------
TRUB_LACSS      AVDFGRKLGLP-AVMSDLTRLKSGGIQIGSCVT---------------------------
TRUB_LACS1      AVDVGKKLGVP-AVMSDLTRLKSGGFQIGMAKS---------------------------
TRUB_LACRD      VVDLARKLGYP-GVMSLLTRLKSGGFTLDQTLS---------------------------
TRUB_STRR6      SVDLGEKLGYA-AHMSHLTRTSAAGLQLEDALA---------------------------
TRUB_STRP2      SVDLGEKLGYA-AHMSHLTRTSAAGLQLEDALA---------------------------
TRUB_STRPN      SVDLGEKLGYA-AHMSHLTRTSAAGLQLEDALA---------------------------
TRUB_STRGC      SVDLGEKLGYA-AHMSHLTRTSAAGMRLGDALT---------------------------
TRUB_STRSV      SVDLGAKLGFA-SHMSQLTRTFSAGMSLDDALT---------------------------
TRUB_STRT2      SVDLGVKLGFA-SHMSALRRTASAGLTLDSSLS---------------------------
TRUB_STRT1      SVDLGVKLGFA-SHMSALRRTASAGLTLDSSLS---------------------------
TRUB_STRA1      AVDLGIKLGYA-SHMSFLKRTSSAGLSITQSLT---------------------------
TRUB_STRA3      AVDLGIKLGYA-SHMSFLKRTSSAGLSITQSLT---------------------------
TRUB_STRA5      AVDLGIKLGYA-SHMSFLKRTSSAGLSITQSLT---------------------------
TRUB_STRMU      AVDLGQKLGYA-SHMSFLKRTASAGLDLSQALT---------------------------
TRUB_STRP1      AVDLGRALGVE-SHMSFLQRSASAGLTLETAYT---------------------------
TRUB_STRP8      AVDLGRALGVE-SHMSFLQRSASAGLTLETAYT---------------------------
TRUB_STRPF      AVDLGRALGVE-SHMSFLQRSASAGLTLETAYT---------------------------
TRUB_STRP6      AVDLGRALGVE-SHMSFLQRSASAGLTLETAYT---------------------------
TRUB_STRPB      AVDLGRALGVE-SHMSFLQRSASAGLTLETAYT---------------------------
TRUB_STRPC      AVDLGRALGVE-SHMSFLQRSASAGLTLETAYT---------------------------
TRUB_STRP3      AVDLGRALGVE-SHMSFLQRSASAGLTLETAYT---------------------------
TRUB_STRPM      AVDLGRALWVE-SHMSFLQRSASAGLTLETAYT---------------------------
TRUB_STRPG      AVDLGRALGVE-SHMSFLQRSASAGLTLETAYT---------------------------
TRUB_STRPD      AVDLGRALGVE-SHMSFLQRSASAGLTLETAYT---------------------------
TRUB_LACLM      AVDLADSLGYA-GHMSKLQRTASNGLLIKDAIK---------------------------
TRUB_LACLS      AVDLADSLGYA-GHMSKLQRTASNGLLIKDAIK---------------------------
TRUB_LACLA      AVDLAEQLGYA-GHMSKLQRTASNGLMIKDAVK---------------------------
TRUB_LACDB      VNDLGEELGLP-AVMTKLRRTASSGYKLQDAVT---------------------------
TRUB_LACDA      VNDLGEELGLP-AVMTKLRRTASSGYKLQDAVT---------------------------
TRUB_LACGA      VNDLGEELGVP-AVMTSLTRTSSSGYDLNQAVD---------------------------
TRUB_LACJO      VNDLGEELGVP-AVMTSLTRTSSSGFDLSQAVD---------------------------
TRUB_LACAC      VNDLGEKLDEP-AVMTYLRRVASSGFDISQAVK---------------------------
TRUB_OENOB      IEDFGAKLGLP-ATMMRLRRIEADGYDVKNSIN---------------------------
TRUB_SYMTH      AHDLGRFLQVG-AHLSYLVRTRSGPFVLAQAAT---------------------------
TRUB_MOOTA      GADWGDYLGVG-ATLAFLLRTRAGSFRLTDAWT---------------------------
TRUB_PELTS      CHDMGSRLGCG-AHMSFLVRTRAGPFKIADSVT---------------------------
TRUB_CARHZ      ANEIGNLLKTG-ATLKFLLRTRSGPFLLDDSNL---------------------------
TRUB_CALS4      VRDICKKLEVP-GHMSFLIRTEVGDFDIESSYT---------------------------
TRUB_MYCMO      IYDIGIKLNS-LAYMESLERTKIGNLFLEKNQDDKI------------------------
TRUB_MYCH2      ADDLGKMLKT-RAYLSDLERTKIGNF--DKKFLNQS------------------------
TRUB_MYCPU      INQIGLELKT-YALMDDLERIELSGLS---KNDLGV------------------------
TRUB_WOLSU      GGMIASRLGC-YGALSSLERLSEGEMRF---EGYRE------------------------
TRUB_HELHP      GEIIAKKLGV-NGVLSSLERISEGQMSVSATEQIRI------------------------
TRUB_SULNB      GALIADRLRV-DATLSSLHRIHEGQFHY---ENEKA------------------------
TRUB_NITSB      AEAIAKKLGF-PGTLSYLERLAEGKFVY---ENENP------------------------
TRUB_SULDN      GLIIANRLGVKNGSLSALERLSEGRFKY---DNHKP------------------------
TRUB_CAMJJ      CELFARKLGI-NATLSSLERIKEGKFVY---NNEKS------------------------
TRUB_CAMJ8      CELFARKLGI-NATLSSLERIKEGKFVY---NNEKS------------------------
TRUB_CAMJE      CELFARKLGI-NATLSSLERIKEGKFVY---NNEKS------------------------
TRUB_CAMJR      CELFARKLGI-NATLSSLERIKEGKFVY---NNEKS------------------------
TRUB_CAMJD      CELFARKLGI-NATLSSLERIKEGKFVY---NNEKS------------------------
TRUB_CAMC1      AEIFGQKVGY-NVTLSSLKRVSEGKFRY---ENEKF------------------------
TRUB_CAMC5      AQLFGKRLGY-DVCLSELKRISEGKFRF---ENEKF------------------------
                                                                            

TRUB_UREPA      ---------------IEQVY----------------------------------------
TRUB_UREP2      ---------------IEQVY----------------------------------------
TRUB_MYCPE      ---------------LDQAY----------------------------------------
TRUB_MYCMS      ---------------LNNISWDH-------------------------------------
TRUB_MYCCT      ---------------IKDLSWKH-------------------------------------
TRUB_MESFL      ---------------IENCEESN-------------------------------------
TRUB_AYWBP      ---------------IENLELND-------------------------------------
TRUB_ONYPE      ---------------IENLELND-------------------------------------
TRUB_ACHLI      ---------------VEDTELPD-------------------------------------
TRUB_CAUVC      ---------------LETLENLSYEARLSE------------------------------
TRUB_CAUSK      ---------------LETLENLSYEARLSE------------------------------
TRUB_MARMM      ---------------LDELEEMAHKGAASE------------------------------
TRUB_BRUSI      ---------------LAKLEAVWPPLPPKD----------------------EDGNVIEP
TRUB_BRUAB      ---------------LAKLEAVWPPLPPKD----------------------EDGNVIEP
TRUB_BRUA2      ---------------LAKLEAVWPPLPPKD----------------------EDGNVIEP
TRUB_BRUSU      ---------------LAKLEAVWPPLPPKD----------------------EDGNVIEP
TRUB_BRUO2      ---------------LAKLEAVWPPLPPKD----------------------EDGNVIEP
TRUB_BRUC2      ---------------LAKLEAVWPPLPPKD----------------------EDGNVIEP
TRUB_BRUME      ---------------LAKLEAVWPPLPPKD----------------------EDGNVIEP
TRUB_OCHA4      ---------------LAELEQAWPPLPPKD----------------------EDGNVVEP
TRUB_RHILO      ---------------IAELEAARFGAQGEDKPEPA-----------------DDADAIDV
TRUB_CHESB      ---------------LKDLEGAAADAETES------------------------------
TRUB_RHIME      ---------------LADLVALEAIEDDAE------------------------------
TRUB_SINMW      ---------------LADLVALEKIEDEAE------------------------------
TRUB_RHIEC      ---------------LANLVALEAIEDMDE------------------------------
TRUB_RHIL3      ---------------LADLVALEAIEDMDE------------------------------
TRUB_AGRFC      ---------------LETLTALEAIEDRDE------------------------------
TRUB_BARHE      ---------------WDELKA-VELDKSAK-------------------------NEKDA
TRUB_BARQU      ---------------WEELKA-VALDKIAI-------------------------NENGI
TRUB_BART1      ---------------WDELKAAISPNKNTT-------------------------DENEN
TRUB_BARBK      ---------------WDALKA-AIPHENTT-------------------------DENCI
TRUB_BRADU      ---------------LDQLEALCDRAASGE------------------------------
TRUB_RHOPA      ---------------LEELQALCDRAASGE------------------------------
TRUB_GLUDA      ---------------LDKIVPSD------D------------------------------
TRUB_GLUOX      ---------------IDQISLDKSTQ-TVD------------------------------
TRUB_RHORT      ---------------LDMVDALG-------------------------------------
TRUB_RUEST      ---------------LEQIDALAKSPE---------------------------------
TRUB_RUEPO      ---------------LEQVEALAKTPE---------------------------------
TRUB_ROSDO      ---------------LETIEALARTPE---------------------------------
TRUB_RHOS4      ---------------VATIDELARSEA---------------------------------
TRUB_RHOS1      ---------------VATIDELARSEA---------------------------------
TRUB_RHOS5      ---------------VATIDELAKSEE---------------------------------
TRUB_DINSH      ---------------LETLEDLAKDPA---------------------------------
TRUB_JANSC      ---------------LDRVEALARTDA---------------------------------
TRUB_PARDP      ---------------FDRIDR-ANQAE---------------------------------
TRUB_EHRRW      ---------------LDKLKILHNNGD---------------------------------
TRUB_EHRRG      ---------------LDKLKILHNNGD---------------------------------
TRUB_EHRCJ      ---------------LEMLKTLYSTNC---------------------------------
TRUB_EHRCR      ---------------LEMLKMLYNNSR---------------------------------
TRUB_ANAMM      ---------------LDRLEALADADV---------------------------------
TRUB_ZYMMO      ---------------LDKLMEMAQAGK---------------------------------
TRUB_RICB8      ---------------IDSFNDITKLSLEEK------------------------------
TRUB_RICBR      ---------------IDSFNDITKLSLEEK------------------------------
TRUB_RICRS      ---------------IKSPDEITKNALEAK------------------------------
TRUB_RICRO      ---------------IKSPDEITKNALEAK------------------------------
TRUB_RICCK      ---------------IKSSDAIIKNSLEEK------------------------------
TRUB_RICAH      ---------------IKSPDEITKSFLEEK------------------------------
TRUB_RICTY      ---------------IKASDAITKNFIDKK------------------------------
TRUB_BORAP      ---------------CKNLSKASL------------------------------------
TRUB_BORBP      ---------------CKNLSKSSL------------------------------------
TRUB_BORBU      ---------------CENLSKASL------------------------------------
TRUB_TREPA      ---------------VSRLGSWTWGKERASCGAACFDVGAPPPPSSGGVATDSVSFGCED
TRUB_TREDE      ---------------FDLLNNFSAAPENLFLKEK----------KILDAAAGKKFYKQKE
TRUB_ARTS2      ---------------LEQLAEEL-------------------------------------
TRUB_PAEAT      ---------------LEELAEEL-------------------------------------
TRUB_THEFY      ---------------LDELAAEF-------------------------------------
TRUB_STRAW      ---------------LDQLQEEL-------------------------------------
TRUB_STRCO      ---------------LDQLQQEL-------------------------------------
TRUB_LEIXX      ---------------LATLEPAA-------------------------------------
TRUB_CUTAK      ---------------FAQDAVTP-------------------------------------
TRUB_CORGL      ---------------LSKLQENPE------------------------------------
TRUB_CORGB      ---------------LSKLQENPE------------------------------------
TRUB_COREF      ---------------LADLQDNAR------------------------------------
TRUB_CORDI      ---------------LEKLEENPH------------------------------------
TRUB_CORJK      ---------------LEQLEEDPS------------------------------------
TRUB_MYCTU      ---------------LDDLAERPA------------------------------------
TRUB_MYCBP      ---------------LDDLAERPA------------------------------------
TRUB_MYCBO      ---------------LDDLAERPA------------------------------------
TRUB_MYCTA      ---------------LDDLAERPA------------------------------------
TRUB_MYCA1      ---------------LDELAECPR------------------------------------
TRUB_MYCPA      ---------------LDELAECPR------------------------------------
TRUB_MYCLE      ---------------LEDLAELPR------------------------------------
TRUB_MYCUA      ---------------LDELAERPA------------------------------------
TRUB_NOCFA      ---------------LDALADEPR------------------------------------
TRUB_RHOJR      ---------------LEQLAEEPG------------------------------------
TRUB_BIFLO      REGQTVTRNKCVLDTPEGLAGDERRN----------------------------------
TRUB_DEIRA      ---------------LENLTEAP-------------------------------------
TRUB_DEIGD      ---------------VEDLAGAE-------------------------------------
TRUB_THET2      ---------------LSDLSPEK-------------------------------------
TRUB_THET8      ---------------LSDLSPEK-------------------------------------
TRUB_TROWT      -------------GNTQGLTDNMAIS------ESDKHDCTEPGINCTELGIKDTCTALRE
TRUB_TROW8      -------------GNTQGLTDNMAISDNMAISESDKHDCTEPGINCTELGIKDTCTALRE
TRUB_TRIV2      ---------------LTDLET---QL----------------------------------
TRUB_NOSS1      ---------------LTDLET---QL----------------------------------
TRUB_TRIEI      ---------------FAEVEN---QL----------------------------------
TRUB_ACAM1      ---------------FETLAE---QV----------------------------------
TRUB_SYNP6      ---------------LTELLD---G-----------------------------------
TRUB_SYNE7      ---------------LTELLD---G-----------------------------------
TRUB_GLOVI      ---------------LAAVEA---GF----------------------------------
TRUB_THEEB      ---------------LESIA----------------------------------------
TRUB_SYNY3      ---------------LTALEK---IVA---------------------------------
TRUB_MICAN      ---------------LEALM----------------------------------------
TRUB_PROMT      ---------------LPEKS---DFYP---------------------------------
TRUB_PROM1      ---------------LPEKS---DFYP---------------------------------
TRUB_PROMA      ---------------LPDLD---KNN----------------------------------
TRUB_SYNPW      ---------------LPERPEPGATAT---------------------------------
TRUB_SYNPX      ---------------LPE-----ADAT---------------------------------
TRUB_SYNS3      ---------------LPVHPNE-QSGP---------------------------------
TRUB_PROMM      ---------------LPDR----DNPA---------------------------------
TRUB_PROMP      ---------------ISDLS--DNN-----------------------------------
TRUB_PROM5      ---------------ISDLV--NLN-----------------------------------
TRUB_PROM0      ---------------ISDIE--KDK-----------------------------------
TRUB_PROMS      ---------------ISDIE--KEKGK---------------------------------
TRUB_PROM9      ---------------ISDIK--KGIDQ---------------------------------
TRUB_PROM2      ---------------ISDIE--KAK-----------------------------------
TRUB_BACFN      ---------------PAKFAE---------------------------------------
TRUB_BACFR      ---------------PAKFAE---------------------------------------
TRUB_BACTN      ---------------PEHFKE---------------------------------------
TRUB_BACV8      ---------------VESFPE---------------------------------------
TRUB_PARD8      ---------------PEEIDD---------------------------------------
TRUB_FLAJ1      ---------------ITLFEE---------------------------------------
TRUB_PELLD      ---------------VEDARA---------------------------------------
TRUB_CHLPM      ---------------VEDAVA---------------------------------------
TRUB_CHLCH      ---------------VNDTIE---------------------------------------
TRUB_CHLTE      ---------------VDAVVD---------------------------------------
TRUB_RHOBA      ---------------CAFMFD---------------------------------------
TRUB_CUPMC      ---------------LEQIDAQADEARP--------------------------------
TRUB_CUPPJ      ---------------LDQIDAQADEARP--------------------------------
TRUB_RALSO      ---------------LEALEAASEDQRA--------------------------------
TRUB_BURPS      ---------------LDALDAATQDERD--------------------------------
TRUB_BURMA      ---------------LDALDAATQDERD--------------------------------
TRUB_BURP1      ---------------LDALDAATQDERD--------------------------------
TRUB_BURP0      ---------------LDALDAATQDERD--------------------------------
TRUB_BURM7      ---------------LDALDAATQDERD--------------------------------
TRUB_BURP6      ---------------LDALDAATQDERD--------------------------------
TRUB_BURL3      ---------------LDALSDADDASRD--------------------------------
TRUB_VEREI      ---------------LERLQALPEAERL--------------------------------
TRUB_DECAR      ---------------LAELETLDEAGRM--------------------------------
TRUB_BORPE      ---------------LEALQAMPDAKQ---------------------------------
TRUB_BORBR      ---------------LEALQAMPDAKQ---------------------------------
TRUB_BORPA      ---------------LEALQAMPDAKQ---------------------------------
TRUB_BORA1      ---------------LDALQAMTDPKA---------------------------------
TRUB_AROAE      ---------------LTALEALPAESRV--------------------------------
TRUB_THIDA      ---------------LAELEATNAGARQ--------------------------------
TRUB_CHRVO      ---------------LADLESLDMPARE--------------------------------
TRUB_NEIMB      ---------------LEALANLNETERD--------------------------------
TRUB_NEIG1      ---------------LEALANLNETERD--------------------------------
TRUB_NEIMA      ---------------LEALANLDETERD--------------------------------
TRUB_NITMU      ---------------LTGLEAMPPSQRD--------------------------------
TRUB_NITEU      ---------------LDQLESETPVNRQ--------------------------------
TRUB_PSEAB      ---------------LETLERVHAEGGP--------------------------------
TRUB_PSEAE      ---------------LETLERVHAEGGP--------------------------------
TRUB_PSEA7      ---------------LETLERVHAEGGP--------------------------------
TRUB_PSEF5      ---------------LEELEAVHAEGGN--------------------------------
TRUB_PSEPF      ---------------LEELEAVHAEGGN--------------------------------
TRUB_PSE14      ---------------LEELEQVHADGGN--------------------------------
TRUB_PSEU2      ---------------LEELEQVHADGGN--------------------------------
TRUB_PSEP1      ---------------LEELEQAHAEGGN--------------------------------
TRUB_PSEPG      ---------------LEELEQAHADGGN--------------------------------
TRUB_PSEE4      ---------------LEELEQAHAEGGN--------------------------------
TRUB_PSEMY      ---------------LEELEAVHAEGGS--------------------------------
TRUB_PSEU5      ---------------LETLERLHGEGGA--------------------------------
TRUB_COXBU      ---------------LAHLEREYDKANY--------------------------------
TRUB_COXBR      ---------------LAHLEREYDKANY--------------------------------
TRUB_COXBN      ---------------LAHLEREYDKANY--------------------------------
TRUB_NITOC      ---------------LEELEM-LAETNV--------------------------------
TRUB_METFK      ---------------IEQLDQMSQAER---------------------------------
TRUB_ACIAD      ---------------LEYLEQ-LNETER--------------------------------
TRUB_MARMS      ---------------LEEFEA-IAEQGY--------------------------------
TRUB_LEGPC      ---------------LDELQDMPLSQRL--------------------------------
TRUB_LEGPA      ---------------LDELQDMPLSQRL--------------------------------
TRUB_LEGPH      ---------------LDELQDMPLSQRL--------------------------------
TRUB_LEGPL      ---------------LDELQDMPLSQRL--------------------------------
TRUB_MARHV      ---------------VKDLEAMRER---G-------------------------------
TRUB_HAHCH      ---------------FVSFADESGRQAAA-------------------------------
TRUB_SACD2      ---------------IEELEQERGER-LA-------------------------------
TRUB_XANAC      ---------------LEALSAVLEAG----------------------------------
TRUB_XANC5      ---------------LEALSAALEAG----------------------------------
TRUB_XANOM      ---------------LEGLATALEAG----------------------------------
TRUB_XANOR      ---------------LEGLATALEAG----------------------------------
TRUB_XANCP      ---------------LEALTALVESG----------------------------------
TRUB_XANC8      ---------------LEALTALVESG----------------------------------
TRUB_XYLFA      ---------------LDALEQALSAG----------------------------------
TRUB_XYLFT      ---------------LDALEQALSAG----------------------------------
TRUB_METCA      --------------------QAVEK-----------------------------------
TRUB_SERP5      ---------------LEQLNELLEQAHRQEI-----------------------------
TRUB_PECAS      ---------------LEQLAALAEQAQTQEH-----------------------------
TRUB_ECOL5      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_ECOL6      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_ECOLI      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_ECOHS      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_ECOUT      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_SHIF8      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_SHISS      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_ECOLC      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_ECOK1      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_ECO57      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_ECO24      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_SHIDS      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_SHIFL      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_SHIBS      ---------------LEHLRELVEQAEQQDI-----------------------------
TRUB_CITK8      ---------------LEQLRELVEQAERQDI-----------------------------
TRUB_SALCH      ---------------LEHLQTLVAQAEQQGV-----------------------------
TRUB_SALTY      ---------------LEHLQTLVAQAEQQGV-----------------------------
TRUB_SALTI      ---------------LEHLQTLVAQAEQQGV-----------------------------
TRUB_SALPA      ---------------LEHLQTLVAQAEQQGV-----------------------------
TRUB_SALPB      ---------------LEHLQTLVAQAEQQGV-----------------------------
TRUB_SALAR      ---------------LEHLQALAAQAEQQGV-----------------------------
TRUB_ENT38      ---------------LEQLRELVEQAETQGI-----------------------------
TRUB_KLEP7      ---------------LEQLQALVDEAAAQDI-----------------------------
TRUB_CROS8      ---------------LEQLNALLEEAQTRDI-----------------------------
TRUB_YERPE      ---------------LEQLTAMVEAAQAEGR-----------------------------
TRUB_YERPA      ---------------LEQLTAMVEAAQAEGR-----------------------------
TRUB_YERPP      ---------------LEQLTAMVEAAQAEGR-----------------------------
TRUB_YERP3      ---------------LEQLTAMVEAAQAEGR-----------------------------
TRUB_YERPN      ---------------LEQLTAMVEAAQAEGR-----------------------------
TRUB_YERPS      ---------------LEQLTAMVEAAQAEGR-----------------------------
TRUB_YERE8      ---------------LEQLTAIVETAQAEER-----------------------------
TRUB_YEREN      ---------------LEQLTAIVETAQAEER-----------------------------
TRUB_PHOLL      ---------------LEQLYELQKQAKDQEI-----------------------------
TRUB_SODGM      ---------------LAALQAIAADAPPDTL-----------------------------
TRUB_VIBVU      ---------------LEQLNELVDNANRDGV-----------------------------
TRUB_VIBVY      ---------------LEQLNELVDNANRDGV-----------------------------
TRUB_VIBCB      ---------------LEQLNELLEQAHRDEV-----------------------------
TRUB_VIBPA      ---------------LEQLNELLEQAHREEI-----------------------------
TRUB_VIBC3      ---------------LEQLNALVEQAHRDEK-----------------------------
TRUB_VIBCH      ---------------LEQLNALVEQAHRDEK-----------------------------
TRUB_ALIF1      ---------------IEDLEALLEQAHREER-----------------------------
TRUB_PHOPR      ---------------LEQLQALRDQAIEQGI-----------------------------
TRUB_SHEHH      ---------------LKQLEELVTKADAESL-----------------------------
TRUB_SHEPA      ---------------LKQLEELVAKADAESL-----------------------------
TRUB_SHELP      ---------------LEQLEALLAKAQEEER-----------------------------
TRUB_SHEDO      ---------------LADLEALVTQAQQQEL-----------------------------
TRUB_SHEFN      ---------------LAQLEALLEQAHRQDV-----------------------------
TRUB_SHESR      ---------------LEQLEALVAKAQEEQL-----------------------------
TRUB_SHESM      ---------------LEQLEALVAKAQEEQL-----------------------------
TRUB_SHESA      ---------------LEQLEALVAKAQEEQL-----------------------------
TRUB_SHESW      ---------------LEQLEALVTQAHEQQI-----------------------------
TRUB_SHEPC      ---------------LEQLEALVTQAHEQQI-----------------------------
TRUB_SHEB9      ---------------LEQLEALVAQAHEQQI-----------------------------
TRUB_SHEB8      ---------------LEQLEALVAQAHEQQI-----------------------------
TRUB_SHEB5      ---------------LEQLEALVAQAHEQQI-----------------------------
TRUB_SHEAM      ---------------IEALEALLEQAEKEGV-----------------------------
TRUB_PSYIN      ---------------IEQLEALIEQAKESDV-----------------------------
TRUB_COLP3      ---------------LPELEALLEQANADEI-----------------------------
TRUB_PSEA6      ---------------FEMLESLLEKAQAEQI-----------------------------
TRUB_HAEIE      ---------------INELQLLAESF----------------------------------
TRUB_HAEIG      ---------------INELELLAESF----------------------------------
TRUB_HAEI8      ---------------INELQLLAESF----------------------------------
TRUB_HAEIN      ---------------INELQLLAESF----------------------------------
TRUB_MANSM      ---------------WEQLQQFAQDE----------------------------------
TRUB_PASMU      ---------------WDTLQVLAAQQ----------------------------------
TRUB_ACTP2      ---------------YADLQNLSENQ----------------------------------
TRUB_HAEDU      ---------------YASLQHLSETE----------------------------------
TRUB_HAES1      ---------------LEQLQQFSEQE----------------------------------
TRUB_HISS2      ---------------LEQLQQFSEQE----------------------------------
TRUB_PSEHT      ---------------LDEIEALLAKAKDEEV-----------------------------
TRUB_IDILO      ---------------LEQLETLAEEG----------------------------------
TRUB_BUCAI      ---------------ISYLHKLLRKEKNNNF-----------------------------
TRUB_BUCAP      ---------------LSFLENLLNEKNVVKI-----------------------------
TRUB_BUCBP      ---------------IKTLNKLVKYNINV-------------------------------
TRUB_BLOPB      ---------------PA-------------------------------------------
TRUB_BLOFL      ---------------IK-------------------------------------------
TRUB_WIGBR      ---------------SNKLYNIKKKFNDL-------------------------------
TRUB_FRATT      ---------------LEQLKDLSFEQKI--------------------------------
TRUB_FRAT1      ---------------LEQLKDLSFEQKI--------------------------------
TRUB_FRATW      ---------------LEQLKDLSFEQKI--------------------------------
TRUB_FRATH      ---------------LEQLKDLSFEQKI--------------------------------
TRUB_FRATF      ---------------LEQLKDLSFEQKI--------------------------------
TRUB_FRATO      ---------------LEQLKDLSFEQKI--------------------------------
TRUB_FRATN      ---------------LEQLKDLSFEQKI--------------------------------
TRUB_FRAP2      ---------------LDNLKDLSFEQKL--------------------------------
TRUB_PSYCK      ---------------LADLEALPLEQRQ--------------------------------
TRUB_PSYA2      ---------------LANLEALALEQRQ--------------------------------
TRUB_HYDCU      ---------------LEEIEL----NKD--------------------------------
TRUB_GEOSL      ---------------LERLKELAEAGNL--------------------------------
TRUB_GEOMG      ---------------LDELASIKEQGAV--------------------------------
TRUB_GEOUR      ---------------LDDWARRMQDGRA--------------------------------
TRUB_PELCD      ---------------LEAIELMAPE-DR--------------------------------
TRUB_DESAG      ---------------LDDV--LAEPAEL--------------------------------
TRUB_DESVH      ---------------LDAV--LAEPGRL--------------------------------
TRUB_DESPS      ------------------------------------------------------------
TRUB_SYNWW      ---------------LDYIIEKREN--L--------------------------------
TRUB_DEHMB      ---------------FADLEAAKCDGKL--------------------------------
TRUB_DEHMC      ---------------FADLEAAKCDGKL--------------------------------
TRUB_DEHM1      ---------------LADLEAAENKGRL--------------------------------
TRUB_CHLMU      ---------------GNHLDEP--------------------------------------
TRUB_CHLTR      ---------------GNLLDEP--------------------------------------
TRUB_CHLFF      ---------------GCLLDRP--------------------------------------
TRUB_CHLAB      ---------------GCLLDCP--------------------------------------
TRUB_CHLPN      ---------------GNLLDHP--------------------------------------
TRUB_PARUW      ---------------GAEIHTV--------------------------------------
TRUB_AQUAE      ---------------LEEFLS---SENPEE------------------------------
TRUB_SOLUE      ---------------LEQLESLAAEDRLPD------------------------------
TRUB_THEMA      ---------------VFEAA----PEEIEN------------------------------
TRUB_THEP1      ---------------VFEAA----PEEIEN------------------------------
TRUB_THEM4      ---------------PFEVG----REKLLE------------------------------
TRUB_SYNAS      ---------------LEDIADGKGRETLLS------------------------------
TRUB_CALS8      ---------------LDFISEDS-------------------------------------
TRUB_BDEBA      ---------------LEQIEASVKGGSLGP------------------------------
TRUB_CLOAB      ---------------LEDLNEQ----NITE------------------------------
TRUB_CLONN      ---------------LNKLTTD----NIND------------------------------
TRUB_CLOBL      ---------------LEDLNEE----NIKQ------------------------------
TRUB_CLOTE      ---------------LEDINEE----NIQE------------------------------
TRUB_CLOPE      ---------------IEDLTEE----LLEK------------------------------
TRUB_CLOP1      ---------------IEDLTEE----LLEK------------------------------
TRUB_CLOPS      ---------------IEDLTEE----LLEK------------------------------
TRUB_CLOK5      ---------------LEYLDSE----NILK------------------------------
TRUB_ALKOO      ---------------IEELQAL---ENVED------------------------------
TRUB_LACP7      ---------------LAEIEECVKNQTLEQ------------------------------
TRUB_CLOD6      ---------------LEELELFYENKTLDK------------------------------
TRUB_FUSNN      ---------------LEQIEEMTL-NNNFK------------------------------
TRUB_GEOTN      ---------------LEEVERRAADGTVDA------------------------------
TRUB_GEOKA      ---------------FEDVERRAADGTADA------------------------------
TRUB_BACHK      ---------------FEEIEENVQNGTVES------------------------------
TRUB_BACAH      ---------------FEEIEENVQNGTVES------------------------------
TRUB_BACCZ      ---------------FEEIEENVQNGTVES------------------------------
TRUB_BACAN      ---------------FEEIEENVQNGTVES------------------------------
TRUB_BACC1      ---------------FEEIEENVQNGTVES------------------------------
TRUB_BACCR      ---------------FEEIEENVQNGTVES------------------------------
TRUB_BACCN      ---------------FEEIEENMQNGTVES------------------------------
TRUB_BACVZ      ---------------FEELEQQVSDGTVAE------------------------------
TRUB_BACSU      ---------------FDELEAQAQSGTVEE------------------------------
TRUB_BACLD      ---------------FEDVEGLIADGTLSE------------------------------
TRUB_BACP2      ---------------LDELRDISEEGTVDE------------------------------
TRUB_BACHD      ---------------FTELEERLEQGEGSS------------------------------
TRUB_BACSK      ---------------LSAFAE-MSLDERLN------------------------------
TRUB_OCEIH      ---------------FDMIEEAVSNQSEER------------------------------
TRUB_LISMF      ---------------LAEIDEMMQASDS-S------------------------------
TRUB_LISMO      ---------------LTEIDEMMQASDS-S------------------------------
TRUB_LISIN      ---------------LAEIDEKMQANDT-D------------------------------
TRUB_LISW6      ---------------LSEIDEMMQANDL-N------------------------------
TRUB_STAEQ      ---------------IDQIKELHEHDSLHN------------------------------
TRUB_STAES      ---------------IDQIKELHEHDSLHN------------------------------
TRUB_STAAT      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAA3      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAA8      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAAC      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAAE      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAAS      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAAW      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAAR      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAA1      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAA2      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAAM      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAAN      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAA9      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAAB      ---------------LEQIKELHEQDSLQN------------------------------
TRUB_STAHJ      ---------------LDQISQLHEQDTLQP------------------------------
TRUB_STAS1      ---------------LEDIKSLHEHDTLLE------------------------------
TRUB_LACPL      ---------------FEEIAAHVDAGTAGA------------------------------
TRUB_LACBA      ---------------LADVEAAMADDQIER------------------------------
TRUB_LACP3      ---------------IEQLKAHAAAGTLAD------------------------------
TRUB_PEDPA      ---------------LSDLEQARDEDRLST------------------------------
TRUB_LACSS      ---------------LAQLAEAADNGQLAD------------------------------
TRUB_LACS1      ---------------LSQLEKLAHENKLSE------------------------------
TRUB_LACRD      ---------------LDDVRDAVATQTLQQ------------------------------
TRUB_STRR6      ---------------LEEIAEKVEAGQLD-------------------------------
TRUB_STRP2      ---------------LEEIAEKVEAGQLD-------------------------------
TRUB_STRPN      ---------------LEEIAEKVEAGQLD-------------------------------
TRUB_STRGC      ---------------LEQIAERVAEEDYS-------------------------------
TRUB_STRSV      ---------------LDEIAERVAVDDFS-------------------------------
TRUB_STRT2      ---------------LSQISEMVEAGDQS-------------------------------
TRUB_STRT1      ---------------LSQISEMVEAGDQS-------------------------------
TRUB_STRA1      ---------------LEEINEKYKQEDFS-------------------------------
TRUB_STRA3      ---------------LEEINEKYKQEDFS-------------------------------
TRUB_STRA5      ---------------LEEINEKYKQEDFS-------------------------------
TRUB_STRMU      ---------------LAEIAEKVEEKDFS-------------------------------
TRUB_STRP1      ---------------LGEIADMVSKQEMS-------------------------------
TRUB_STRP8      ---------------LGEIADMVSKQEMS-------------------------------
TRUB_STRPF      ---------------LGEIADMVSKQEMS-------------------------------
TRUB_STRP6      ---------------LGEIADMVSKQEMS-------------------------------
TRUB_STRPB      ---------------LGEIADMVSKQEMS-------------------------------
TRUB_STRPC      ---------------LGEIADMVSKQEMS-------------------------------
TRUB_STRP3      ---------------LGEIADMVSKQEMS-------------------------------
TRUB_STRPM      ---------------LGEIADMVSKQEMS-------------------------------
TRUB_STRPG      ---------------LGEIADMVSKQEMS-------------------------------
TRUB_STRPD      ---------------LGEIADMVSKQEMS-------------------------------
TRUB_LACLM      ---------------LSKIEEIKESGKLST------------------------------
TRUB_LACLS      ---------------LSKIEEIQESGKLST------------------------------
TRUB_LACLA      ---------------LSEIEVAMEAGELSS------------------------------
TRUB_LACDB      ---------------LEELADNLD--HAED------------------------------
TRUB_LACDA      ---------------LEELADNLD--HAED------------------------------
TRUB_LACGA      ---------------LETIEAEID--TPGK------------------------------
TRUB_LACJO      ---------------LETIEKEID--YPEK------------------------------
TRUB_LACAC      ---------------LSEIEANPE--KASE------------------------------
TRUB_OENOB      ---------------LEEI---LASKTPRK------------------------------
TRUB_SYMTH      ---------------LEELAAGKAR-----------------------------------
TRUB_MOOTA      ---------------LEEIAGAIDRGE-RT------------------------------
TRUB_PELTS      ---------------LEELQAAASKGVLER------------------------------
TRUB_CARHZ      ---------------LHEDFT---------------------------------------
TRUB_CALS4      ---------------LEEIKEGKAE-----------------------------------
TRUB_MYCMO      ---------------LNAKEIIQLEIIQL-------------------------------
TRUB_MYCH2      ---------------LKPQDLFDLQQVKL-------------------------------
TRUB_MYCPU      ---------------VSDLDIIDLEVLSL-------------------------------
TRUB_WOLSU      ---------------LEPLEILPYPKID--------------------------------
TRUB_HELHP      ---------------LNPLEYLPYPQLEN-------------------------------
TRUB_SULNB      ---------------LDPFTHLAIPSNI--------------------------------
TRUB_NITSB      ---------------LDPVQYLRTKQNF--------------------------------
TRUB_SULDN      ---------------LDIKKSLNMMQNF--------------------------------
TRUB_CAMJJ      ---------------LNVLKYIDLKPN---------------------------------
TRUB_CAMJ8      ---------------LNVLKYINLKPN---------------------------------
TRUB_CAMJE      ---------------LNVLKYINLKPN---------------------------------
TRUB_CAMJR      ---------------LNVLKYINLKPN---------------------------------
TRUB_CAMJD      ---------------LNVLKYINLKPN---------------------------------
TRUB_CAMC1      ---------------LNICNFLNIEQNT--------------------------------
TRUB_CAMC5      ---------------LNICEILNLPRNK--------------------------------
                                                                            

TRUB_UREPA      --------------DYWNNINKYL------------------------------------
TRUB_UREP2      --------------DYWNNINKYL------------------------------------
TRUB_MYCPE      --------------DFFDLVKQVN------------------------------------
TRUB_MYCMS      ------------LISINDAIRTNDFKVVKYQNSLEIIQGKKIILNDINDDLVFIS-----
TRUB_MYCCT      ------------LTSIYDAVKINDFKVVKYHNILDVKQGKKIVLNNIKDQLVFIS-----
TRUB_MESFL      ------------LIKMFDAIKMADYEIVELDDTLNVEHGKKIEVIAEKN-IVFIS-----
TRUB_AYWBP      ------------LILDSIFFASYDELILNDYLIKLVKNGTYLDQRQIITQKPFIV-----
TRUB_ONYPE      ------------LILDSTFFAAYDELILNDYLIKLVKNGTHLDQRQITTKKPFIV-----
TRUB_ACHLI      ------------LIDHALLFEGVKKIVLNDYLIKLVKNGVVLDERQTTLNEPFIV-----
TRUB_CAUVC      -----------ALLPVETALDDIPALAVTDEDAFRLAQGRA------IVLLPRQVETLKA
TRUB_CAUSK      -----------ALLPVETALDDIPALAVTDEDAFRLAQGRA------IVLLPRQVESLKA
TRUB_MARMM      -----------ALLPVQTALDDIPALAITEEESFQLKLGRS------IVLLPRQAQELKA
TRUB_BRUSI      APRRDFSALDALVIDTGAALDCLPQVPLSDDQAQRVRLGNP------VILRGRDAPLEAD
TRUB_BRUAB      APRRDFSALDALVIDTGAALDCLPQVPLSDDQAQRVRLGNP------VILRGRDAPLEAD
TRUB_BRUA2      APRRDFSALDALVIDTGAALDCLPQVPLSDDQAQRVRLGNP------VILRGRDAPLEAD
TRUB_BRUSU      APRRDFSALDALVIDTGAALDCLPQVPLSDDQAQRVRLGNP------VILRGRDAPLEAD
TRUB_BRUO2      APRRDFSALDALVIDTGAALDCLPQVPLSDDQAQRVRLGNP------VILRGRDAPLEAD
TRUB_BRUC2      APRRDFSALDALVIDTGAALDCLPQVPLSDDQAQRVRLGNP------VILRGRDAPLEAD
TRUB_BRUME      APRRDFSALDALVIDTGAALDCLPQVPLSDDQAQRVRLGNP------VILRGRDAPLEAD
TRUB_OCHA4      TPRRDFSAIDALVIDTGAALDCLPQVPLTDDQAQRVRLGNP------VILRGRDAPLEAD
TRUB_RHILO      PV--DFGAIDALLVDTSAALDCLPQIAISDDAATKIRLGNP------VIIRGRDAPVEAE
TRUB_CHESB      ---DRFSALDSYLLDTEAALDGLPEIVLGDDAAGRIRLGNP------VIVRGRDAPVQAP
TRUB_RHIME      ----RLAALDAYLIDTGEALSDLPHIAVNDDQAHRLRMGNP------IILRGRDAPLPTP
TRUB_SINMW      ----RLAALDEHLIDTGEALSDLPHIAVNDDQAHRLRMGNP------IILRGRDAPLPTP
TRUB_RHIEC      ----RLAALDALLIDTCEALSALPHLVINDDQAHRLKMGNP------ILVRGRDAPIAES
TRUB_RHIL3      ----RLAALDALLIDTCEALSSLPHLVINDDQAHRLKMGNP------ILVRGRDAPVAES
TRUB_AGRFC      ----RLEALDAFLIDTAEALSSLPRLIINDDQAHRLKMGNP------ILLRGRDAPANHP
TRUB_BARHE      PFERNFIKLDELLIETISALECLSHYTLSQTQAQQVMKGNT------VLLYHHDVPLDED
TRUB_BARQU      PSERNFTKIDELLIETGAALKCLSHYTLSETRAQ--------------------------
TRUB_BART1      SFEKDFLTLDELLIETGAALDCLPHYPLTDTQAQRVMRGHS------IPLSAQKTLLDEE
TRUB_BARBK      PLKQNFSTLDGLLIETDVALKCLAHYTLNQIQAQRVRMGNS------ILLCDQNMPTSNI
TRUB_BRADU      ------GSLADALLPVETALDDIPALAVTRADAARLHRGQA------VLLRGRDAPTCSG
TRUB_RHOPA      ------GSLADALLPVETALDDIPALAVTRADAARLHRGQA------VLLRGRDAPHCSG
TRUB_GLUDA      ----NAPASPDLLLPVATALADIPALALTHEEADALSHGRA------VSLLDLMGRIPDA
TRUB_GLUOX      ----NADALPAPLLDAATALVDIPALAVTDAEGRMLVWGQS------IDPADLVHPLPAS
TRUB_RHORT      ----HDAPHSESLLPIEAALADIPAVPLTEAEARRLSQGQP------VSLLHLASRTPLN
TRUB_RUEST      --------IDQFLRPLEEGLADLPELKCTPQGATRLRNGNP------GMVIASDVEYGEE
TRUB_RUEPO      --------LDSYLRPLEEGLADLPELKCSPEGAQRLRNGNP------GMVYPGEAEYGDE
TRUB_ROSDO      --------LDAHVQPLETALDDMPEVKATAEGAVRLRNGNP------GMVLASGIEYGET
TRUB_RHOS4      --------LLSHVLPLAKGLADLPELPATPEGAARLRCGNP------GMVIASDVEFGEE
TRUB_RHOS1      --------LLSLVLPLAKGLADLPELPATPEGAARLRCGNP------GMVIASDVEFGEE
TRUB_RHOS5      --------LLAHVMPLACGLADLPELPATAEGAARLKCGNP------GMVIASDVEFGEE
TRUB_DINSH      --------LDAHLMPLETGLADLPELPCTPEGAARMRNGNP------GMVRASDAEYGET
TRUB_JANSC      --------LYALLQPVGLALHALPELRVTDAGAARLRNGNP------GGVLPGNVEYGDL
TRUB_PARDP      --------IEAALLPLQAALADLPEMQATEIGATRILNGNP------GQVL-GHAEFGEE
TRUB_EHRRW      --------THKYLLPLWYVLQDIKHLDDVFCSVEISKIKNG----QNIQLNNLYMVKNCD
TRUB_EHRRG      --------THKYLLPLWYVLQDIKHLDDVFCSVEISKIKNG----QNIQLNNLYMVKNCD
TRUB_EHRCJ      --------KSSYLLPLWYVLQDIKHLNNFFSELEIKKLKNG----QNIELNNLYVIRNCD
TRUB_EHRCR      --------KCSYLLPLWYVLQDMKHLNDVFSDIQIKKIKNG----QNIELNNLYVVRNCG
TRUB_ANAMM      --------LNEALLPISYVMGDALLRLHVDAEVAEIVKKGQSVSLQRTSLNGLYAAENYD
TRUB_ZYMMO      --------LYQMLLPLTAGLDDIPALAVSSDQAKALRQGQK--------LIGINAESGLN
TRUB_RICB8      ------------NIKIEAILDDILVLDANDEQAQKIKYGQK-------CLFDYDKN----
TRUB_RICBR      ------------NIKIEAILDDILVLDANDEQAQKIKYGQK-------CLFDYDKN----
TRUB_RICRS      ------------SIKIEAILDDILVLDATDSQAQQIKYGQK-------CLFNYEKDFRHL
TRUB_RICRO      ------------SIKIEAILDDILVLDATDSQAQQIKYGQK-------CLFNYEKDFRHL
TRUB_RICCK      ------------SIKIEAILDDILVLDATDQQAQQIKYGQK-------CLFNYEKD----
TRUB_RICAH      ------------SIKIEAILDDILVLDATDSQAQQIKYGQK-------CIFDYEDD----
TRUB_RICTY      ------------SIKIEAILDDILVLDATDDQAQKIKYGQK-------CVFDYEED----
TRUB_BORAP      --------------ISLESLKSFEKVCIDSSKINLVKNGAY----VEIQININEFKILKS
TRUB_BORBP      --------------ISLESLSSFKKVYIDSSKVNLVKNGAY----VEVQININEFKILKS
TRUB_BORBU      --------------ISLESLKSFEKVYIDSNKINLVKNGVY----FEIEININEFKILKS
TRUB_TREPA      LTVREIKQAVVSCDVDFANRIGLTACSVHAQYASRFLHGER----IRACWFQSFGTRRPG
TRUB_TREDE      IDFLEIMAKSIIFSPKTAENLKLPYLFLDRKYLNDFYNGKK----IKFNWFLNTDEVLEN
TRUB_ARTS2      -----------EVLEMSQAARALMPNRELSEDEATEISFG-----------RRIA-AGAG
TRUB_PAEAT      -----------EVLEMSLAARSLMPNRELSEQETTEISFG-----------RRIA-AGPG
TRUB_THEFY      -----------TVMPLAEAVAAAFPVRRLSAGEARRVVHG-----------HRIS-PSGH
TRUB_STRAW      -----------TVMPIAEAAAAAFPRWDVDTKRARLLLNG-----------VRLEMPEEY
TRUB_STRCO      -----------TVMPVADAAGAAFPRWGVDARRARLLANG-----------VRLEMPEEY
TRUB_LEIXX      -----------ALIPATEAASSLFERLRLTEQQATDLAHG-----------KRLHLAGWE
TRUB_CUTAK      -----------TPMTMAEAAALSFPVVHVTADQAAAIRVG-----------RRLSFTVPA
TRUB_CORGL      -----------LSLNLDQALTRSYPVLDITEDEGVDLSMG-----------KWLEPRGLK
TRUB_CORGB      -----------LSLNLDQALTRSYPVLDITEDEGVDLSMG-----------KWLEPRGLK
TRUB_COREF      -----------LSLSLDEALARSYPVLEITEAEGEALSMG-----------KWLEPRGLK
TRUB_CORDI      -----------VSLTLDQALAASYPVLSVSEKEASDLAMG-----------KWLTPRGLK
TRUB_CORJK      -----------LTLNLDEAMVRCFDTREISESEGVDLSLG-----------KWLKPVGNK
TRUB_MYCTU      -----------LSLSLDEACLLMFARRDLTAAEASAAANG-----------RSLPAVGID
TRUB_MYCBP      -----------LSLSLDEACLLMFARRDLTAAEASAAANG-----------RSLPAVGID
TRUB_MYCBO      -----------LSLSLDEACLLMFARRDLTAAEASAAANG-----------RSLPAVGID
TRUB_MYCTA      -----------LSLSLDEACLLMFARRDLTAAEASAAANG-----------RSLPAVGID
TRUB_MYCA1      -----------LSYSLDEACLLIFGRRDLSADEAEAAGNGRALAAAAAGNGRALAAAGID
TRUB_MYCPA      -----------LSYSLDEACLLIFGRRDLSADEAEAAGNG-----------RALAAAGID
TRUB_MYCLE      -----------LSRTLDETCLLMFPRRDLTVSEVEATSNG-----------RPISSAGID
TRUB_MYCUA      -----------LSLTLDQACLLMFPRRDLTVDESQSVGNG-----------RPLEPAGID
TRUB_NOCFA      -----------LNLDMDEAVRIAFPHRAIDAREAESLRDG-----------RWLDPVGIP
TRUB_RHOJR      -----------VSLDIDAAAQTAFPHRQVDADEAESISQG-----------RWLEPIGIK
TRUB_BIFLO      -------WLLDHALTMEQAARGAMPALDITPEEASELRFG-----------RRIERTISE
TRUB_DEIRA      --------------TIPDLDALDFPRIEADERLARELRQG-----------KRPAHPQRG
TRUB_DEIGD      --------------GFPNLAALDLPRMEADEPLARALRQG-----------KRPRSAVVG
TRUB_THET2      --------------AIPELDVLPFPVVELSHTEARRVLEG-----------MPLPIPAMG
TRUB_THET8      --------------AIPELDVLPFPVVELSHTEARRVLEG-----------MPLPIPAMG
TRUB_TROWT      VHYTQGDTLSFTRLTALQALSRIYKPIEVSQKQADDLSCG-----------RYISLGIDS
TRUB_TROW8      VHYTQGDTLSFTRLTALQALSRIYKPIEVSQKQADDLSCG-----------RYISLGIDS
TRUB_TRIV2      ------QAGTFEPTPADAALQYLPSVTLPSISAQK-WCQGQR----IELNLETVGKVRVY
TRUB_NOSS1      ------QAGTFEPTPADAALQCLPSVTLPSISAQK-WCQGQR----IELNLETIGKVRVY
TRUB_TRIEI      ------QENKFSLLSIEIALAHLPVIVLITEDAKR-WCQGQRLPYQVKWQIETKKAEHYF
TRUB_ACAM1      ------QAGTFSPLEPSFSLQQ-PILHLPPAEAQR-FCWGQK--------LPQDCADGMM
TRUB_SYNP6      --------AAVPLLALDLPLQHLAKVQLSAETSDR-WRQGQAM----PVPDSVLPDAAPV
TRUB_SYNE7      --------AAVPLLALDLPLQHLAKVQLSAETSDR-WRQGQAM----PVPDSVLPDAAPV
TRUB_GLOVI      ------QAGTVPLIGPRTALAHLAAVHLEPPLAAR-WLMGQR------VPGDCEGAFAQI
TRUB_THEEB      -------PEHLPLCSPQEVLSHLPWLELNAAQLND-WYHGRAV----ICEGLPPAD-SCV
TRUB_SYNY3      ------EEEHIPLIPPQEALSHLPTVQLNSELEKR-WFHGQRL----LLPDLPVGV-VLI
TRUB_MICAN      -------VNSEGLISPRIALAHLDWISFTPERVID-WFHGRKI----NLTDTNVIIGSLV
TRUB_PROMT      ------EGDKPKVLNPNIFFKHLSSFELISEEEIISWRSGRKISFQNNVKRLKVTKNNEV
TRUB_PROM1      ------EEDKPKVLNPNIFFKHLSSFELISEEEIISWRSGRKISFQNNIKRLKVSKNNEV
TRUB_PROMA      ------DLNKPMIIDPLKALSHLPSIKLMTIDELSSWRKGKHLILSKS--RLKNPLYLIE
TRUB_SYNPW      ------DPPALPLLPPQDALAHLPQRRLS-AREQEDWSCGRRITPGADQESDAVVVLSEG
TRUB_SYNPX      ------PPPP---LSPLLALEHLPRRQLT-DSEEADWRCGRRLSLDPGP-GDAVVVCNAD
TRUB_SYNS3      ------SLEPLTLIPPQLALKHLPIRTLS-ELERDDWSCGRTIPHQNGD--GPTVVLSED
TRUB_PROMM      ------LTTPPAVLPPLTALAHLPRLQLN-EEEQESWSCGRRITAHQDQCQPAPKPLASD
TRUB_PROMP      ------DKNAPFIIPTISALDHISTLVLANQEEINFWQTGRIIKFDANNFVKSRSFDYKK
TRUB_PROM5      ------KNCSTFIIPTIYALDHISTLILNNQEEINFWETGRLIKLDEENLIKSSKFDYKK
TRUB_PROM0      ------KNSKNFIIPTISALNHISSFVLSTEEQINFWQTGRAIRVDINYFQENKSFDYKK
TRUB_PROMS      ------KNSKNFIIPTISALSHISTFVLSNEEQINFWQTGREIKVDINYFRESKSFDYKK
TRUB_PROM9      ------KNASNFIIPTISALNHISTLILNKEEDINFWQTGRAIKFDINYFNEGNNFDNKK
TRUB_PROM2      ------KNAPKFIIPTISALDHISTYSLNKDEEINYWQTGRAIKIDINFLYECKAFDYKQ
TRUB_BACFN      -----------WIDQQDVEISD--------------------------------------
TRUB_BACFR      -----------WIDQQDVEISD--------------------------------------
TRUB_BACTN      -----------WIDRQEIENDEDNN-----------------------------------
TRUB_BACV8      -----------WLDQQEIEEVINE------------------------------------
TRUB_PARD8      -----------FLEQNVVKIEEEK------------------------------------
TRUB_FLAJ1      -----------SLQ----------------------------------------------
TRUB_PELLD      -----------RILSQIAVDEQQPGGVLAQHEREGSRALDSAAGNAEHDREEARIADNNR
TRUB_CHLPM      -----------RVLGQMQVTDQ--------------------------------------
TRUB_CHLCH      -----------QIHNNASKGALCGTASTIHPAT---------------------------
TRUB_CHLTE      -----------EITRAASVIEE--------------------------------------
TRUB_RHOBA      -----------DDDREKMSSEPMVKYLRPAIEGLTHMPAMNLDRQQIGMLQAGIRISGTP
TRUB_CUPMC      ----------GMLAPVDALLQRCPPVHLDAAAMGRFLQGQRIARRDLPEGQVPP------
TRUB_CUPPJ      ----------AMLAPVDALLRRCPPVTLSAEAMSRFLQGQRLAYRDLDPDSAP-------
TRUB_RALSO      ----------ALLAPVDALLQTLPRVELGAEDSRRFLHGQRLP---LQLSLPSA------
TRUB_BURPS      ----------ARLAPVDALLSTFPCVKLDAALATRFLHGQRLKLSELAARPDAA------
TRUB_BURMA      ----------ARLAPVDALLSTFPCVKLDAALATRFLHGQRLKLSELAARPDAA------
TRUB_BURP1      ----------ARLAPVDALLSTFPCVKLDAALATRFLHGQRLKLSELAARPDAA------
TRUB_BURP0      ----------ARLAPVDALLSTFPCVKLDAALATRFLHGQRLKLSELAARPDAA------
TRUB_BURM7      ----------ARLAPVDALLSTFPCVKLDAALATRFLHGQRLKLSELAARPDAA------
TRUB_BURP6      ----------ARLAPVDALLSTFPCVKLDAALATRFLHGQRLKLSELAARPDAA------
TRUB_BURL3      ----------AWLQPVDALLSTFPLVRLDETSAKRFLHGQRLPLSALDPI-DAA------
TRUB_VEREI      ----------ACLQPPQSLLTRHLRVTLDSDNAARFLSG--------LPRRGAW------
TRUB_DECAR      ----------ERLLPVDALLQSLPIVGVEGPEAERFRHG--------NPVSLPA------
TRUB_BORPE      -----------ALLAMNELPAGLLPAT---------------------------------
TRUB_BORBR      -----------ALLAMNELPAGLLPAT---------------------------------
TRUB_BORPA      -----------ALLAMNELPAGLLPAT---------------------------------
TRUB_BORA1      -----------ALLALNELPAGLLPAT---------------------------------
TRUB_AROAE      ----------GLLAPVDALVGHLPRIELDAFQAGLLLQGRV--------LAAPC------
TRUB_THIDA      ----------ALLLPADCLVAHLPSVHLGETAAASLRQGRS--------VPDAA------
TRUB_CHRVO      ----------ALLMPADVLVMHFPQLELADEEIGKFLHGQPVR------FEQKC------
TRUB_NEIMB      ----------SLLLPCDVLVSHFPQTVLNDYAVHMLHCGQRPR------FEEDL------
TRUB_NEIG1      ----------GLLLPCDVLVSHFPQTVLNDYAVHMLQCGQRPR------FEEDL------
TRUB_NEIMA      ----------SLLLPCDVLVAHFPQTVLNDYAVHMLRCGQRPR------FEEDL------
TRUB_NITMU      ----------SCLLPADSLLRSLPPVVVDSAAALSLLQGRAIP--GTHPAGESL------
TRUB_NITEU      ----------KLLCPIDSLLNDIPSIVLDDDEALRLRQGQKI---RKNMSRYGL------
TRUB_PSEAB      ------EALDQFLMPEDSGLLHWPVLQLSEHSAYYWLHGQPVR------AP-EA------
TRUB_PSEAE      ------EALDQFLMPEDSGLLHWPVLQLSEHSAYYWLHGQPVR------AP-EA------
TRUB_PSEA7      ------EALDQFLMPEDSGLLHWPVLQLSEHSAYYWLHGQPVR------AP-EA------
TRUB_PSEF5      ------EAVDRFLMPSDSGLLDWPLLQFSEHSAFYWLNGQPVR------AP-DA------
TRUB_PSEPF      ------EAVDRFLMPSDSGLQDWPLLQFSEASAFYWLNGQPVR------AP-DA------
TRUB_PSE14      ------EAVDRFLMPSDSGLLDWPLLKFSEHSSFYWLHGQPVR------AP-DA------
TRUB_PSEU2      ------EAVDRFLMPSDSGLLDWPLLKFSEHSSFYWLHGQPVR------AP-DA------
TRUB_PSEP1      ------EALDRFLMPSDSGLQDWPLVSLSEHSAFYWLHGQAVR------AP-DA------
TRUB_PSEPG      ------EALDRFLMPSDSGLQDWPMVSLSEHSAFYWLHGQAVR------AP-DA------
TRUB_PSEE4      ------EALDRFLMPSDSGLQDWPLVLLSEHSAFYWLHGQAVR------AP-DA------
TRUB_PSEMY      ------EALDRFLQPVDSGLQDWPLLQFSEHSAFYWLQGQPVR------AP-EA------
TRUB_PSEU5      ------EALDALLQPVDSGLEHWPLLQLSEHSAYYWLHGQPVR------AP-EA------
TRUB_COXBU      ------TGLDRYLLPLETMVSHFPAIKLSSSTAFYLQQGQAVM------VP-NA------
TRUB_COXBR      ------TGLDRYLLPLETMVSHFPAIKLSSSTAFYLQQGQAVM------VP-NA------
TRUB_COXBN      ------TGLDRYLLPLETMVSHFPAIKLSSSTAFYLQQGQAVM------VP-NA------
TRUB_NITOC      ------EALGNLLLPVGQILADWPAVNLIADLAYYLRQGQSVR------VP-QA------
TRUB_METFK      ---------DAVLLQVDAAIEDFPIVTLDADSAFYLLQGQEVW------KS-GL------
TRUB_ACIAD      ------DML---LLAPYAPVDYLPQVQIPEGRLKYFCNGQES----------NI------
TRUB_MARMS      ------DALDAHLITMDTAVEHFAKVELPESDTVNMMFGRTVP------SPVSL------
TRUB_LEGPC      ----------ACLIPIDQAIQHLTPVILSDSEVTAIRQGKVIS------NKTGA------
TRUB_LEGPA      ----------ACLIPIDQAIQHLTPVILSDSEVTAIRQGKVIS------NKTGA------
TRUB_LEGPH      ----------ACLIPIDQAVQHLTPVILSDSEVTAIRQGKVIS------NKTGA------
TRUB_LEGPL      ----------ACLIPIDQAVQHLTPVILSDSEVTAIRQGKVIS------NKTSA------
TRUB_MARHV      ------ESLDGLLLPPETALTMFPEYRLSGVPLVSILNGQPV------RIPGQP------
TRUB_HAHCH      ------EKYKERLLPIDSSVQQFSEIILDEANTGSIIQGQTV------KISPLS------
TRUB_SACD2      ------EVLDHHLLPTDIAVADFPSLELDDNSAFYFSRGQAVM---DSRVYRLG------
TRUB_XANAC      ------AEAQTLLLPIEAGLADFARIVLDQTRAARFRMGQRLR---DAAFPTG-------
TRUB_XANC5      ------TEARTLLLPIEAGLAGFARIVLDQTHAARFRMGQRLR---DAAFPPG-------
TRUB_XANOM      ------AEAQTVLLPIEAGLADFARIVLDAALAARFRMGQRLR---DAAFPTG-------
TRUB_XANOR      ------AEAQTVLLPIEAGLADFARIVLDAALAARFRMGQRLR---DAAFPTG-------
TRUB_XANCP      ------ADAAQLLLPVAAGLSDFAQITLDATLAARFRMGQRLR---DPAFPEG-------
TRUB_XANC8      ------ADAAQLLLPVAAGLSDFAQITLDATLAARFRMGQRLR---DPAFPEG-------
TRUB_XYLFA      ------RDPDSLLLPLVEGLAGFPALELDAQRLACFRLGQRLR---DHSFQTG-------
TRUB_XYLFT      ------RDPDSLLLPLVEGLAGFPALELDAQRLACFRLGQRLR---DHSFQTG-------
TRUB_METCA      -------------VSIEAAMYPFAWV--------------RGR---RKPFFSA-------
TRUB_SERP5      ---APAELLDPLLMPMDSPVENYPEVNLLPVVAGYVKQGQPVQV-----AGAP-------
TRUB_PECAS      ---SLSLSLDSLLMPMESPVIDFPEVNLPPVVAGYLKLGQAVQA-----ANAP-------
TRUB_ECOL5      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_ECOL6      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_ECOLI      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_ECOHS      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_ECOUT      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_SHIF8      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_SHISS      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_ECOLC      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_ECOK1      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_ECO57      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_ECO24      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_SHIDS      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_SHIFL      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_SHIBS      ---PAAELLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_CITK8      ---PAAQLLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----TGVP-------
TRUB_SALCH      ---PAAQLLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----TGAP-------
TRUB_SALTY      ---PAAQLLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----TGAP-------
TRUB_SALTI      ---PAAQLLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----TGAP-------
TRUB_SALPA      ---PAAQWLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----TGAP-------
TRUB_SALPB      ---PAAQLLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----TGAP-------
TRUB_SALAR      ---PAAQLLDPLLMPMDSPASDYPVVNLPLTSSVYFKNGNPVRT-----SGAP-------
TRUB_ENT38      ---SPADLLDPLLMPMDSPASDFPVVNLPLTSSVYFKNGNPVRT-----TETP-------
TRUB_KLEP7      ---PAAQLLDPLLMPMDSPASDYPLVNIPETSAVYFKNGNPVRQ-----SGAP-------
TRUB_CROS8      ---APSELLDPLLMPMDSPAADYPVVNLPLTSSVYFKNGNPVRT-----TGAP-------
TRUB_YERPE      ---SPNPELDSLLLPMDSAVLNFPEVNLLPSVAAYVKQGQPVHV-----SGAP-------
TRUB_YERPA      ---SPNPELDSLLLPMDSAVLNFPEVNLLPSVAAYVKQGQPVHV-----SGAP-------
TRUB_YERPP      ---SPNPELDSLLLPMDSAVLNFPEVNLLPSVAAYVKQGQPVHV-----SGAP-------
TRUB_YERP3      ---SPNPELDSLLLPMDSAVLNFPEVNLLPSVAAYVKQGQPVHV-----SGAP-------
TRUB_YERPN      ---SPNPELDSLLLPMDSAVLNFPEVNLLPSVAAYVKQGQPVHV-----SGAP-------
TRUB_YERPS      ---SPNPELDSLLLPMDSAVLNFPEVNLLPSVAAYVKQGQPVHV-----SGAP-------
TRUB_YERE8      ---SPNAELDALLLPMDSAVLNFPEVNLLPAVAAYVKQGQPVHV-----AGTP-------
TRUB_YEREN      ---SPNAELDALLLPMDSAVLNFPEVNLLPTVAAYVKQGQPVHV-----AGAP-------
TRUB_PHOLL      ---PVGELIDSLLLPMDSAIAHFPEVNLIPVVAAYFKQGQAVRS-----AKSPA------
TRUB_SODGM      ---A---QLDALLLPMDSAVADMPLVNLPSDLAARLRLGQTVAV-----TAQP-------
TRUB_VIBVU      ---APREVLDPLLMPMDTAVEDLPEVNLIADLADMVMHGQAVQV-----LGAP-------
TRUB_VIBVY      ---APREVLDPLLMPMDTAVEDLPEVNLIADLADMVMHGQAVQV-----LGAP-------
TRUB_VIBCB      ---APKELLDPLLLPMDTAVEDLPEVNLKAELTNLVQHGMPVQV-----LGAP-------
TRUB_VIBPA      ---APRELLDPLLMPMDTAVEDLPEVNLIPELADMVQHGQPVQV-----LGAP-------
TRUB_VIBC3      ---AVADVLDPLLLPMDTAVEALPEVNVIPELMTLIQHGQAVQV-----SGAP-------
TRUB_VIBCH      ---AVADVLDPLLLPMDTAVEALPEVNVIPELMTLIQHGQAVQV-----SGAP-------
TRUB_ALIF1      ---APRELLDPLLMPMDSAVQDLPEVNMIPELADHVLHGQPVQV-----FGAP-------
TRUB_PHOPR      ---EPGELLDPLLLPTDSAVQDLPEANVTVEGGDAILHGQPVKA-----SQLP-------
TRUB_SHEHH      ---SLSEVLDPLLLPMDTAVSGFKEINVSDELATYLMNGNPVQV-----ANLP-------
TRUB_SHEPA      ---TLSEVLDPLLLPMDTAVSGFKEINVSDELATYLMNGNPVQV-----ANLP-------
TRUB_SHELP      ---PPKELLDPLLLPMDTAVSGLKEINVSDELAHYLMNGNPVQV-----ANLP-------
TRUB_SHEDO      ---AVGELLDPLLLPMDTAVANFPEINLPESMLYYVMQGQAVQA-----SGLK-------
TRUB_SHEFN      ---APQTLMDPLLLPMDTAVAKFAEINLPEAMLYYVMQGQAIQA-----AGLK-------
TRUB_SHESR      ---DSSSLLDSLLLPMDTAVADFPEVNVPDASAAYLMQGQAVRV-----SGLV-------
TRUB_SHESM      ---DPSSLLDSLLLPMDTAVADFPEVNVPDASAAYLMQGQAVRV-----SGLV-------
TRUB_SHESA      ---DPSSLLDSLLLPMDTAVADFPEVNVPDASAAYLMQGQAVRV-----SGLV-------
TRUB_SHESW      ---DPSVLLDPLLLPMDTAVADFPEVNVPEASAAYLMQGQAVRV-----TGLK-------
TRUB_SHEPC      ---DPSVLLDPLLLPMDTAVADFPEVNVPEASAAYLMQGQAVRV-----TGLK-------
TRUB_SHEB9      ---DPSVLLDPLLLPMDTAVADFPEVNVPDAIAPYLMQGQAVRVPV--NADLK-------
TRUB_SHEB8      ---DPSVLLDPLLLPMDTAVADFPEVNVPDAIAPYLMQGQAVRVPV--NADLK-------
TRUB_SHEB5      ---DPSILLDPLLLPMDTAVADFPEVNVPDAIAPYLMQGQAVRVPV--NAGLK-------
TRUB_SHEAM      ---EPKTLLDPLLLPMDTAVANFPEVNIPDAVAPYLMNGNPVRV-----AGVS-------
TRUB_PSYIN      ---SPYDLLDPLLLDMDTAVKKYPEVNISDEMGEYVLHGQPVQV-----FGAP-------
TRUB_COLP3      ---TPSDVLDPLLLPMNSAVDGMHCVYVDDMSANFLRHGNPVQA-----YNQP-------
TRUB_PSEA6      ---PLTDILDPLLIPMDSAVKALPSVELTPASRDSFLHGQPVPYVS--EATID-------
TRUB_HAEIE      ----PLSELDRLLLPTDTAVSKLPALHLDVEQSKAIGFGQRVKFA----NEQQ-------
TRUB_HAEIG      ----PLSELDRLLLPTDTAVSKLPALHLDVEQSKAIGFGQRVKFA----NEQQ-------
TRUB_HAEI8      ----PLSELDRLLLPTDTAVSKLPALHLDVEQSKAIGFGQRVKFA----NEQQ-------
TRUB_HAEIN      ----PLSELDRLLLPTDTAVSKLPALHLDAEQSKAIGFGQRVKFA----NEQQ-------
TRUB_MANSM      ----DLAALDARLLPVDSAVSKLPVLSLSEEQTKAVGFGQRVKFD----NLQQ-------
TRUB_PASMU      ----DLALLDQHLLPTDSAVSALPALHLNQEQSKAISFGQRVKFD----NPTQ-------
TRUB_ACTP2      ----PLEELDKYLLPLDTAVESLPKLNLTAEQTKAVGFGQRVKFE----NNDQ-------
TRUB_HAEDU      ----ALEVLDEYLLPVDTAVRRFPKIKLTTMQTKAIGFGQRVKFD----NLAQ-------
TRUB_HAES1      ----DLDLLDQHLLPMESAVIRLPGLHLTKEQARAVGFGQRIKFL----NEQG-------
TRUB_HISS2      ----DLDLLDQHLLPMESAVIRLPGLHLTKEQARAVGFGQRIKFL----NEQG-------
TRUB_PSEHT      ---APSTYLDALLLPLDTALVDLPVVEISKEQGSIFSHGQAIDLD----IDLP-------
TRUB_IDILO      -----YEGLDALLHPADLLLGQLPEVTVTQAQTRDFLHGQPIPLPE--QNGND-------
TRUB_BUCAI      ---NFFEKIDNLLMPIDSPVSFLPKVYLFPQQSYNFQLGQTVIFF----SDIK-------
TRUB_BUCAP      ---NFFKKIDDLLMPVDTPVYFLPKIYISIEKLSVFRLGQKVNFS----SSIT-------
TRUB_BUCBP      --------LEHILLSVDNAISCFPEVNIVPNVIKNLQNGQKVKTH----SGFI-------
TRUB_BLOPB      --------------TLEAIF--------YNDSFDDVQVFCKLDAF----LTPM-------
TRUB_BLOFL      --------------TIESIF--------FDKDLNDLEVLDKLDNL----LIST-------
TRUB_WIGBR      ------KKLDECLLPIESIFKKLPIIVVNDDIINRLRNGIKLNFW----KIKK-------
TRUB_FRATT      ----------ASITNIESVFIDKPIYSLLEEEKDDLYKRGLFADK--------P------
TRUB_FRAT1      ----------ASITNIESVFIDKPIYSLLEEEKDDLYKRGLFADK--------P------
TRUB_FRATW      ----------ASITNIESVFIDKPIYSLLEEEKDDLYKRGLFADK--------P------
TRUB_FRATH      ----------ASITNIESVFIDKPIYSLLEEEKNDLYKRGLFADK--------P------
TRUB_FRATF      ----------ASITNIESVFIDKPIYSLLEEEKNDLYKRGLFADK--------P------
TRUB_FRATO      ----------ASITNIESVFIDKPIYSLLEEEKNDLYKRGLFADK--------P------
TRUB_FRATN      ----------ASITNIESVFIDKPIYSLLEEEKDDLYKRGLFADK--------P------
TRUB_FRAP2      ----------ASIASVESVFIDKPIYSLVEEEKDDLYKRGLFADK--------S------
TRUB_PSYCK      ----------TYLLPVDACIDISAELSLSSEQCERVQMGQRLNVI--------D------
TRUB_PSYA2      ----------TYLLPVDACIDINAELTLSSEQCERVQMGQRLNVI--------D------
TRUB_HYDCU      ----------AYLQPLDLPLKHLQAIHLNAKDTDKILHGGKLAVE--------E------
TRUB_GEOSL      ---------ADVLVSPSDALGHLHALPLTAQGAERVRRGMPPCREDVEHGAGTG------
TRUB_GEOMG      ---------DSLLLAPNEVLGHFPEIELSDEEVRKVYCGVPPRCHGRCEESSAS------
TRUB_GEOUR      ---------GETLVSPFAALSHLKDFILTGKGAAKVANGVVPALEDFQVLSECE------
TRUB_PELCD      ---------PELLLSIAEALREYPSLNVCPEGIKRLGYGIPPTADMIA--DTID------
TRUB_DESAG      ---------AGRVIPLDKALPHWPKLRLSAADEARVKNGMPHPYDPAEMASMPF------
TRUB_DESVH      ---------AERVIPITHALPHWPKVGISLQQEASVRNGIPLPYQPEMVADMPF------
TRUB_DESPS      ----------DVDMLAEDAHERFMKKVLSVESVGKLLQ----------------------
TRUB_SYNWW      ---------SRALLPLDYPINNLPLISLKSAELPAIING-------RQISRTGK------
TRUB_DEHMB      ---------AGILLPLETAIGHLPRVSLDEENITRLVNGLEITLDRIDKPEAVA------
TRUB_DEHMC      ---------AGILLPLETAIGHLPRVSLDEKNITRLVNGLEITLDRIDKPEAVA------
TRUB_DEHM1      ---------ADILLPPEAAVGHLPRITLDDESITRLVNGLEIRLEMTGQPEAMA------
TRUB_CHLMU      --------------------------GFDVFPHLRDANGLILQPTPVL------------
TRUB_CHLTR      --------------------------GFDVSPYLRDANGLILQPAPVL------------
TRUB_CHLFF      --------------------------DFDVSPYLRDFNGNIL------------------
TRUB_CHLAB      --------------------------DFDISPYLRDFNGNML------------------
TRUB_CHLPN      --------------------------DFDISPYLRDAHGNSL------------------
TRUB_PARUW      --------------------------TNLEQNLIRND-----------------------
TRUB_AQUAE      -----------YVLPVDTLFRVIPEVRLNTFEAGKILQG---------------------
TRUB_SOLUE      -----------AIVPAGKLLPAFPSVFVDEITAAQIRNG---------------------
TRUB_THEMA      -----------RIIPLEKCLEWLPRVVVHQESTKMILNGSQIHLEMLKEW----------
TRUB_THEP1      -----------RIIPLEKCLEWLPRVVVHQESTKTILNGSQIHLEMLKEW----------
TRUB_THEM4      -----------SLIDVQKVLP-LPKVEIYKDFVENIYNGNQPTLDFVKEMV---------
TRUB_SYNAS      -----------RVIPLSDGLRNVAAIEISEELSGRIRDGFQPDGSTLREYHI--------
TRUB_CALS8      ------------IIPLENLILNEIIVNESVYKKLINGN----------------------
TRUB_BDEBA      -----------AFVPMELALPQVKRIRIKGQDKVLLGNGQISH-----------------
TRUB_CLOAB      -----------NIINVDKCLENYDEIAVDEKFEKLLVNGV-KVSDRRLI-----------
TRUB_CLONN      -----------YIISIDESLNQYDKAFVSSKCEKLLVNGV-RIGDKRLL-----------
TRUB_CLOBL      -----------YITPIDEALKDYEKLSLDKKFEKLVLNGV-VLKDRRVL-----------
TRUB_CLOTE      -----------FIIPAEKALSKYERIEIDEYFSRLLKNGV-KVKDKRLL-----------
TRUB_CLOPE      -----------HIISIEKALDSFEKITVNEKFGKLLRNGV-KVFDNRMYS----------
TRUB_CLOP1      -----------HIISIEKALDSFEKITVNEKFGKLLRNGV-KVFDNRMYS----------
TRUB_CLOPS      -----------HIISIEKALDSFEKITVNEKFGKLLRNGV-KVFDNRMYS----------
TRUB_CLOK5      -----------YIIPIDKALYGYPEVLVEDEYVKKILNGI-SIKDESFLS----------
TRUB_ALKOO      -----------ILLPMDYPLQHMSKAIVKSAYSKQVLNGN-RIYSNYLID----------
TRUB_LACP7      -----------VLMPVDKLFLSMPKVVVKKESCKFLYNGNQLVEDNFTWE----------
TRUB_CLOD6      -----------YLYDIDYVLDSFNYVVLNPNAIKYYSNGG-SIDDKRFLK----------
TRUB_FUSNN      -----------FLKTIEEIFSYDKYNLQTEKEFILYKNGN-----TVKIK----------
TRUB_GEOTN      -----------LLIPIEQALFHLPKYEI-SDKVAEKVKNGALLRLPAF------------
TRUB_GEOKA      -----------LLIPIERALFHLPKYEI-NDKVAEKVKNGALLRLPAF------------
TRUB_BACHK      -----------IFISIDEALSKFPKMVV-DEKQAEKIKNGMFLKNE--------------
TRUB_BACAH      -----------IFISIDEALSKFPKMVV-DEKQAEKIKNGMFLKNE--------------
TRUB_BACCZ      -----------IFISIDEALSKFPKMVV-DEKQAEKIKNGMFLKNE--------------
TRUB_BACAN      -----------IFISIDEALSKFPKMVV-DEKQAEKIKNGMFLKNE--------------
TRUB_BACC1      -----------IFISIDEALSKFPKMVV-DEKQAEKIKNGMFLKNE--------------
TRUB_BACCR      -----------IFISIDEALSKFPKMVV-DEKQAEKIKNGMFLKNE--------------
TRUB_BACCN      -----------VFISIDEALSKFPKIVV-DEKQAEKIKNGMFLKNE--------------
TRUB_BACVZ      -----------HAVPIDRALNHLPKWVI-SDTLAKKAENGSVFDIPAE------------
TRUB_BACSU      -----------HTVPIERALNHLPKWII-SDTLAKKVENGALLETPEQ------------
TRUB_BACLD      -----------KLVPIERALDHLPKWII-SDTLAKKVENGAVLETPGS------------
TRUB_BACP2      -----------HLVPIERALNHLPKWEI-NDTLASKVENGAVLPMPDE------------
TRUB_BACHD      -----------LLLPIETAILDIPRVQV-NKEIEEKIRHGAVLPQK--------------
TRUB_BACSK      -----------KLRPLDTALQHFPRVTA-DKELEKRIRNGAVLEKSA-------------
TRUB_OCEIH      -----------LLEPIINGLQHLEQIEV-NEDMEKRILNGQKLSLQ--------------
TRUB_LISMF      -----------FLYPLEKGIESMAKLVI-DEEIHAKVLNGGLLPKSL-------------
TRUB_LISMO      -----------FLYPLEKGIESMAKLVI-EEEVYAKVLNGGLLPTSL-------------
TRUB_LISIN      -----------FLYPLEKGIESMAKLEI-DEEIHAKVLNGVLLPKSL-------------
TRUB_LISW6      -----------FLYPLEKGIESMTKLII-DDEIHAKVLNGALLPKAL-------------
TRUB_STAEQ      -----------ELFPIEYGLKGLKSFQVKDSNFKKKICNGQKFHKKV-------------
TRUB_STAES      -----------ELFPIEYGLKGLKSFQVKDSNFKKKICNGQKFHKKV-------------
TRUB_STAAT      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAA3      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAA8      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAAC      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAAE      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAAS      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAAW      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAAR      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAA1      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAA2      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAAM      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAAN      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAA9      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAAB      -----------KLFPLEYGLKGLPSIKIKDSHIKKRILNGQKFNKNE-------------
TRUB_STAHJ      -----------HLFPLEYGLKSLPKIYVSDENIKTRILNGQKFNKKQ-------------
TRUB_STAS1      -----------KLFPIEYGLKGIEQILITDNAIKGKILNGQKFYKAE-------------
TRUB_LACPL      -----------LLAPIDKALSQYPRVTL-TDEQWQRVKNGAFITAAE-------------
TRUB_LACBA      -----------TLRPIDYALQDYPHVAL-DEHLWALVKNGVFLSAAEL------------
TRUB_LACP3      -----------VIQPIDIAFADLPQVDL-TVEQFEAISHGRFLSLDQ-------------
TRUB_PEDPA      -----------VIQPLDRALDNFNTITI-SDVEWEIVKNGGFLNRP--------------
TRUB_LACSS      -----------ILIPLDHVFEENVKIAL-DDDQWAKILNGVFLTFPE-------------
TRUB_LACS1      -----------SLYPIDYAVKDLPRYDL-KLEQWRIVKNGGFLSVNT-------------
TRUB_LACRD      -----------YLYPLDYALKDYPQLTI-QVAQWKKVQNGGWLSPSE-------------
TRUB_STRR6      -----------FLHPLEIGTGDLVKVFL-TPEEATEVRFGRFIELDQ-------------
TRUB_STRP2      -----------FLHPLEIGTGDLVKVFL-TPEEATEVRFGRFIELDQ-------------
TRUB_STRPN      -----------FLHPLEIGTGDLVKVFL-SPEEATEVRFGRFIELDQ-------------
TRUB_STRGC      -----------FLQPLELGIGDLLKVEL-SDEQVEDVRNGRFISLVS-------------
TRUB_STRSV      -----------FLQPLELGIGDLVRVEL-SDEQVEDVRNGRFISLMS-------------
TRUB_STRT2      -----------FLLPIEFGVQDLPAVQV-TEDDAKEISFGRFISINS-------------
TRUB_STRT1      -----------FLLPIEFGVQDLPAVQV-TEDDAKEISFGRFISINS-------------
TRUB_STRA1      -----------FLLPIEYGVLDLPKVNL-TEEDKVEISYGRRILLEN-------------
TRUB_STRA3      -----------FLLPIEYGVLDLPKVNL-TEEDKVEISYGRRILLEN-------------
TRUB_STRA5      -----------FLLPIEYGVLDLPKVNL-TEEDKVEISYGRRILLEN-------------
TRUB_STRMU      -----------FLLPIEYGVLDLPRIDL-NPKQTKEVSFGRRLKLLR-------------
TRUB_STRP1      -----------FLLPIEYGVADLPKMVI-DDTELTEISFGRRLSLPS-------------
TRUB_STRP8      -----------FLLPIEYGVADLPKMVI-DDTELTEISFGRRLSLPS-------------
TRUB_STRPF      -----------FLLPIEYGVADLPKMVI-DDTELTEISFGRRLSLPS-------------
TRUB_STRP6      -----------FLLPIEYGVADLPKMVI-DDTELTEISFGRRLSLPS-------------
TRUB_STRPB      -----------FLLPIEYGVADLPKMVI-DDTELTEISFGRRLSLPS-------------
TRUB_STRPC      -----------FLLPIEYGVADLPKMVI-DDTELTEISFGRRLSLPS-------------
TRUB_STRP3      -----------FLLPIEYGVADLPKMVI-DDTELTEISFGRRLSLPS-------------
TRUB_STRPM      -----------FLLPIEYGVADLPKMVI-DDTELTEISFGRRLSLPS-------------
TRUB_STRPG      -----------FLLPIEYGVADLPKMVI-DDTELTEISFGRRLSLPS-------------
TRUB_STRPD      -----------FLLPIEYGVADLPKMVI-DDTELTEISFGRRLSLPS-------------
TRUB_LACLM      -----------ILYPAEYAVSDLPRVNL-TTVQFDMARVGKKFAQSDWTNEVETADSSVN
TRUB_LACLS      -----------ILYPAEYAVSDLPRVNL-TTVQFDMARVGKKFAQSDWTNEVETADSSVN
TRUB_LACLA      -----------LMYPAEYAVSDLPRVNL-TADQFEMARVGKKFAEDDWVTD-ETTDSPVI
TRUB_LACDB      -----------YIQPIDSFFADYQQVDL-DAALWQQVKNGAWIKLPL-------------
TRUB_LACDA      -----------YIQPIDSFFADYQQVDL-DAALWQQVKNGAWIKLPL-------------
TRUB_LACGA      -----------WLQPIDSFFAELPQLQL-SPDQFKRVSNGASISLNT-------------
TRUB_LACJO      -----------WLQPIDSFFVDLPQLQI-SPDQFKRVSNGASIKLNT-------------
TRUB_LACAC      -----------LIQPIDAFFKDYETIDL-PEGKWLKVKNGAGISLET-------------
TRUB_OENOB      -----------FIIPMEKLLPTLPKYSV-GSDDWQLIKNGGWLKELP-------------
TRUB_SYMTH      ------------LLPPAAALGDMPRVTVSGRAAARVLHGVAPAV-RVEHP----------
TRUB_MOOTA      -----------FLLPPAAGLAHLPVIIVPGEFIRHVSNGVAIKG-DVCRPL---------
TRUB_PELTS      -----------KIIEMDRAVSEYPEVIVKSSAVKAVAAGSKLYIPGVARMP---------
TRUB_CARHZ      ------------LIPPEQLFQDFPKINLTREQYLRVKNGGGVKVETKGEN----------
TRUB_CALS4      -------------VQPVDKFIKFPSVELDEVSSNKILNGQFIRNTYNVEN----------
TRUB_MYCMO      --------EKNQIENLSKG-LLIDLKNEDN-FYALFWKDEM-------------------
TRUB_MYCH2      --------DLENLELLLQG-KKINYFAKNSELNTLIFKDEV-------------------
TRUB_MYCPU      --------EKHEILTLAKGQKFSKDLADGKYAFIYKNTKKI-------------------
TRUB_WOLSU      --------ATSLKEEFLHG-KKLLASDLGNPKEGKYIAEFE-------------------
TRUB_HELHP      --------MHRFSKQMYDG-KKI---TLKNAQKGKYIVCFE-------------------
TRUB_SULNB      --------YTGDEAYLELG-KKLSVDYFEAKENGIYLIETS-------------------
TRUB_NITSB      --------VKKSKEAIFHG-AKLTIDDLAYKEDGEYHILFD-------------------
TRUB_SULDN      --------YHGDSDNLKYG-RVLALNDLEIKSDGFYWLDSG-------------------
TRUB_CAMJJ      --------FIKELNKLENG-AKIFVEELEFHDEGDYYIETE-------------------
TRUB_CAMJ8      --------FIKDLNKLENG-AKIFVEELKFHDEGDYYIETE-------------------
TRUB_CAMJE      --------FIKDLNKLENG-AKIFVEELEFHDKGDYYIETE-------------------
TRUB_CAMJR      --------FIKDLNKLENG-AKIFVEELEFHDEGDYYIETE-------------------
TRUB_CAMJD      --------FIKDLNKLENG-AKIFVEELEFHDEGDYYIETE-------------------
TRUB_CAMC1      --------YFGDINNILDG-KELKINDFETQTQGIYLLNYD-------------------
TRUB_CAMC5      --------YLGDVADIMDG-KSLKPSDFTTQKDGIYLLEYD-------------------
                                                                            

TRUB_UREPA      ------------------------------------------------------------
TRUB_UREP2      ------------------------------------------------------------
TRUB_MYCPE      ------------------------------------------------------------
TRUB_MYCMS      --------------------------------------------------DDQNNILAVY
TRUB_MYCCT      --------------------------------------------------DEQNNILAVY
TRUB_MESFL      --------------------------------------------------NKSKELIACY
TRUB_AYWBP      --------------------------------------------------KDSNKNFVAY
TRUB_ONYPE      --------------------------------------------------KDSNKNFVAY
TRUB_ACHLI      --------------------------------------------------QDEMGNYIAY
TRUB_CAUVC      ELPPG--------------------------------------DRTVSAMS--GDRLVAL
TRUB_CAUSK      VLTPG--------------------------------------DRTVSAMS--GQRLVAL
TRUB_MARMM      QRRPREIAGK---------------------------------DCTFTALALCDGVAVAL
TRUB_BRUSI      E-----------------------------------------------ACVTTRGKLLAI
TRUB_BRUAB      E-----------------------------------------------ACVTTRGKLLAI
TRUB_BRUA2      E-----------------------------------------------ACVTTRGKLLAI
TRUB_BRUSU      E-----------------------------------------------ACVTTRGKLLAI
TRUB_BRUO2      E-----------------------------------------------ACVTTRGKLLAI
TRUB_BRUC2      E-----------------------------------------------ACVTTRGKLLAI
TRUB_BRUME      E-----------------------------------------------ACVTTRGKLLAI
TRUB_OCHA4      E-----------------------------------------------ACVTTRGKLLAI
TRUB_RHILO      E-----------------------------------------------ACATARGKLVAI
TRUB_CHESB      E-----------------------------------------------AWASLRGRLIAI
TRUB_RHIME      E-----------------------------------------------AYATAQGKLVAI
TRUB_SINMW      E-----------------------------------------------AYATVQGKLVAI
TRUB_RHIEC      E-----------------------------------------------AYATARGRLIAI
TRUB_RHIL3      E-----------------------------------------------AYATARGKLIAI
TRUB_AGRFC      E-----------------------------------------------AYATAQGKLVAI
TRUB_BARHE      E-----------------------------------------------VCVLYQDQLLAI
TRUB_BARQU      ------------------------------------------------------------
TRUB_BART1      E-----------------------------------------------VCVLYKEQLLAI
TRUB_BARBK      D-----------------------------------------------ICVTYKAQLLAI
TRUB_BRADU      T-----------------------------------------------VYVTVAGRLLAL
TRUB_RHOPA      T-----------------------------------------------VYVTVAGRLLAL
TRUB_GLUDA      VDPAC-----------------------------------------GIVRGMDGARVIGL
TRUB_GLUOX      SQGED-----------------------------------------HLWRAMIGEHVLGL
TRUB_RHORT      GLAQG-----------------------------------------ETVQALLNGKLVAL
TRUB_RUEST      A------------------------------------------------WASLEGKAVAV
TRUB_RUEPO      A------------------------------------------------WASFEGRAVAV
TRUB_ROSDO      C------------------------------------------------WASFESRAIAI
TRUB_RHOS4      A------------------------------------------------WASFQGQPVAV
TRUB_RHOS1      A------------------------------------------------WASYQGQPVAV
TRUB_RHOS5      A------------------------------------------------WASFQGQPVAV
TRUB_DINSH      A------------------------------------------------WASYNGTAVAV
TRUB_JANSC      A------------------------------------------------WASLNGTPVAV
TRUB_PARDP      V------------------------------------------------WVSRNGRALCI
TRUB_EHRRW      M----------------------------------------------CYVS-THSVPVAI
TRUB_EHRRG      M----------------------------------------------CYVS-THSVPVAI
TRUB_EHRCJ      I----------------------------------------------CYVS-TGNVPVAI
TRUB_EHRCR      I----------------------------------------------CYVS-TGNVPVAI
TRUB_ANAMM      M----------------------------------------------CYLSRVGGVPVAV
TRUB_ZYMMO      M-------------------------------------------------AMESQIPVAL
TRUB_RICB8      ---------------------------------------------VDFMWVRYKGVLLAI
TRUB_RICBR      ---------------------------------------------VDFMWVRYKGVLLTI
TRUB_RICRS      AKFAYREEFKGNTERSTTAYTLVREDASTGLTYKLPLEVEFGKMSIDLLWVRYKGTLLAI
TRUB_RICRO      AKFAYREEFKGNTERSTTAYTLVREDASTGLTYKLPLEVEFGKMSIDLLWVRYKGTLLAI
TRUB_RICCK      ---------------------------------------------INLLWVRYKGVVLAI
TRUB_RICAH      ---------------------------------------------ISLLWVRYKGTLLAI
TRUB_RICTY      ---------------------------------------------VNFLWVRYNGTLLAI
TRUB_BORAP      ---------------------------------------------------REGEILAVI
TRUB_BORBP      ---------------------------------------------------REGEILAVI
TRUB_BORBU      ---------------------------------------------------REEKILAVI
TRUB_TREPA      ----------------------------------------------ERALVFSEGRCLGL
TRUB_TREDE      ITGLD--------------------------------------LENKKTCVFCGDLWIGI
TRUB_ARTS2      AGTP-----------------------------------EAATADNPAAAFAPDGSLVAL
TRUB_PAEAT      AGTP-----------------------------------DAATAEKPAAAFAPSGELVAL
TRUB_THEFY      SG--------------------------------------------PVGLFAPDGRVLAL
TRUB_STRAW      AGR------------------------------------------GAVAVVDPAGRFLAL
TRUB_STRCO      TGV------------------------------------------GAVAVFDPEGRLLAL
TRUB_LEIXX      GPR-----------------------------------------GEPVAAIAPSGSLVGL
TRUB_CUTAK      EVT---------------------------------------------AIIAETGELLAL
TRUB_CORGL      GVH---------------------------------------------AAVTPSGKAVAL
TRUB_CORGB      GVH---------------------------------------------AAVTPSGKAVAL
TRUB_COREF      GVH---------------------------------------------AAVTPSGRSIAL
TRUB_CORDI      GIH---------------------------------------------AAVDPHGRAIAL
TRUB_CORJK      GVR---------------------------------------------AAVTPSGQAIAL
TRUB_MYCTU      GVY---------------------------------------------AACDADGRVIAL
TRUB_MYCBP      GVY---------------------------------------------AACDADGRVIAL
TRUB_MYCBO      GVY---------------------------------------------AACDADGRVIAL
TRUB_MYCTA      GVY---------------------------------------------AACDADGRVIAL
TRUB_MYCA1      GVY---------------------------------------------AACAPDGRVIAL
TRUB_MYCPA      GVY---------------------------------------------AACAPDGRVIAL
TRUB_MYCLE      GIY---------------------------------------------AASDADGRVIAL
TRUB_MYCUA      GIY---------------------------------------------AASDADGRVIAL
TRUB_NOCFA      GVY---------------------------------------------AALTADGTAIAL
TRUB_RHOJR      GVY---------------------------------------------AAIDPSGHTIAL
TRUB_BIFLO      PTA---------------------------------------------AIVPQTHDVAAI
TRUB_DEIRA      R-----------------------------------------------AVVTLGGELVAV
TRUB_DEIGD      R-----------------------------------------------HVVTRDGELVAV
TRUB_THET2      YV----------------------------------------------TLVDSKRRLLAI
TRUB_THET8      YV----------------------------------------------TLVDSKRRLLAI
TRUB_TROWT      KGPV-----------------------------------CAVCKENLIAVIQPVSAGLWR
TRUB_TROW8      NGPV-----------------------------------CAVCKENLIAVIQPVSAGLWR
TRUB_TRIV2      QA------------------------------------------------ETNI--FLGI
TRUB_NOSS1      QA------------------------------------------------ETNI--FLGI
TRUB_TRIEI      RV------------------------------------------------YNYKGDFLGI
TRUB_ACAM1      QV------------------------------------------------HDTSDRFLGM
TRUB_SYNP6      RV------------------------------------------------YDLNGQFLGI
TRUB_SYNE7      RV------------------------------------------------YDLNGQFLGI
TRUB_GLOVI      WE------------------------------------------------CETD-RFLGV
TRUB_THEEB      GV------------------------------------------------TFATA-CVGV
TRUB_SYNY3      TS------------------------------------------------ELGPVKCLGV
TRUB_MICAN      AV------------------------------------------------ESLEAQFLGI
TRUB_PROMT      E--------------------------------------DSFIHNNHILVLNKENKILGI
TRUB_PROM1      E--------------------------------------DSFIHNNNILVLNKENKILGI
TRUB_PROMA      D--------------------------------------DKDIPKTFLTVINNENHLIGL
TRUB_SYNPW      ------------------------------------------------------GRMLGL
TRUB_SYNPX      ------------------------------------------------------GSMAGI
TRUB_SYNS3      ------------------------------------------------------NIMLGI
TRUB_PROMM      QQESA------------------------------PNQTDPSANKSMLVVIDCRGEVAGM
TRUB_PROMP      P----------------------------------------------IKIIDPNKILLGI
TRUB_PROM5      P----------------------------------------------IKIINNQKMLLGI
TRUB_PROM0      P----------------------------------------------IKVIDKKQILLGI
TRUB_PROMS      P----------------------------------------------IKVIDNKQTLLGI
TRUB_PROM9      P----------------------------------------------IKVVDKRKMLLGI
TRUB_PROM2      P----------------------------------------------LKVVDSRKMLLGI
TRUB_BACFN      ------------------------------------------------------------
TRUB_BACFR      ------------------------------------------------------------
TRUB_BACTN      ------------------------------------------------------------
TRUB_BACV8      ------------------------------------------------------------
TRUB_PARD8      ------------------------------------------------------------
TRUB_FLAJ1      ------------------------------------------------------------
TRUB_PELLD      EDRSR------------------------------QHADR--------------------
TRUB_CHLPM      ------------------------------------------------------------
TRUB_CHLCH      ------------------------------------------------------------
TRUB_CHLTE      ------------------------------------------------------------
TRUB_RHOBA      EAPSE------------------------------PLPEAWIGCIDQVDTFDRNTDVLDC
TRUB_CUPMC      ----------------------------------------------------DEGTLARV
TRUB_CUPPJ      ----------------------------------------------------QEGVLARV
TRUB_RALSO      ----------------------------------------------------EQVRVYGA
TRUB_BURPS      ----------------------------------------------------EGGR-VRV
TRUB_BURMA      ----------------------------------------------------EGGR-VRV
TRUB_BURP1      ----------------------------------------------------EGGR-VRV
TRUB_BURP0      ----------------------------------------------------EGGR-VRV
TRUB_BURM7      ----------------------------------------------------EGGR-VRV
TRUB_BURP6      ----------------------------------------------------EGGR-VRV
TRUB_BURL3      ----------------------------------------------------EGER-VRV
TRUB_VEREI      ----------------------------------------------------PDAPAVAV
TRUB_DECAR      ----------------------------------------------------GLAGKARV
TRUB_BORPE      ------------------------------------------------------------
TRUB_BORBR      ------------------------------------------------------------
TRUB_BORPA      ------------------------------------------------------------
TRUB_BORA1      ------------------------------------------------------------
TRUB_AROAE      ----------------------------------------------------GAAGLVRI
TRUB_THIDA      ----------------------------------------------------DRRGLVRV
TRUB_CHRVO      ----------------------------------------------------EKMQRFRV
TRUB_NEIMB      ----------------------------------------------------PSDTPVRV
TRUB_NEIG1      ----------------------------------------------------PSDTPVRV
TRUB_NEIMA      ----------------------------------------------------PSDTPVRV
TRUB_NITMU      ----------------------------------------------------LPGRQVRL
TRUB_NITEU      ----------------------------------------------------PVNTQLKL
TRUB_PSEAB      ----------------------------------------------------PKFGWLRV
TRUB_PSEAE      ----------------------------------------------------PKFGWLRV
TRUB_PSEA7      ----------------------------------------------------PKFGWLRV
TRUB_PSEF5      ----------------------------------------------------PKFGMVRV
TRUB_PSEPF      ----------------------------------------------------PKFGMVRV
TRUB_PSE14      ----------------------------------------------------PKFGMVRV
TRUB_PSEU2      ----------------------------------------------------PKFGMVRV
TRUB_PSEP1      ----------------------------------------------------PQFGMVRV
TRUB_PSEPG      ----------------------------------------------------PQFGMVRV
TRUB_PSEE4      ----------------------------------------------------PQFGMVRV
TRUB_PSEMY      ----------------------------------------------------PKFGMVRV
TRUB_PSEU5      ----------------------------------------------------PKYGMVRV
TRUB_COXBU      ----------------------------------------------------PTHGFVRL
TRUB_COXBR      ----------------------------------------------------PTHGFVRL
TRUB_COXBN      ----------------------------------------------------PTHGFVRL
TRUB_NITOC      ----------------------------------------------------PSEGWVRL
TRUB_METFK      ----------------------------------------------------SISGLFRL
TRUB_ACIAD      ----------------------------------------------------DHDAVPEV
TRUB_MARMS      ----------------------------------------------------EHEAVVRM
TRUB_LEGPC      ----------------------------------------------------VEGEDLRL
TRUB_LEGPA      ----------------------------------------------------VEGEDLRL
TRUB_LEGPH      ----------------------------------------------------VEGEDLRL
TRUB_LEGPL      ----------------------------------------------------VEGEDLRL
TRUB_MARHV      ----------------------------------------------------FEG-FVRL
TRUB_HAHCH      ----------------------------------------------------SEG-KVRL
TRUB_SACD2      ----------------------------------------------------DEGDKVRV
TRUB_XANAC      --------------------------------------------------------QVAV
TRUB_XANC5      --------------------------------------------------------QVAV
TRUB_XANOM      --------------------------------------------------------QVAV
TRUB_XANOR      --------------------------------------------------------QVAV
TRUB_XANCP      --------------------------------------------------------QVAV
TRUB_XANC8      --------------------------------------------------------QVAV
TRUB_XYLFA      --------------------------------------------------------RVAV
TRUB_XYLFT      --------------------------------------------------------RVAV
TRUB_METCA      --------------------------------------------------------PTAA
TRUB_SERP5      -----------------------------------------------------ASGMVRI
TRUB_PECAS      -----------------------------------------------------LNGMVRI
TRUB_ECOL5      -----------------------------------------------------LEGLVRV
TRUB_ECOL6      -----------------------------------------------------LEGLVRV
TRUB_ECOLI      -----------------------------------------------------LEGLVRV
TRUB_ECOHS      -----------------------------------------------------LEGLVRV
TRUB_ECOUT      -----------------------------------------------------LEGLVRV
TRUB_SHIF8      -----------------------------------------------------LEGLVRV
TRUB_SHISS      -----------------------------------------------------LEGLVRV
TRUB_ECOLC      -----------------------------------------------------LEGLVRV
TRUB_ECOK1      -----------------------------------------------------LEGLVRV
TRUB_ECO57      -----------------------------------------------------LEGLVRV
TRUB_ECO24      -----------------------------------------------------LEGLVRV
TRUB_SHIDS      -----------------------------------------------------LEGLVRV
TRUB_SHIFL      -----------------------------------------------------LEGLVRV
TRUB_SHIBS      -----------------------------------------------------LEGLVRV
TRUB_CITK8      -----------------------------------------------------LEGLVRV
TRUB_SALCH      -----------------------------------------------------LKGLVRV
TRUB_SALTY      -----------------------------------------------------LKGLVRV
TRUB_SALTI      -----------------------------------------------------LKGLVRV
TRUB_SALPA      -----------------------------------------------------LKGLVRV
TRUB_SALPB      -----------------------------------------------------LKGLVRV
TRUB_SALAR      -----------------------------------------------------LNGLVRV
TRUB_ENT38      -----------------------------------------------------QRGLVRV
TRUB_KLEP7      -----------------------------------------------------LNGLVRV
TRUB_CROS8      -----------------------------------------------------SEGLVRV
TRUB_YERPE      -----------------------------------------------------SEGMVRI
TRUB_YERPA      -----------------------------------------------------SEGMVRI
TRUB_YERPP      -----------------------------------------------------SEGMVRI
TRUB_YERP3      -----------------------------------------------------SEGMVRI
TRUB_YERPN      -----------------------------------------------------SEGMVRI
TRUB_YERPS      -----------------------------------------------------SEGMVRI
TRUB_YERE8      -----------------------------------------------------GEGMVRI
TRUB_YEREN      -----------------------------------------------------GEGMVRI
TRUB_PHOLL      ----------------------------------------------------LVESMVRV
TRUB_SODGM      -----------------------------------------------------QAGLVRL
TRUB_VIBVU      ----------------------------------------------------TEG-QLRL
TRUB_VIBVY      ----------------------------------------------------TEG-QLRL
TRUB_VIBCB      ----------------------------------------------------EGT-PIRM
TRUB_VIBPA      ----------------------------------------------------EQG-FLRL
TRUB_VIBC3      ----------------------------------------------------SDG-MVRI
TRUB_VIBCH      ----------------------------------------------------SDG-MVRI
TRUB_ALIF1      ----------------------------------------------------QDG-IVRM
TRUB_PHOPR      ----------------------------------------------------EQGTLVRI
TRUB_SHEHH      ----------------------------------------------------VDE-LVRI
TRUB_SHEPA      ----------------------------------------------------VDE-LVRI
TRUB_SHELP      ----------------------------------------------------IDE-LVRI
TRUB_SHEDO      ----------------------------------------------------IDV-LVRI
TRUB_SHEFN      ----------------------------------------------------PDE-LVRI
TRUB_SHESR      ----------------------------------------------------ADK-LVRI
TRUB_SHESM      ----------------------------------------------------ADK-LVRI
TRUB_SHESA      ----------------------------------------------------ADT-LVRI
TRUB_SHESW      ----------------------------------------------------ADT-LVRI
TRUB_SHEPC      ----------------------------------------------------ADT-LVRI
TRUB_SHEB9      ----------------------------------------------------TDE-LVRI
TRUB_SHEB8      ----------------------------------------------------TDE-LVRI
TRUB_SHEB5      ----------------------------------------------------TDE-LVRI
TRUB_SHEAM      ----------------------------------------------------SDS-LLRI
TRUB_PSYIN      ----------------------------------------------------DNT-VLRI
TRUB_COLP3      ----------------------------------------------------EAG-SVQV
TRUB_PSEA6      ----------------------------------------------------QGT-LVRT
TRUB_HAEIE      -----------------------------------------------------LSGQVRL
TRUB_HAEIG      -----------------------------------------------------LSGQVRL
TRUB_HAEI8      -----------------------------------------------------LGGQVRL
TRUB_HAEIN      -----------------------------------------------------LSGQVRL
TRUB_MANSM      -----------------------------------------------------LQGQVRL
TRUB_PASMU      -----------------------------------------------------LTGQVRL
TRUB_ACTP2      -----------------------------------------------------IYGQVRL
TRUB_HAEDU      -----------------------------------------------------IYGMVRL
TRUB_HAES1      -----------------------------------------------------IQGQVRL
TRUB_HISS2      -----------------------------------------------------IQGQVRL
TRUB_PSEHT      ------------------------------------------------------EGAIKV
TRUB_IDILO      ------------------------------------------------------AEEWRV
TRUB_BUCAI      ------------------------------------------------------NSLVRV
TRUB_BUCAP      ------------------------------------------------------NGLVRV
TRUB_BUCBP      ------------------------------------------------------NQFVRI
TRUB_BLOPB      ------------------------------------------------------NMIMLE
TRUB_BLOFL      ------------------------------------------------------ETIMCS
TRUB_WIGBR      ------------------------------------------------------NNLFKI
TRUB_FRATT      ----------------------------------------------------HLDGTVRI
TRUB_FRAT1      ----------------------------------------------------HLDGTVRI
TRUB_FRATW      ----------------------------------------------------HLDGTVRI
TRUB_FRATH      ----------------------------------------------------HLDGTVRI
TRUB_FRATF      ----------------------------------------------------HLDGTVRI
TRUB_FRATO      ----------------------------------------------------HLDGTVRI
TRUB_FRATN      ----------------------------------------------------HLDGTVRI
TRUB_FRAP2      ----------------------------------------------------HLDGTVRI
TRUB_PSYCK      ----------------------------------------------------QLTDDVQS
TRUB_PSYA2      ----------------------------------------------------QLTNDLQS
TRUB_HYDCU      ----------------------------------------------------PETLLVRF
TRUB_GEOSL      ----------------------------------------------------IPAGTRLR
TRUB_GEOMG      ----------------------------------------------------QNDGKKVR
TRUB_GEOUR      ----------------------------------------------------LLRDELVR
TRUB_PELCD      ----------------------------------------------------FEEGTQVL
TRUB_DESAG      ----------------------------------------------------TEGIRAVL
TRUB_DESVH      ----------------------------------------------------MEGVKAIL
TRUB_DESPS      ------------------------------------------------------------
TRUB_SYNWW      ----------------------------------------------------LASPRVRL
TRUB_DEHMB      ----------------------------------------------------VYNAENSF
TRUB_DEHMC      ----------------------------------------------------VYNAENSF
TRUB_DEHM1      ----------------------------------------------------VYSAENRF
TRUB_CHLMU      ------------------------------------------------------------
TRUB_CHLTR      ------------------------------------------------------------
TRUB_CHLFF      ------------------------------------------------------------
TRUB_CHLAB      ------------------------------------------------------------
TRUB_CHLPN      ------------------------------------------------------------
TRUB_PARUW      ------------------------------------------------------------
TRUB_AQUAE      ------KRIL-------------------------IKNYDYEGLVKIYE----DSKFIGI
TRUB_SOLUE      ------RDFP-------------------------ASPFRSQPASKYVKAVTRTGDLVAI
TRUB_THEMA      --DGFKKGEV-------------------------VRVFNEEGRLLALAEAERNSSFLET
TRUB_THEP1      --DGFKKGEV-------------------------VRVFNEEGRLLALAEAERNSSFLET
TRUB_THEM4      --DSFSKDDD-------------------------VMLICN-GQLVAIAKAERNSKFLEK
TRUB_SYNAS      --PSLADGDM-------------------------VKFLTSSGGLVAVARFLYASDQLAV
TRUB_CALS8      ---PLTRKDI-------------------------KEIRLNDSLFEDFYKISMKDAFFVY
TRUB_BDEBA      ---DLRSQLI-------------------------SAFNPDVDQYIQVLAQEGGELLAVI
TRUB_CLOAB      --------------------------------------EKIPDNKTYRVYNMERKFLGLG
TRUB_CLONN      --------------------------------------PNLDINKMYRIYSEDNKFLGLG
TRUB_CLOBL      --------------------------------------DNIEENKLYRTYIEDDSFIGLG
TRUB_CLOTE      --------------------------------------DKIKANDILRVYQED-KFIGLG
TRUB_CLOPE      --------------------------------------EEVEFNKLYRVYEDNGVFLGLG
TRUB_CLOP1      --------------------------------------EEVEFNKLYRVYEDNGVFLGLG
TRUB_CLOPS      --------------------------------------EEVEFNKLYRVYEDNGVFLGLG
TRUB_CLOK5      --------------------------------------KTIK-DKLYRVYIEGNKFIGIG
TRUB_ALKOO      --------------------------------------TIHEPIGQEVCVYLEKEFVGFG
TRUB_LACP7      --------------------------------------KVSDQINIDKIRVYDSEDVFTG
TRUB_CLOD6      --------------------------------------NNFDKDDEFVRVYSTDNFLGLG
TRUB_FUSNN      --------------------------------------ENLE-NKKYRIYFQD-EFIGLA
TRUB_GEOTN      --------------------------------------LQELDG--PVLLVTPEREAMAL
TRUB_GEOKA      --------------------------------------LEKLTG--RSCLFRPSG-----
TRUB_BACHK      --------------------------------------LQITAP--FITVFDKNDRCLAI
TRUB_BACAH      --------------------------------------LQITAP--FITVFDKNDRCLAI
TRUB_BACCZ      --------------------------------------LQITAP--FITVFDKNDRCLAI
TRUB_BACAN      --------------------------------------LQITAP--FITVFDKNDRCLAI
TRUB_BACC1      --------------------------------------LQITAP--FITVFDKNDRCLAI
TRUB_BACCR      --------------------------------------LEITAP--FITVFDKNDRCLAI
TRUB_BACCN      --------------------------------------IQAETP--FITVFDRNNHCLAI
TRUB_BACVZ      --------------------------------------FSAMTADARIAVCTEDGECVAI
TRUB_BACSU      --------------------------------------FSEMTSGDRIAVFTESGTCLAI
TRUB_BACLD      --------------------------------------FSHLTSEDRIAVFTEAGRCTAV
TRUB_BACP2      --------------------------------------FAHFAEEDRVAVFAPSGRCMAI
TRUB_BACHD      ---------------------------------------WFNHP--RFTVYNEEGALLAI
TRUB_BACSK      ---------------------------------------SFGDG--RFLFYNEQGDCLAL
TRUB_OCEIH      ---------------------------------------RNQPKQTDPFVFVREGNVLAI
TRUB_LISMF      --------------------------------------FIEVENEPRAALIFN-DKLTAI
TRUB_LISMO      --------------------------------------FAEVENEPRAALIFK-DKLTAI
TRUB_LISIN      --------------------------------------FQTVENEPRVALIFQ-EKLTAI
TRUB_LISW6      --------------------------------------FVSVENESRVALIFE-GKLTAI
TRUB_STAEQ      --------------------------------------LSQNVKEPFIFVDSSTQKVLAI
TRUB_STAES      --------------------------------------LSQNVKEPFIFVDSSTQKVLAI
TRUB_STAAT      --------------------------------------FDNKIKDQIVFIDDDSEKVLAI
TRUB_STAA3      --------------------------------------FDNKIKDQIVFIDDDSEKVLAI
TRUB_STAA8      --------------------------------------FDNKIKDQIVFIDDDSEKVLAI
TRUB_STAAC      --------------------------------------FDNKIKDQIVFIDDDSEKVLAI
TRUB_STAAE      --------------------------------------FDNKIKDQIVFIDDDSEKVLAI
TRUB_STAAS      --------------------------------------FDNKIKDQIVFIDDDSEKVLAI
TRUB_STAAW      --------------------------------------FDNKIKDQIVFIDGDSEKVLAI
TRUB_STAAR      --------------------------------------FDNKIKDQIVFIDDDSEKVLAI
TRUB_STAA1      --------------------------------------FDNKIKDQIVFIDDDSEKVLAI
TRUB_STAA2      --------------------------------------FDNKIKDQIVFIDDDSEKVLAI
TRUB_STAAM      --------------------------------------FDNKIKDQIVFIDDDSEKVLAI
TRUB_STAAN      --------------------------------------FDNKIKDQIVFIDDDSEKVLAI
TRUB_STAA9      --------------------------------------FDNKIKDQIVFIDDDSEKVLAI
TRUB_STAAB      --------------------------------------FDNKIKDQIVFIDDDSEKVLAI
TRUB_STAHJ      --------------------------------------FNQTIEQQLVFIDSETEKVMAI
TRUB_STAS1      --------------------------------------FKQNIDDIVIMVDNETHKVLAI
TRUB_LACPL      -------------------------------------GQQTDPDANTMVALVYQNSLKCL
TRUB_LACBA      -------------------------------------NQATEPE----LALTYQGETKCL
TRUB_LACP3      ----------------------------------------QTPR----VRLHFAGVLKAI
TRUB_PEDPA      ----------------------------------------QTDEI---IALKYNGNIQAL
TRUB_LACSS      ----------------------------------------QTEEI---LALTYEGHIKAL
TRUB_LACS1      --------------------------------------FKEDYDR---VNLFYDDRIRCI
TRUB_LACRD      ---------------------------------------LNTSEKE--IVLSFDGQVKAL
TRUB_STRR6      ----------------------------------------TDKEL----AAFEDDKLLAI
TRUB_STRP2      ----------------------------------------TDKEL----AAFEDDKLLAI
TRUB_STRPN      ----------------------------------------TDKEL----AAFEDDKLLAI
TRUB_STRGC      ----------------------------------------DEAEL----AGFYGEKLVTI
TRUB_STRSV      ----------------------------------------EEAEL----AGFYKEKLIAI
TRUB_STRT2      ----------------------------------------QEPLV----AAFLGDKVLAI
TRUB_STRT1      ----------------------------------------QEPLV----AAFLGNKVLAI
TRUB_STRA1      ----------------------------------------EADTL----AAFYENRVIAI
TRUB_STRA3      ----------------------------------------EADTL----AAFYENRVIAI
TRUB_STRA5      ----------------------------------------EADTL----AAFYENRVIAI
TRUB_STRMU      ----------------------------------------QEELL----AAFFENQLVAV
TRUB_STRP1      ----------------------------------------QEPLL----AAFHGEKVIAI
TRUB_STRP8      ----------------------------------------QEPLL----AAFHGEKVIAI
TRUB_STRPF      ----------------------------------------QEPLL----AAFHGEKVIAI
TRUB_STRP6      ----------------------------------------QEPLL----AAFHGEKVIAI
TRUB_STRPB      ----------------------------------------QEPLL----AAFHGEKVIAI
TRUB_STRPC      ----------------------------------------QEPLL----AAFHGEKVIAI
TRUB_STRP3      ----------------------------------------QEPLL----AAFHGEKVIAI
TRUB_STRPM      ----------------------------------------QEPLL----AAFHGEKVIAI
TRUB_STRPG      ----------------------------------------QEPLL----AAFHGEKVIAI
TRUB_STRPD      ----------------------------------------QEPLL----AAFHGEKVIAI
TRUB_LACLM      KTKQQEYLLT-------------------------DLSLLTTEKF----AAFYNDKLVAV
TRUB_LACLS      KTKQQEYLLT-------------------------DLSLLTTEKF----AAFYNDKLVAV
TRUB_LACLA      KSNKSKFLLT-------------------------DLSELTRDKF----AAFYDDKLIAV
TRUB_LACDB      ----------------------------------------DADKV----ALRYNKTVKAI
TRUB_LACDA      ----------------------------------------DADKV----ALRYNKTVKAI
TRUB_LACGA      ----------------------------------------SYAKV----ALVYNGHIKAI
TRUB_LACJO      ----------------------------------------TYAKV----ALVYNGHIKAI
TRUB_LACAC      ----------------------------------------NAKKV----ALRYNEKVKAI
TRUB_OENOB      ---------------------------------------ISVSPV----KIFYNNSFQAI
TRUB_SYMTH      ---------------------------------------DGTTVAVVAANGALLALAEA-
TRUB_MOOTA      -----------------------------------PSLREGDIVRLETGEGQLLALARV-
TRUB_PELTS      -----------------------------------LDLDCGKLVRLTGPDG-LLAIAEAG
TRUB_CARHZ      ---------------------------------------FGPVFAYYGEKIIATGMICG-
TRUB_CALS4      -----------------------------------------SLVKLYDNHGIFIGIGVAE
TRUB_MYCMO      ----------------------------------------------------IGFGQILN
TRUB_MYCH2      ----------------------------------------------------VGFGKIIN
TRUB_MYCPU      ----------------------------------------------------LGICKIES
TRUB_WOLSU      ----------------------------------------------------EFFSIIEI
TRUB_HELHP      ----------------------------------------------------DFFSIIEI
TRUB_SULNB      ----------------------------------------------------NFFSIIEI
TRUB_NITSB      ----------------------------------------------------DFFAIIRV
TRUB_SULDN      ----------------------------------------------------SFISIIHV
TRUB_CAMJJ      ----------------------------------------------------KYFSIINI
TRUB_CAMJ8      ----------------------------------------------------KYFSIINI
TRUB_CAMJE      ----------------------------------------------------KYFSIINI
TRUB_CAMJR      ----------------------------------------------------KYFSIINI
TRUB_CAMJD      ----------------------------------------------------KYFSIINI
TRUB_CAMC1      ----------------------------------------------------KFMSVIQI
TRUB_CAMC5      ----------------------------------------------------KFLSIIEI
                                                                            

TRUB_UREPA      ------------------------------------------------------------
TRUB_UREP2      ------------------------------------------------------------
TRUB_MYCPE      ------------------------------------------------------------
TRUB_MYCMS      QKYDNNIF----------------------------------------------------
TRUB_MYCCT      QKYENNIF----------------------------------------------------
TRUB_MESFL      ERENGNVF----------------------------------------------------
TRUB_AYWBP      YDILDENK----------------------------------------------------
TRUB_ONYPE      YDTLDENK----------------------------------------------------
TRUB_ACHLI      Y-VPDNQQ----------------------------------------------------
TRUB_CAUVC      CEMRAGK-----------------------------------------------------
TRUB_CAUSK      CEMRAGS-----------------------------------------------------
TRUB_MARMM      GDARAGK-----------------------------------------------------
TRUB_BRUSI      GYIEHGQ-----------------------------------------------------
TRUB_BRUAB      GYIEHGQ-----------------------------------------------------
TRUB_BRUA2      GYIEHGQ-----------------------------------------------------
TRUB_BRUSU      GYIEHGQ-----------------------------------------------------
TRUB_BRUO2      GYIEHGQ-----------------------------------------------------
TRUB_BRUC2      GYIEHGQ-----------------------------------------------------
TRUB_BRUME      GYIEHGQ-----------------------------------------------------
TRUB_OCHA4      GYIEHGQ-----------------------------------------------------
TRUB_RHILO      GAIEQGM-----------------------------------------------------
TRUB_CHESB      GMVEAGM-----------------------------------------------------
TRUB_RHIME      GEIAEGE-----------------------------------------------------
TRUB_SINMW      GEIAEGE-----------------------------------------------------
TRUB_RHIEC      GEIGQGE-----------------------------------------------------
TRUB_RHIL3      GEIGQGE-----------------------------------------------------
TRUB_AGRFC      GEIGEGE-----------------------------------------------------
TRUB_BARHE      GALEKNQ-----------------------------------------------------
TRUB_BARQU      ------------------------------------------------------------
TRUB_BART1      GTLDKGL-----------------------------------------------------
TRUB_BARBK      GTIDQNQ-----------------------------------------------------
TRUB_BRADU      AEVGNGE-----------------------------------------------------
TRUB_RHOPA      AEVGNGE-----------------------------------------------------
TRUB_GLUDA      CRLEDGW-----------------------------------------------------
TRUB_GLUOX      CHVRHGR-----------------------------------------------------
TRUB_RHORT      AKIVEGE-----------------------------------------------------
TRUB_RUEST      GTFKAGE-----------------------------------------------------
TRUB_RUEPO      GIYKSGE-----------------------------------------------------
TRUB_ROSDO      GRYKSGE-----------------------------------------------------
TRUB_RHOS4      GIYKSGE-----------------------------------------------------
TRUB_RHOS1      GIYKSGE-----------------------------------------------------
TRUB_RHOS5      GIYKAGE-----------------------------------------------------
TRUB_DINSH      GTYRAGE-----------------------------------------------------
TRUB_JANSC      GRYRSGE-----------------------------------------------------
TRUB_PARDP      GRYMGGE-----------------------------------------------------
TRUB_EHRRW      CSIANNV-----------------------------------------------------
TRUB_EHRRG      CSIANNV-----------------------------------------------------
TRUB_EHRCJ      CSIVNSV-----------------------------------------------------
TRUB_EHRCR      CSIVNSV-----------------------------------------------------
TRUB_ANAMM      CKVVNGT-----------------------------------------------------
TRUB_ZYMMO      IEVTGQE-----------------------------------------------------
TRUB_RICB8      GSLNKNC-----------------------------------------------------
TRUB_RICBR      GSLNKNC-----------------------------------------------------
TRUB_RICRS      GSLNKSC-----------------------------------------------------
TRUB_RICRO      GSLNKSC-----------------------------------------------------
TRUB_RICCK      GSLNKSC-----------------------------------------------------
TRUB_RICAH      GSLNKNC-----------------------------------------------------
TRUB_RICTY      GSLNKSC-----------------------------------------------------
TRUB_BORAP      KGIDLNK-----------------------------------------------------
TRUB_BORBP      EGIGFNK-----------------------------------------------------
TRUB_BORBU      QGVGLNK-----------------------------------------------------
TRUB_TREPA      IRKAANG-----------------------------------------------------
TRUB_TREDE      IGLNKNC-----------------------------------------------------
TRUB_ARTS2      LA---DAGG--------------------------------------------------Y
TRUB_PAEAT      LA---DTGS--------------------------------------------------F
TRUB_THEFY      AE---NRSG--------------------------------------------------S
TRUB_STRAW      VE---EQKG--------------------------------------------------K
TRUB_STRCO      VE---EHKG--------------------------------------------------K
TRUB_LEIXX      IE---FRGK--------------------------------------------------E
TRUB_CUTAK      YRPDDEKDG--------------------------------------------------Q
TRUB_CORGL      IE---EKGK--------------------------------------------------R
TRUB_CORGB      IE---EKGK--------------------------------------------------R
TRUB_COREF      VE---EKGK--------------------------------------------------R
TRUB_CORDI      VK---EQGK--------------------------------------------------R
TRUB_CORJK      VE---EKGK--------------------------------------------------R
TRUB_MYCTU      LR---DEGS--------------------------------------------------R
TRUB_MYCBP      LR---DEGS--------------------------------------------------R
TRUB_MYCBO      LR---DEGS--------------------------------------------------R
TRUB_MYCTA      LR---DEGS--------------------------------------------------R
TRUB_MYCA1      LR---DEGA--------------------------------------------------R
TRUB_MYCPA      LR---DEGA--------------------------------------------------R
TRUB_MYCLE      LR---DEGP--------------------------------------------------R
TRUB_MYCUA      LR---DEGR--------------------------------------------------R
TRUB_NOCFA      LE---EKGK--------------------------------------------------R
TRUB_RHOJR      LQ---ERGR--------------------------------------------------R
TRUB_BIFLO      IE--RANAH--------------------------------------------------Q
TRUB_DEIRA      VD---GDGE--------------------------------------------------H
TRUB_DEIGD      VD---GDGK--------------------------------------------------E
TRUB_THET2      AE---GDGF--------------------------------------------------K
TRUB_THET8      AE---GDGF--------------------------------------------------K
TRUB_TROWT      PETVLSDNR--------------------------------------------------K
TRUB_TROW8      PETVLSDNR--------------------------------------------------K
TRUB_TRIV2      GELQTG------------------------------------------------------
TRUB_NOSS1      GELQAG------------------------------------------------------
TRUB_TRIEI      GQLIKSEEN--------------------------------------------------L
TRUB_ACAM1      GEIIDG------------------------------------------------------
TRUB_SYNP6      GAIAAG------------------------------------------------------
TRUB_SYNE7      GAIAAG------------------------------------------------------
TRUB_GLOVI      AACEAG------------------------------------------------------
TRUB_THEEB      GISG----G--------------------------------------------------D
TRUB_SYNY3      ALVTPEDHG--------------------------------------------------T
TRUB_MICAN      GEIVVAEDE--------------------------------------------------Y
TRUB_PROMT      A-CLDDS----------------------------------------------------F
TRUB_PROM1      A-CLDES----------------------------------------------------F
TRUB_PROMA      ARWHHEP----------------------------------------------------F
TRUB_SYNPW      G-VPDGT----------------------------------------------------G
TRUB_SYNPX      G-LRQED----------------------------------------------------D
TRUB_SYNS3      G-LANSE----------------------------------------------------A
TRUB_PROMM      A-YWEDN----------------------------------------------------A
TRUB_PROMP      GFINEEK----------------------------------------------------T
TRUB_PROM5      GFINEDK----------------------------------------------------N
TRUB_PROM0      GFLNEEQ----------------------------------------------------S
TRUB_PROMS      GFLNKEQ----------------------------------------------------S
TRUB_PROM9      GFLNKEL----------------------------------------------------T
TRUB_PROM2      GFLDDDH----------------------------------------------------T
TRUB_BACFN      ------------------------------------------------------------
TRUB_BACFR      ------------------------------------------------------------
TRUB_BACTN      ------------------------------------------------------------
TRUB_BACV8      ------------------------------------------------------------
TRUB_PARD8      ------------------------------------------------------------
TRUB_FLAJ1      ------------------------------------------------------------
TRUB_PELLD      ------------------------------------------------------------
TRUB_CHLPM      ------------------------------------------------------------
TRUB_CHLCH      ------------------------------------------------------------
TRUB_CHLTE      ------------------------------------------------------------
TRUB_RHOBA      IGVDRSDGS--------------------------------------------------S
TRUB_CUPMC      YGDEG------RLLGVA---RM-KEG--------------------------------AL
TRUB_CUPPJ      YGGEPP-----KLLGVA---RM-REG--------------------------------AL
TRUB_RALSO      RGEAGA-----SLLGVA---AW-QGG--------------------------------VL
TRUB_BURPS      Y-DADD-----RLLGVA---RA-SEG--------------------------------VL
TRUB_BURMA      Y-DADD-----RLLGVA---RA-SEG--------------------------------VL
TRUB_BURP1      Y-DADD-----RLLGVA---RA-SEG--------------------------------VL
TRUB_BURP0      Y-DADD-----RLLGVA---RA-SEG--------------------------------VL
TRUB_BURM7      Y-DADD-----RLLGVA---RA-SEG--------------------------------VL
TRUB_BURP6      Y-DADD-----RLLGVA---RA-SEG--------------------------------VL
TRUB_BURL3      Y-DAT------RLLGVA---RK-ANG--------------------------------VL
TRUB_VEREI      FGADPP-----ALLGVG---HI-AGG--------------------------------CL
TRUB_DECAR      Y--AEG-----RLIGVG---EPGHGG--------------------------------LL
TRUB_BORPE      ------------------------------------------------------------
TRUB_BORBR      ------------------------------------------------------------
TRUB_BORPA      ------------------------------------------------------------
TRUB_BORA1      ------------------------------------------------------------
TRUB_AROAE      Y--GEG-----RYLGLG---ECDGN---------------------------------GT
TRUB_THIDA      YD-GHG-----VFVGLA---EAEA----------------------------------GK
TRUB_CHRVO      YQQSSR-----RFVGLG---EARGD---------------------------------GR
TRUB_NEIMB      YT-ENG-----RFVGLA---EYQKEI--------------------------------CR
TRUB_NEIG1      YT-ENG-----RFVGLA---EYQKEI--------------------------------CR
TRUB_NEIMA      YT-ENG-----RFVGLA---EYQKEI--------------------------------CR
TRUB_NITMU      YD-KAQ-----RFLGLG---EISTEG--------------------------------YI
TRUB_NITEU      YD-DRN-----VFLGLG---ERIDPE--------------------------------VI
TRUB_PSEAB      QDQTG------RFIGIG---EVTDD---------------------------------GR
TRUB_PSEAE      QDHTG------RFIGIG---EVTDD---------------------------------GR
TRUB_PSEA7      QDHTG------RFIGIG---EVTDD---------------------------------GR
TRUB_PSEF5      QDHNG------RFIGIG---EVSED---------------------------------GR
TRUB_PSEPF      QDHNG------RFIGIG---EVSED---------------------------------GR
TRUB_PSE14      QDHEG------RFIGIG---EVGED---------------------------------GR
TRUB_PSEU2      QDHEG------RFIGIG---EVAED---------------------------------GR
TRUB_PSEP1      QDHNA------RFIGIG---EVSED---------------------------------GR
TRUB_PSEPG      QDHNA------RFIGIG---EVSED---------------------------------GR
TRUB_PSEE4      QDHNG------RFIGIG---EVSED---------------------------------GR
TRUB_PSEMY      QDHNG------RFIGIG---EVSDD---------------------------------GR
TRUB_PSEU5      QDNNG------RFIGIG---EVSED---------------------------------GR
TRUB_COXBU      RDQND------QFIGIG---EILSD---------------------------------AR
TRUB_COXBR      RDQND------QFIGIG---EILSD---------------------------------AR
TRUB_COXBN      RDQND------QFIGIG---EILSD---------------------------------AR
TRUB_NITOC      IECGK------GFFGVG---RITED---------------------------------GR
TRUB_METFK      YSEQG------AFLGLG---EQTSR---------------------------------GS
TRUB_ACIAD      LVFEGE-----RCLGLA---EITDK---------------------------------KR
TRUB_MARMS      YDQGTQ-----RFLGLG---QIKGAFIRP-----------------------------YR
TRUB_LEGPC      YGEQS------QFIGIG---QALIH---------------------------------GD
TRUB_LEGPA      YGEQS------QFIGIG---QALIH---------------------------------GD
TRUB_LEGPH      YGEQS------QFIGIG---QALIH---------------------------------GD
TRUB_LEGPL      YGEQS------QFIGIG---QALIH---------------------------------GD
TRUB_MARHV      Y-GEH------SFVGLA---EALPE---------------------------------GD
TRUB_HAHCH      YTNRR------HFIGLG---EVMSD---------------------------------GT
TRUB_SACD2      FDSSG------KFYGVA---EITDE---------------------------------GT
TRUB_XANAC      FGPDG------TPSGLG---LVDAD---------------------------------GR
TRUB_XANC5      FGPDG------TPSGLG---LVDAD---------------------------------GR
TRUB_XANOM      FGPDG------SPSGLG---LVDAD---------------------------------GR
TRUB_XANOR      FGPDG------SPSGLG---LVDAD---------------------------------GR
TRUB_XANCP      FDADG------SPAGLG---LVDAD---------------------------------GR
TRUB_XANC8      FDADG------SPAGLG---LVDAD---------------------------------GR
TRUB_XYLFA      FSRDG------IPAGLG---EVDSE---------------------------------GL
TRUB_XYLFT      FSRDG------IPAGLG---EVDSE---------------------------------GL
TRUB_METCA      WAPP--------------------------------------------------------
TRUB_SERP5      TEGEER-----KFIGVG---DIADDG---------------------------------R
TRUB_PECAS      TEGDAH-----KFIGMG---EIDGDG---------------------------------R
TRUB_ECOL5      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_ECOL6      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_ECOLI      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_ECOHS      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_ECOUT      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_SHIF8      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_SHISS      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_ECOLC      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_ECOK1      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_ECO57      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_ECO24      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_SHIDS      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_SHIFL      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_SHIBS      TEGENG-----KFIGMG---EIDDEG---------------------------------R
TRUB_CITK8      TEGDDE-----KFIGMG---EIDDEG---------------------------------R
TRUB_SALCH      TEGEDD-----KFIGMG---EIDDEG---------------------------------R
TRUB_SALTY      TEGEDD-----KFIGMG---EIDDEG---------------------------------R
TRUB_SALTI      TEGEDD-----KFIGMG---EIDDEG---------------------------------R
TRUB_SALPA      TEGEDD-----KFIGMG---EIDDEG---------------------------------R
TRUB_SALPB      TEGEDD-----KFIGMG---EIDDEG---------------------------------R
TRUB_SALAR      TEGEDG-----KFIGMG---EIDDEG---------------------------------R
TRUB_ENT38      TEGEEN-----KFIGMG---EIDDEG---------------------------------R
TRUB_KLEP7      MESESG-----KFLGMG---EIDDEG---------------------------------R
TRUB_CROS8      TEGEAQ-----KFLGMG---EIDSEG---------------------------------R
TRUB_YERPE      TEGKER-----NFIGIG---TIAEDG---------------------------------R
TRUB_YERPA      TEGKER-----NFIGIG---TIAEDG---------------------------------R
TRUB_YERPP      TEGKER-----NFIGIG---TIAEDG---------------------------------R
TRUB_YERP3      TEGKER-----NFIGIG---TIAEDG---------------------------------R
TRUB_YERPN      TEGKER-----NFIGIG---TIAEDG---------------------------------R
TRUB_YERPS      TEGKER-----NFIGIG---TIAEDG---------------------------------R
TRUB_YERE8      TEGEER-----NFIGIG---TIAEDG---------------------------------R
TRUB_YEREN      TEGEER-----NFIGIG---TIAEDG---------------------------------A
TRUB_PHOLL      TEGDER-----KFIGIA---VINDDG---------------------------------L
TRUB_SODGM      TEGDAG-----RFFGIG---EIAAPG---------------------------------R
TRUB_VIBVU      TMGEER-----RFIGVG---EMNRDG---------------------------------K
TRUB_VIBVY      TMGEER-----RFIGVG---EMNRDG---------------------------------K
TRUB_VIBCB      TSGEDK-----LFIGVA---EVNDDG---------------------------------K
TRUB_VIBPA      TMGEEH-----LFIGVG---EMNDDG---------------------------------K
TRUB_VIBC3      TGGEQK-----LFLGVG---EIDDNG---------------------------------K
TRUB_VIBCH      TGGEQK-----LFLGVG---EIDDNG---------------------------------K
TRUB_ALIF1      TSGDER-----LFIGVG---HIDDDG---------------------------------R
TRUB_PHOPR      TVGEQR-----DFIGIG---EIDQNN---------------------------------M
TRUB_SHEHH      TIGDAR-----QFVGIG---QMNDDG---------------------------------Q
TRUB_SHEPA      TIGDAR-----QFVGIG---QMNDDG---------------------------------L
TRUB_SHELP      TLGEAK-----QFVGIG---QMNDDG---------------------------------L
TRUB_SHEDO      TIGEQR-----KFVGIG---IMNDDG---------------------------------L
TRUB_SHEFN      TIGDER-----RFVGMG---IMNDDG---------------------------------L
TRUB_SHESR      TLGTER-----RFVGIG---KMNEDG---------------------------------L
TRUB_SHESM      TLGTER-----RFVGIG---EMNEDG---------------------------------L
TRUB_SHESA      TLGTER-----RFVGIG---EMNQDG---------------------------------L
TRUB_SHESW      TLGDAH-----RFVGIG---AMNDDG---------------------------------L
TRUB_SHEPC      TLGDAH-----RFVGIG---AMNDDG---------------------------------L
TRUB_SHEB9      TLGDIR-----RFVGIG---TMNEDG---------------------------------L
TRUB_SHEB8      TLGDIR-----RFVGIG---TMNEDG---------------------------------L
TRUB_SHEB5      TLGDIR-----RFVGIG---TMNEDG---------------------------------L
TRUB_SHEAM      TLGEAR-----RFVGVG---AINDDG---------------------------------L
TRUB_PSYIN      TVGEAH-----TFIGVG---KMNEAG---------------------------------L
TRUB_COLP3      YLGEDENDADAEFIGVG---FINDDG---------------------------------L
TRUB_PSEA6      YCTEGN-----VFLGVS---ELDSDN---------------------------------K
TRUB_HAEIE      FSAENL------FLGVA----LIDGN---------------------------------I
TRUB_HAEIG      FSAENL------FLGVA----LIDGN---------------------------------I
TRUB_HAEI8      FSAENL------FLGVA----LIDGN---------------------------------I
TRUB_HAEIN      FSAENL------FLGVLNRREYYSPT---------------------------------T
TRUB_MANSM      FSPQNV------FLGVA---EIGKDN---------------------------------V
TRUB_PASMU      FSDTQQ------FLGVA---LVDEHN---------------------------------V
TRUB_ACTP2      FSHNMQ------FLGVA---EITTDN---------------------------------V
TRUB_HAEDU      YSEADL------FLGIA---EITADN---------------------------------V
TRUB_HAES1      ISPENL------FLGVA---VIDENS---------------------------------I
TRUB_HISS2      ISPENL------FLGVA---VIDENS---------------------------------I
TRUB_PSEHT      VADGI-------FIGTG---ERNASG---------------------------------H
TRUB_IDILO      ATENSL------FLGVA----RVKNA---------------------------------E
TRUB_BUCAI      IALENN-----KFIGLG---RINTEE---------------------------------L
TRUB_BUCAP      FEKDNN-----TFIGLG---KINSEK---------------------------------T
TRUB_BUCBP      TEGINR-----RFIGIG---KINNIN---------------------------------E
TRUB_BLOPB      LANISN-----EKC----------------------------------------------
TRUB_BLOFL      F-----------------------------------------------------------
TRUB_WIGBR      ISKDTK-----KFVGII---DINKYG---------------------------------R
TRUB_FRATT      YDV-------EKFVAIA---EFDKG----------------------------------K
TRUB_FRAT1      YDV-------EKFVAIA---EFDKG----------------------------------K
TRUB_FRATW      YDV-------EKFVAIA---EFDKG----------------------------------K
TRUB_FRATH      YDV-------EKFVAIA---EFDKG----------------------------------K
TRUB_FRATF      YDV-------EKFVAIA---EFDKG----------------------------------K
TRUB_FRATO      YDV-------EKFVAIA---EFDKG----------------------------------K
TRUB_FRATN      YDD-------EKFVAIA---EFDKG----------------------------------K
TRUB_FRAP2      YDD-------EKFVAIA---EFDKG----------------------------------K
TRUB_PSYCK      YITTAI---DQHLAANN---NSAADSQNIEDTNDDNE---------------------QQ
TRUB_PSYA2      YITSAI---EQHLSTSN---KNAAVNQNVEDDNDDNDDNDDNDDNDDNDDNDDNDDNAQQ
TRUB_HYDCU      YDP------QQRFIGVG---EWQQEKQLLKP---------------------------KR
TRUB_GEOSL      LLRDGI------VVAVADSLAGLWSS---------------------------------D
TRUB_GEOMG      LVQNGK------LLAVAEIGQAESGN---------------------------------G
TRUB_GEOUR      MSFGGT------LLAVAKAGLPGDWK---------------------------------M
TRUB_PELCD      LVGPGG------ALAMATYVPSRARE---------------------------------S
TRUB_DESAG      LDPAGD------PLALAETAYRNQVP---------------------------------V
TRUB_DESVH      LDTREV------PVALVETAIVGGRQ---------------------------------V
TRUB_DESPS      ------------------------------------------------------------
TRUB_SYNWW      YTPEGQ------LLAIAEANNYNEDT---------------------------------V
TRUB_DEHMB      VAIIQP------ETDGTWHPAKVFIR---------------------------------Q
TRUB_DEHMC      VAIIQP------ETDGTWHPAKVFIR---------------------------------Q
TRUB_DEHM1      AAVIRP------ETDGSWHPAKVFLS---------------------------------P
TRUB_CHLMU      ------------------------------------------------------------
TRUB_CHLTR      ------------------------------------------------------------
TRUB_CHLFF      ------------------------------------------------------------
TRUB_CHLAB      ------------------------------------------------------------
TRUB_CHLPN      ------------------------------------------------------------
TRUB_PARUW      ------------------------------------------------------------
TRUB_AQUAE      GELKGGVLS--------------------------------------------------P
TRUB_SOLUE      GEVVLPNLY--------------------------------------------------H
TRUB_THEMA      LRKHERNER--------------------------------------------------V
TRUB_THEP1      LRKHERNER--------------------------------------------------V
TRUB_THEM4      NLPRGR-----------------------------------------------------I
TRUB_SYNAS      SDMGQP-----------------------------------------------------A
TRUB_CALS8      KREGDK-----------------------------------------------------F
TRUB_BDEBA      GLEPGR-----------------------------------------------------G
TRUB_CLOAB      NL----SEE--------------------------------------------------G
TRUB_CLONN      MR----NSK--------------------------------------------------G
TRUB_CLOBL      MK----NAY--------------------------------------------------G
TRUB_CLOTE      QK----TKE--------------------------------------------------G
TRUB_CLOPE      KR----DEK--------------------------------------------------G
TRUB_CLOP1      KR----DEK--------------------------------------------------G
TRUB_CLOPS      KR----DEK--------------------------------------------------G
TRUB_CLOK5      MN----KDF--------------------------------------------------Q
TRUB_ALKOO      IVRNEDHNQ--------------------------------------------------K
TRUB_LACP7      IYEYDEKKN--------------------------------------------------C
TRUB_CLOD6      KLSKHNNTI--------------------------------------------------S
TRUB_FUSNN      NIE---NNN--------------------------------------------------L
TRUB_GEOTN      YVKHPARPG--------------------------------------------------V
TRUB_GEOKA      -KRWPCT-----------------------------------------------------
TRUB_BACHK      YEHHPKHPG--------------------------------------------------M
TRUB_BACAH      YEHHPKHPG--------------------------------------------------M
TRUB_BACCZ      YEHHPKHPG--------------------------------------------------M
TRUB_BACAN      YEHHPKHPG--------------------------------------------------M
TRUB_BACC1      YEHHPKHPG--------------------------------------------------M
TRUB_BACCR      YEHHPKHPG--------------------------------------------------M
TRUB_BACCN      YEHHPKRPG--------------------------------------------------M
TRUB_BACVZ      YMPHPSKKG--------------------------------------------------L
TRUB_BACSU      YFPHPAKKG--------------------------------------------------L
TRUB_BACLD      YYPHPTKTG--------------------------------------------------L
TRUB_BACP2      YMKHPTKQN--------------------------------------------------L
TRUB_BACHD      YKAHPSKDG--------------------------------------------------F
TRUB_BACSK      YQAHPTKAG--------------------------------------------------L
TRUB_OCEIH      YQSHPTNED--------------------------------------------------Q
TRUB_LISMF      YKPHPEKNE--------------------------------------------------L
TRUB_LISMO      YKPHPEKKD--------------------------------------------------L
TRUB_LISIN      YKPHPEKQD--------------------------------------------------L
TRUB_LISW6      YKPHPEKKD--------------------------------------------------L
TRUB_STAEQ      YIVHPDKPY--------------------------------------------------E
TRUB_STAES      YIVHPDKPY--------------------------------------------------E
TRUB_STAAT      YMVHPTKES--------------------------------------------------E
TRUB_STAA3      YMVHPTKES--------------------------------------------------E
TRUB_STAA8      YMVHPTKES--------------------------------------------------E
TRUB_STAAC      YMVHPTKES--------------------------------------------------E
TRUB_STAAE      YMVHPTKES--------------------------------------------------E
TRUB_STAAS      YMVHPTKES--------------------------------------------------E
TRUB_STAAW      YMVHPTKES--------------------------------------------------E
TRUB_STAAR      YMVHPTKES--------------------------------------------------E
TRUB_STAA1      YMVHPTKES--------------------------------------------------E
TRUB_STAA2      YMVHPTKES--------------------------------------------------E
TRUB_STAAM      YMVHPTKES--------------------------------------------------E
TRUB_STAAN      YMVHPTKES--------------------------------------------------E
TRUB_STAA9      YMVHPTKES--------------------------------------------------E
TRUB_STAAB      YMVHPTKES--------------------------------------------------E
TRUB_STAHJ      YIQHPEKNH--------------------------------------------------E
TRUB_STAS1      YEPHPEKLD--------------------------------------------------E
TRUB_LACPL      YSY-RPDEQ--------------------------------------------------R
TRUB_LACBA      YRW-SDEKK--------------------------------------------------Q
TRUB_LACP3      YRR-EDD----------------------------------------------------Q
TRUB_PEDPA      YQYDTNRQN---------------------------------------------------
TRUB_LACSS      YQVANAKQH--------------------------------------------------L
TRUB_LACS1      YQYNKEKNR---------------------------------------------------
TRUB_LACRD      YHF-DPKNK--------------------------------------------------M
TRUB_STRR6      LEKRGNL-----------------------------------------------------
TRUB_STRP2      LEKRGNL-----------------------------------------------------
TRUB_STRPN      LEKRGNL-----------------------------------------------------
TRUB_STRGC      LEKRKDQ-----------------------------------------------------
TRUB_STRSV      LEKREEA-----------------------------------------------------
TRUB_STRT2      MEKRGQV-----------------------------------------------------
TRUB_STRT1      MEKRGQV-----------------------------------------------------
TRUB_STRA1      LEKRGNE-----------------------------------------------------
TRUB_STRA3      LEKRGNE-----------------------------------------------------
TRUB_STRA5      LEKRGNE-----------------------------------------------------
TRUB_STRMU      LEKRDTS-----------------------------------------------------
TRUB_STRP1      LEKRDQE-----------------------------------------------------
TRUB_STRP8      LEKRDQE-----------------------------------------------------
TRUB_STRPF      LEKRDQE-----------------------------------------------------
TRUB_STRP6      LEKRDQE-----------------------------------------------------
TRUB_STRPB      LEKRDQE-----------------------------------------------------
TRUB_STRPC      LEKRDQE-----------------------------------------------------
TRUB_STRP3      LEKRDQE-----------------------------------------------------
TRUB_STRPM      LEKRDQE-----------------------------------------------------
TRUB_STRPG      LEKRDQE-----------------------------------------------------
TRUB_STRPD      LEKRDQE-----------------------------------------------------
TRUB_LACLM      YMKHPEKEG--------------------------------------------------I
TRUB_LACLS      YMKHPEKEG--------------------------------------------------I
TRUB_LACLA      YMKHPEKAG--------------------------------------------------I
TRUB_LACDB      YRAKGQG----------------------------------------------------L
TRUB_LACDA      YRAKGQG----------------------------------------------------L
TRUB_LACGA      YRRQGK-----------------------------------------------------I
TRUB_LACJO      YQRQGK-----------------------------------------------------I
TRUB_LACAC      YEKKGK-----------------------------------------------------I
TRUB_OENOB      YEKQDGF-----------------------------------------------------
TRUB_SYMTH      -DGGG-------------------------------------------------------
TRUB_MOOTA      -EPDTRGSF--------------------------------------------------L
TRUB_PELTS      REPFDKEKL--------------------------------------------------F
TRUB_CARHZ      --------Q--------------------------------------------------I
TRUB_CALS4      -------GE--------------------------------------------------K
TRUB_MYCMO      NVLKSKK-----------------------------------------------------
TRUB_MYCH2      NVLITKK-----------------------------------------------------
TRUB_MYCPU      KIIAPIK-----------------------------------------------------
TRUB_WOLSU      K-EGQVV-----------------------------------------------------
TRUB_HELHP      FSNGGIQ-----------------------------------------------------
TRUB_SULNB      V-GEAVK-----------------------------------------------------
TRUB_NITSB      E-KKKVR-----------------------------------------------------
TRUB_SULDN      K-DAKVN-----------------------------------------------------
TRUB_CAMJJ      K-ENTVK-----------------------------------------------------
TRUB_CAMJ8      K-ENTVK-----------------------------------------------------
TRUB_CAMJE      K-ENTVK-----------------------------------------------------
TRUB_CAMJR      K-ENTVK-----------------------------------------------------
TRUB_CAMJD      K-ENTVK-----------------------------------------------------
TRUB_CAMC1      M-DDTIN-----------------------------------------------------
TRUB_CAMC5      K-NDTIS-----------------------------------------------------
                                                                            

TRUB_UREPA      --------------------------------------
TRUB_UREP2      --------------------------------------
TRUB_MYCPE      --------------------------------------
TRUB_MYCMS      KIKRGGLNNDIY--------------------------
TRUB_MYCCT      KVKRGGLNNDIY--------------------------
TRUB_MESFL      KCKRGGLNI-----------------------------
TRUB_AYWBP      YYPRYFF-------------------------------
TRUB_ONYPE      YYPRYFF-------------------------------
TRUB_ACHLI      YKLKYLF-------------------------------
TRUB_CAUVC      LNPVRVFQLT----------------------------
TRUB_CAUSK      LNPVRVFQLT----------------------------
TRUB_MARMM      FQPSRVFNLTP---------------------------
TRUB_BRUSI      FKPKRVFTAG----------------------------
TRUB_BRUAB      FKPKRVFTAG----------------------------
TRUB_BRUA2      FKPKRVFTAG----------------------------
TRUB_BRUSU      FKPKRVFTAG----------------------------
TRUB_BRUO2      FKPKRVFTAG----------------------------
TRUB_BRUC2      FKPKRVFTAG----------------------------
TRUB_BRUME      FKPKRVFTAG----------------------------
TRUB_OCHA4      FKPKRVFTTG----------------------------
TRUB_RHILO      FKPKRVFAG-----------------------------
TRUB_CHESB      FKPKRVFGL-----------------------------
TRUB_RHIME      FRPKRVFATQ----------------------------
TRUB_SINMW      FRPKRVFAG-----------------------------
TRUB_RHIEC      FRPKRVFA------------------------------
TRUB_RHIL3      FRPKRVFA------------------------------
TRUB_AGRFC      FRPKRVFG------------------------------
TRUB_BARHE      FKPKRLFTI-----------------------------
TRUB_BARQU      --------------------------------------
TRUB_BART1      FKPKRIFTI-----------------------------
TRUB_BARBK      FKPKRIFTTL----------------------------
TRUB_BRADU      IIPKRVFNLTGLTASPGRNERN----------------
TRUB_RHOPA      LIPKRVFNLTGLTASSAVRKESI---------------
TRUB_GLUDA      LRPDRML-------------------------------
TRUB_GLUOX      LRAARMLENHEFFGEHDVDYRRTPHGTDF---------
TRUB_RHORT      IRPLRVVNL-----------------------------
TRUB_RUEST      LHPSRVFNQD----------------------------
TRUB_RUEPO      LHPARVFARPE---------------------------
TRUB_ROSDO      LHPVRVINAPD---------------------------
TRUB_RHOS4      LHPSRVFNL-----------------------------
TRUB_RHOS1      LHPSRVFNL-----------------------------
TRUB_RHOS5      LHPTRVFNL-----------------------------
TRUB_DINSH      LHPTRVFQHGAL--------------------------
TRUB_JANSC      LHPERVFNL-----------------------------
TRUB_PARDP      VQPSRVFNLG----------------------------
TRUB_EHRRW      IKPVRVFNV-----------------------------
TRUB_EHRRG      IKPVRVFNV-----------------------------
TRUB_EHRCJ      VRPVRIFNVRGLVF------------------------
TRUB_EHRCR      VRPVRIFNV-----------------------------
TRUB_ANAMM      ARPVRVFDV-----------------------------
TRUB_ZYMMO      ARVLRGFNF-----------------------------
TRUB_RICB8      FHSLRVFNLTQ---------------------------
TRUB_RICBR      FHSLRVFNLTQ---------------------------
TRUB_RICRS      FNSLRVFNLTQDFF------------------------
TRUB_RICRO      FNSLRVFNLTQDFF------------------------
TRUB_RICCK      FNSLRVLNLTQ---------------------------
TRUB_RICAH      FNSLRVFNVL----------------------------
TRUB_RICTY      FNSLRVFNLL----------------------------
TRUB_BORAP      YKYVIIF-------------------------------
TRUB_BORBP      YKYVIIF-------------------------------
TRUB_BORBU      YKYVIIF-------------------------------
TRUB_TREPA      FSYDAVFCTE----------------------------
TRUB_TREDE      PKYETVIKN-----------------------------
TRUB_ARTS2      AKPVLVFAP---SNEQPGK-------------------
TRUB_PAEAT      AKPVLVFAPGTGTGTGTGQAK-----------------
TRUB_THEFY      SQPVVVFAGS----------------------------
TRUB_STRAW      AKSLAVFG------------------------------
TRUB_STRCO      AKSLAVFG------------------------------
TRUB_LEIXX      ARTLVNFPADEIA-------------------------
TRUB_CUTAK      SRAICVLV------------------------------
TRUB_CORGL      LATVFVAHPNTL--------------------------
TRUB_CORGB      LATVFVAHPNTL--------------------------
TRUB_COREF      LATVFVARPNTL--------------------------
TRUB_CORDI      LATIFVARPSTL--------------------------
TRUB_CORJK      ASSVFVARPAGMD-------------------------
TRUB_MYCTU      TRSVAVLRPATMHPG-----------------------
TRUB_MYCBP      TRSVAVLRPATMHPG-----------------------
TRUB_MYCBO      TRSVAVLRPATMHPG-----------------------
TRUB_MYCTA      TRSVAVLRPATMHPG-----------------------
TRUB_MYCA1      TRSVVVIRPATMQDGTS---------------------
TRUB_MYCPA      TKSVVVLRPATL--------------------------
TRUB_MYCLE      TKSVVVLHPVFVRVSIGRGIVGVIEA------------
TRUB_MYCUA      TKSVVVIRPATM--------------------------
TRUB_NOCFA      ASPVFVVRPRGLVD------------------------
TRUB_RHOJR      ASSVMVVRPATLR-------------------------
TRUB_BIFLO      AKPVTVFPLA----------------------------
TRUB_DEIRA      LKVVRAWA------------------------------
TRUB_DEIGD      LRVVRAWAGA----------------------------
TRUB_THET2      LKIRRVFAKEA---------------------------
TRUB_THET8      LKIRRVFAKEA---------------------------
TRUB_TROWT      LNSNAAQDASGST-------------------------
TRUB_TROW8      LNSNAAQDASGST-------------------------
TRUB_TRIV2      VLIPQMVFEPIS--------------------------
TRUB_NOSS1      VLIPQMVFEPIS--------------------------
TRUB_TRIEI      LLAPQVVISN----------------------------
TRUB_ACAM1      LLKPKVVLPAQ---------------------------
TRUB_SYNP6      LCKPKVVLAAL---------------------------
TRUB_SYNE7      LCKPKVVLAAL---------------------------
TRUB_GLOVI      SLQPLVVLPTL---------------------------
TRUB_THEEB      RLHPKVVLKE----------------------------
TRUB_SYNY3      VLRPKVVLN-----------------------------
TRUB_MICAN      YLQPKIVIQQ----------------------------
TRUB_PROMT      AIKPKVVFNAIG--------------------------
TRUB_PROM1      AIKPKVVFNAIG--------------------------
TRUB_PROMA      KIEPKIVFNADG--------------------------
TRUB_SYNPW      GLQPKVVFEARG--------------------------
TRUB_SYNPX      QLQPKVVFDASG--------------------------
TRUB_SYNS3      QLRPKVVFEARG--------------------------
TRUB_PROMM      TVKPKVVFNAQG--------------------------
TRUB_PROMP      ILHPKLVLNAK---------------------------
TRUB_PROM5      KLHPKLVLNAK---------------------------
TRUB_PROM0      NINPKLVLNAK---------------------------
TRUB_PROMS      NINPKLVLNAK---------------------------
TRUB_PROM9      NINPKLVLNAK---------------------------
TRUB_PROM2      KINPKLVLNAK---------------------------
TRUB_BACFN      --------------------------------------
TRUB_BACFR      --------------------------------------
TRUB_BACTN      --------------------------------------
TRUB_BACV8      --------------------------------------
TRUB_PARD8      --------------------------------------
TRUB_FLAJ1      --------------------------------------
TRUB_PELLD      --------------------------------------
TRUB_CHLPM      --------------------------------------
TRUB_CHLCH      --------------------------------------
TRUB_CHLTE      --------------------------------------
TRUB_RHOBA      GPWGELVAILRPHGKLWHPLRVFPTTESITLRG-----
TRUB_CUPMC      R-PERLVKL-----------------------------
TRUB_CUPPJ      R-PERLVRL-----------------------------
TRUB_RALSO      R-PERLVHL-----------------------------
TRUB_BURPS      A-PERLVVTGA---------------------------
TRUB_BURMA      A-PERLVVTGA---------------------------
TRUB_BURP1      A-PERLVVTGA---------------------------
TRUB_BURP0      A-PERLVVTGA---------------------------
TRUB_BURM7      A-PERLVVTGA---------------------------
TRUB_BURP6      A-PERLVVTGA---------------------------
TRUB_BURL3      A-PERLVVTAA---------------------------
TRUB_VEREI      L-PDRLLSALEIAQILASQPQRQDCGILEET-------
TRUB_DECAR      W-PKRLVQLAD---------------------------
TRUB_BORPE      --------------------------------------
TRUB_BORBR      --------------------------------------
TRUB_BORPA      --------------------------------------
TRUB_BORA1      --------------------------------------
TRUB_AROAE      LSPKRLVSTVATAQQS----------------------
TRUB_THIDA      LVPRRLIATVQA--------------------------
TRUB_CHRVO      LHPIRLLANQAQA-------------------------
TRUB_NEIMB      LKALRLMNTAASAA------------------------
TRUB_NEIG1      MKALRLMNTAASSA------------------------
TRUB_NEIMA      LKALRLMNTAASAA------------------------
TRUB_NITMU      S-PKRLIRFEQSL-------------------------
TRUB_NITEU      V-PRRMISLHEVVTGAIAGSVDLQ--------------
TRUB_PSEAB      IAPRRLIRS-----------------------------
TRUB_PSEAE      IAPRRLIRS-----------------------------
TRUB_PSEA7      IAPRRLIRS-----------------------------
TRUB_PSEF5      IAPRRLIRSE----------------------------
TRUB_PSEPF      IAPRRLIRSE----------------------------
TRUB_PSE14      IAPRRLIRSE----------------------------
TRUB_PSEU2      IAPRRLIRSE----------------------------
TRUB_PSEP1      IAPRRLIRSE----------------------------
TRUB_PSEPG      IAPRRLIRSE----------------------------
TRUB_PSEE4      IAPRRLIRSE----------------------------
TRUB_PSEMY      IAPRRLIYTGA---------------------------
TRUB_PSEU5      IAPRRLIRSE----------------------------
TRUB_COXBU      IAPRRLIQKR----------------------------
TRUB_COXBR      IAPRRLIQKR----------------------------
TRUB_COXBN      IAPRRLIQKR----------------------------
TRUB_NITOC      IAPRRLIFSQSG--------------------------
TRUB_METFK      IAPRRLLRQAGE--------------------------
TRUB_ACIAD      LVPKRLLNL-----------------------------
TRUB_MARMS      LVNTSEFSL-----------------------------
TRUB_LEGPC      IKAKRLVSFAL---------------------------
TRUB_LEGPA      IKAKRLVSFAL---------------------------
TRUB_LEGPH      IKAKRLVSFAL---------------------------
TRUB_LEGPL      IKAKRLVSFAL---------------------------
TRUB_MARHV      GTQLVPRRLVKNSKR-----------------------
TRUB_HAHCH      VKPVRLLNVSALSAE-----------------------
TRUB_SACD2      VAPKRLVSQS----------------------------
TRUB_XANAC      LSPQRLFNGLNEIPAC----------------------
TRUB_XANC5      LSPQRLFNGLNEIPAC----------------------
TRUB_XANOM      LSPQRLFNGLNEISVC----------------------
TRUB_XANOR      LSPQRLFNGLNEISVC----------------------
TRUB_XANCP      LSPQRLFNGLNAAAAC----------------------
TRUB_XANC8      LSPQRLFNGLNAAAAC----------------------
TRUB_XYLFA      LVPQRLFNL-----------------------------
TRUB_XYLFT      LVPQRLFNL-----------------------------
TRUB_METCA      LGAARPFWAH----------------------------
TRUB_SERP5      VAPRRLVVEYFD--------------------------
TRUB_PECAS      VAPRRLVVEFPV--------------------------
TRUB_ECOL5      VAPRRLVVEYPA--------------------------
TRUB_ECOL6      VAPRRLVVEYPA--------------------------
TRUB_ECOLI      VAPRRLVVEYPA--------------------------
TRUB_ECOHS      VAPRRLVVEYPA--------------------------
TRUB_ECOUT      VAPRRLVVEYPA--------------------------
TRUB_SHIF8      VAPRRLVVEYPA--------------------------
TRUB_SHISS      VAPRRLVVEYPA--------------------------
TRUB_ECOLC      VAPRRLVVEYPA--------------------------
TRUB_ECOK1      VAPRRLVVEYPA--------------------------
TRUB_ECO57      VAPRRLVVEYPA--------------------------
TRUB_ECO24      VAPRRLVVEYPA--------------------------
TRUB_SHIDS      VAPRRLVVEYPA--------------------------
TRUB_SHIFL      VAPRRLVVEYPA--------------------------
TRUB_SHIBS      VAPRRLVVEYPA--------------------------
TRUB_CITK8      VAPRRLVVEYPA--------------------------
TRUB_SALCH      VAPRRLVVEYPA--------------------------
TRUB_SALTY      VAPRRLVVEYPA--------------------------
TRUB_SALTI      VAPRRLVVEYPA--------------------------
TRUB_SALPA      VAPRRLVVEYPA--------------------------
TRUB_SALPB      VAPRRLVVDYPA--------------------------
TRUB_SALAR      VAPRRLVVEHPA--------------------------
TRUB_ENT38      VAPRRLVVEYPL--------------------------
TRUB_KLEP7      VAPRRLVVEYPA--------------------------
TRUB_CROS8      VAPRRLVVEYPV--------------------------
TRUB_YERPE      VAPKRLVVESVEVENLPVENKK----------------
TRUB_YERPA      VAPKRLVVESVEVENLPVENKK----------------
TRUB_YERPP      VAPKRLVVESVEVENLPVENKK----------------
TRUB_YERP3      VAPKRLVVESVEVENLPVENKK----------------
TRUB_YERPN      VAPKRLVVESVEVENLPVENKK----------------
TRUB_YERPS      VAPKRLVVESVEVENLPVENKK----------------
TRUB_YERE8      VAPKRLVVEHVDGANPVVAGVAAGNTP-----------
TRUB_YEREN      LHRNAWL-------------------------------
TRUB_PHOLL      VAPRRLVVESRD--------------------------
TRUB_SODGM      LTPRRLIAEPRA--------------------------
TRUB_VIBVU      IAPKRLVVFRDEE-------------------------
TRUB_VIBVY      IAPKRLVVFRDEE-------------------------
TRUB_VIBCB      VAPKRLVVFRDEE-------------------------
TRUB_VIBPA      IAPKRLVVFRDEE-------------------------
TRUB_VIBC3      VAPKRLVVYGE---------------------------
TRUB_VIBCH      VAPKRLVVYGE---------------------------
TRUB_ALIF1      VAPKRLVVFRDEEEK-----------------------
TRUB_PHOPR      VAPKRVMANKQDEA------------------------
TRUB_SHEHH      LAPKRLIVLREQQD------------------------
TRUB_SHEPA      LAPKRLIVLREPQD------------------------
TRUB_SHELP      LAPKRLVVLHDEQA------------------------
TRUB_SHEDO      LAPKRLIVIPAEESPE----------------------
TRUB_SHEFN      LAPKRLIVIHDNDAAE----------------------
TRUB_SHESR      LAPKRLVVIHDQAKAS----------------------
TRUB_SHESM      LAPKRLVVIHDQAKAS----------------------
TRUB_SHESA      LAPKRLVVLHDQAKAS----------------------
TRUB_SHESW      LAPKRLIVIHDEPIVTD---------------------
TRUB_SHEPC      LAPKRLIVIHDEPIVTD---------------------
TRUB_SHEB9      LAPKRLIVIHDEPAETD---------------------
TRUB_SHEB8      LAPKRLIVIHDEPAETD---------------------
TRUB_SHEB5      LAPKRLIVIHDEPAETD---------------------
TRUB_SHEAM      LAPKRLVVFYDDEA------------------------
TRUB_PSYIN      IAPTRLANL-----------------------------
TRUB_COLP3      VAPKRIVVLEQY--------------------------
TRUB_PSEA6      AAPKRVVVFTEQG-------------------------
TRUB_HAEIE      IRPQRLITQSA---------------------------
TRUB_HAEIG      IRPQRLITQSA---------------------------
TRUB_HAEI8      IRPQRLITQSA---------------------------
TRUB_HAEIN      INYTIRITSLPFL-------------------------
TRUB_MANSM      IRPSRMVNL-----------------------------
TRUB_PASMU      IRPQRLMTQNT---------------------------
TRUB_ACTP2      IRPSRMVNI-----------------------------
TRUB_HAEDU      IRPNRMVNL-----------------------------
TRUB_HAES1      VHPQRMVVIKPE--------------------------
TRUB_HISS2      VHPQRMVVIKPE--------------------------
TRUB_PSEHT      LKVKRGLASQQDDYVKPE--------------------
TRUB_IDILO      LWPRRVIAREHVDL------------------------
TRUB_BUCAI      LIPYRLVSRSIN--------------------------
TRUB_BUCAP      LIPYRLVSMLTN--------------------------
TRUB_BUCBP      LYSYRLII------------------------------
TRUB_BLOPB      --------------------------------------
TRUB_BLOFL      --------------------------------------
TRUB_WIGBR      ANSIKLIK------------------------------
TRUB_FRATT      LINKKFFDQDILISE-----------------------
TRUB_FRAT1      LINKKFFDQDILISE-----------------------
TRUB_FRATW      LINKKFFDQDILISE-----------------------
TRUB_FRATH      LINKKFFDQDILISE-----------------------
TRUB_FRATF      LINKKFFDQDILISE-----------------------
TRUB_FRATO      LINKKFFDQDILISE-----------------------
TRUB_FRATN      LINKKFFDQDILISE-----------------------
TRUB_FRAP2      LISKKFFDQDIFISE-----------------------
TRUB_PSYCK      LVHEIPIDIRLIDEQGAFIGLGAVSLNGRLQPKKLIQL
TRUB_PSYA2      LLHEIPVDIRLIDEHGTFIGLGAVSLNGRLQPKKLIQL
TRUB_HYDCU      LFNLNPIG----DDHS----------------------
TRUB_GEOSL      TKNLRLLRVFN---------------------------
TRUB_GEOMG      NKSLRLIRVFN---------------------------
TRUB_GEOUR      LKNLKLSRVFNLDNSFT---------------------
TRUB_PELCD      RGDFELLRVFNDGGSS----------------------
TRUB_DESAG      WTVLRGLWNT----------------------------
TRUB_DESVH      WAVLRGLWS-----------------------------
TRUB_DESPS      --------------------------------------
TRUB_SYNWW      LQPCRVFKINE---------------------------
TRUB_DEHMB      SPKPDAN-------------------------------
TRUB_DEHMC      SPKPDAN-------------------------------
TRUB_DEHM1      CPKKNAD-------------------------------
TRUB_CHLMU      --------------------------------------
TRUB_CHLTR      --------------------------------------
TRUB_CHLFF      --------------------------------------
TRUB_CHLAB      --------------------------------------
TRUB_CHLPN      --------------------------------------
TRUB_PARUW      --------------------------------------
TRUB_AQUAE      KRLLV---------------------------------
TRUB_SOLUE      PTVVM---------------------------------
TRUB_THEMA      LTLRKVFNTR----------------------------
TRUB_THEP1      LTLRKVFNTR----------------------------
TRUB_THEM4      FKLKKVFKEI----------------------------
TRUB_SYNAS      VRILRVFHDRA---------------------------
TRUB_CALS8      KYLLKVENYR----------------------------
TRUB_BDEBA      FVLRRVFKYS----------------------------
TRUB_CLOAB      FKIIKLLT------------------------------
TRUB_CLONN      LKIEKLLL------------------------------
TRUB_CLOBL      FKIHKLLT------------------------------
TRUB_CLOTE      FKIVKLLV------------------------------
TRUB_CLOPE      FKLEKLLIEE----------------------------
TRUB_CLOP1      FKLEKLLIEE----------------------------
TRUB_CLOPS      FKLEKLLIEE----------------------------
TRUB_CLOK5      FKMVKLFV------------------------------
TRUB_ALKOO      YIKILRLLFEKE--------------------------
TRUB_LACP7      YQPVKMFL------------------------------
TRUB_CLOD6      VKSDKMFI------------------------------
TRUB_FUSNN      LKGYKYY-------------------------------
TRUB_GEOTN      MKPLKVFR------------------------------
TRUB_GEOKA      --------------------------------------
TRUB_BACHK      LKPMKVLVNNQELKL-----------------------
TRUB_BACAH      LKPMKVLVNNQELKL-----------------------
TRUB_BACCZ      LKPMKVLVNNQELKL-----------------------
TRUB_BACAN      LKPMKVLVNNQELKL-----------------------
TRUB_BACC1      LKPMKVLVNNQELKL-----------------------
TRUB_BACCR      LKPMKVLVNNQELKL-----------------------
TRUB_BACCN      LKPMKVLVNNQELKL-----------------------
TRUB_BACVZ      LKPAKVLMQKSEQ-------------------------
TRUB_BACSU      LKPAKVLMQKSEQ-------------------------
TRUB_BACLD      LKPAKVLVQKSEQ-------------------------
TRUB_BACP2      MKPAKILSQDKQS-------------------------
TRUB_BACHD      VKPEKMLANDQQ--------------------------
TRUB_BACSK      IKPETLFCHV----------------------------
TRUB_OCEIH      IKPVRVFAIEDKKV------------------------
TRUB_LISMF      WKPEKVIELHQA--------------------------
TRUB_LISMO      WKPEKVIELNQA--------------------------
TRUB_LISIN      FKPEKVIELQQA--------------------------
TRUB_LISW6      WKPEKVIELNEA--------------------------
TRUB_STAEQ      IKPKKVFN------------------------------
TRUB_STAES      IKPKKVFN------------------------------
TRUB_STAAT      IKPKKVFN------------------------------
TRUB_STAA3      IKPKKVFN------------------------------
TRUB_STAA8      IKPKKVFN------------------------------
TRUB_STAAC      IKPKKVFN------------------------------
TRUB_STAAE      IKPKKVFN------------------------------
TRUB_STAAS      IKPKKVFN------------------------------
TRUB_STAAW      IKPKKVFN------------------------------
TRUB_STAAR      IKPKKVFN------------------------------
TRUB_STAA1      IKPKKVFN------------------------------
TRUB_STAA2      IKPKKVFN------------------------------
TRUB_STAAM      IKPKKVFN------------------------------
TRUB_STAAN      IKPKKVFN------------------------------
TRUB_STAA9      IKPKKVFN------------------------------
TRUB_STAAB      IKPKKVFN------------------------------
TRUB_STAHJ      IKPKKVFN------------------------------
TRUB_STAS1      IKPKKVFN------------------------------
TRUB_LACPL      YKPFKMFAVN----------------------------
TRUB_LACBA      YRPLKMFAVN----------------------------
TRUB_LACP3      YRPDLMFLANEKNV------------------------
TRUB_PEDPA      YIPKKMLLVR----------------------------
TRUB_LACSS      YRPYKMYLQNQGTH------------------------
TRUB_LACS1      YQSERMIDLS----------------------------
TRUB_LACRD      YKPTKMFAVN----------------------------
TRUB_STRR6      YKPRKVFS------------------------------
TRUB_STRP2      YKPRKVFS------------------------------
TRUB_STRPN      YKPRKVFS------------------------------
TRUB_STRGC      FKPRKVFL------------------------------
TRUB_STRSV      YKPRKVFL------------------------------
TRUB_STRT2      YKPRKVLSQ-----------------------------
TRUB_STRT1      YKPRKVLSQ-----------------------------
TRUB_STRA1      FKPHKVLL------------------------------
TRUB_STRA3      FKPHKVLL------------------------------
TRUB_STRA5      FKPHKVLL------------------------------
TRUB_STRMU      YKPKKVFL------------------------------
TRUB_STRP1      YKPKKVLI------------------------------
TRUB_STRP8      YKPKKVLI------------------------------
TRUB_STRPF      YKPKKVLI------------------------------
TRUB_STRP6      YKPKKVLI------------------------------
TRUB_STRPB      YKPKKVLI------------------------------
TRUB_STRPC      YKPKKVLI------------------------------
TRUB_STRP3      YKPKKVLI------------------------------
TRUB_STRPM      YKPKKVLI------------------------------
TRUB_STRPG      YKPKKVLI------------------------------
TRUB_STRPD      YKPKKVLI------------------------------
TRUB_LACLM      WKPNKVLV------------------------------
TRUB_LACLS      WKPNKVLV------------------------------
TRUB_LACLA      WKPNKVLV------------------------------
TRUB_LACDB      YCPDLMLLSNE---------------------------
TRUB_LACDA      YCPDLMLLSNE---------------------------
TRUB_LACGA      YRPEMMLLKNE---------------------------
TRUB_LACJO      YRPEMMLLKNE---------------------------
TRUB_LACAC      YRPSLMLLQNE---------------------------
TRUB_OENOB      YKPKKMLIHEDH--------------------------
TRUB_SYMTH      LRLRKVFG------------------------------
TRUB_MOOTA      LKPHKVLK------------------------------
TRUB_PELTS      FKPVCVLARQAGRSSN----------------------
TRUB_CARHZ      FRPEKVFRFGE---------------------------
TRUB_CALS4      IRPKRLF-------------------------------
TRUB_MYCMO      LIGKKIQKILGDKQSE----------------------
TRUB_MYCH2      LFGNRIKKIINT--------------------------
TRUB_MYCPU      IFNKKIEKSLKKDEKNE---------------------
TRUB_WOLSU      YLLNRMEKC-----------------------------
TRUB_HELHP      YILNRIEYVDTFKKTR----------------------
TRUB_SULNB      YRFNRIPKFEDTP-------------------------
TRUB_NITSB      YLLNQIPRKYQ---------------------------
TRUB_SULDN      YELGRIEC------------------------------
TRUB_CAMJJ      YLLNKVEKC-----------------------------
TRUB_CAMJ8      YLLNKVEKC-----------------------------
TRUB_CAMJE      YLLNKVEKC-----------------------------
TRUB_CAMJR      YLLNKVEKC-----------------------------
TRUB_CAMJD      YLLNKVEKC-----------------------------
TRUB_CAMC1      YTLNKVEKC-----------------------------
TRUB_CAMC5      YCLNKVEKC-----------------------------