CLUSTAL format seed alignment for MF_01086

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

Y038_PYRAB       ------------------------------------------------MESLFLLVLGNT
Y034_PYRHO       ---------------------------------------------MKKVKSLFLLVLGNT
Y303_PYRFU       ------------------------------------------------MKSLFLLVLGNT
Y2213_SACS2      ----------------------------------MIKAYFGAETFTLNKDFAYILVIGTT
Y2143_SULTO      ---------------------------------MSVKIFNGEFDIPENSRSLYILVIATT
Y372_PYRAE       ---------------------------------------------MKLEPQIMAIVIGTT
Y3887_METAC      ------------------------------------MAWIDPEVTKKPKKPMFLCVLSNT
Y708_METMA       ------------------------------------MAWIEPEVTEKPKKPMFLCVLSST
Y1572_HALSA      --------------------------------------------MSGTPDTLFALAAGAT
Y224_METKA       ---------MPNANQASAGVGALKEVLPGIRALGDLEAAEKVVKRCSGGSTVMVCVIGST
Y1426_METTH      -----------------------MEMFDGLKIYGSGNYLEGVTDRDS----LFICAVATT
Y078_THEAC       -----------------------------MIIDDVIIGKGIGDIEFSRENTIFVLIAGTT
Y153_THEVO       -------------------------------MEDIIFGKRSNVFDVNPENTVFVLIAGTS
Y276_ARCFU       -------------------------------MTLKFVKGESDNLELAKGRAAFVLVIGNT
Y2029_AERPE      ---------------------------MGVSDVFAVSGALEVVLEGVAGKGVMAVVYGST
Y1598_METJA      ---------------------------------MSIIAINENGFLDKIKGRNPLFTCVIS
Y297_NOSS1       --------------------------MIRIYTQLEQGEAWLRRYSD--RLPLFTCILGFT
Y1500_SYNY3      --------------------------MLTVYTQSDQALSWIERHGH--CPPVFVCVLGFT
Y2306_THEEB      -----------------MVGNCQSVPMIGVATGAAIAGAWSDRHRQPPTFPALVCVLGFT
Y1350_PROMM      MASLPCIPSNFKPGSPPRGLPLACKAFGAGASL-AAQERWLMPWRDGGLGFSLLLVLAGT
Y1869_SYNPX      --MLPLTLSDLE------GLPLGCSIVGSRCSR-QQLQAHLEPWCQGDSSFDLLLLLAAT
Y435_PROMA       MNQFESTQSNIFSLR----SSDRCNVFGSSSSSPSLLNRWIDIWSTSISDITSILVLAGT
Y439_PROMP       ------MQKSYL----------GIKLFGSKGNQ-KLFFEKVDALQKEINNFIFYLVIAGT
                                                                            :

Y038_PYRAB       EISTIPGISVAGATPELTKITPVADAEYLFHEKPLTIDAIPVTPE---GHPTPAIITKAA
Y034_PYRHO       EISTIPGISVAGATPELTKITPVADAEYLFYEKPLTIDTIPVTPE---GHPTPAIITKAA
Y303_PYRFU       EVSLIPGISVAGATPELTKYTPPADAEYLFYDKPKIIDAIPVTPE---GHPTPAIITKAA
Y2213_SACS2      DVSLIPGLTIAGATPELTHFTPAADAEYVILGKCKSINTIPVSPT---GIPTPALLTRAS
Y2143_SULTO      DISLIPGLTVAGATPELTHFTPAADAEFLIKGKCSVINTVPVTPN---GIPTPAIITRAS
Y372_PYRAE       DISLIPGISVAGASPELTHYTPALDVEYLLLGMPKTMEVIPVTPE---GIPTPALVTRAV
Y3887_METAC      KTAHIPKLSAAGKTAELTDYTPAGDAELIETGNIISVPVLPMTPPY--DTPTPAIMTRSA
Y708_METMA       KTAHIPKLSAAGKTAELTDYTPAGDAELMETGNIISVPVLPMTPPY--DTPTPAIMTRSA
Y1572_HALSA      RTAAIEGISAAGADPALMAHTPSADAELLTYGHTVRAPVVPVSPS---GCPTPAVITRAV
Y224_METKA       EISRVPGISAAGKTPESTFHTPAGDVELIYYDRIINAEEVPQNPV---GAPSPAVITKAV
Y1426_METTH      ETSRIPGITGAGASPELTEYTPAADVELIVHDAPRCLPEIPQTIVEGEAAPTPAVITKAA
Y078_THEAC       EVSLRSGITAAGASPEFTRITPTVDAEIIGEGKCLSTADPPMTPE---GIPTPAIVSRAI
Y153_THEVO       EVSTVPGITSAGATPELTRLTPAIDSEIIGEGKCLSSKDPPMTPE---GIPTPAIVTKAI
Y276_ARCFU       KTANIEGITVAGANPELIKYTPPADAELLYHGKCLSIDGVPATPD---GKPTPALITYTA
Y2029_AERPE      RTSTIPGISIAGPSPEATLYTPTLDIEYLVAGRPLTLDVVPVSPE---GVPTPAVITRAV
Y1598_METJA      SIETTLSIPISGVHRDVIKYTPSADVELVFYGKSLTLKTPPIDAT---GSPTPATITRAC
Y297_NOSS1       ETGLIPGISAAGRTPEDRKYTACADAEFLYYG-AEHQPQYPLPPLT--AGASPVLISRAV
Y1500_SYNY3      ETGLIPGISAAGKTPADRKLTAIADAEFLIKG-TTAGATYPLPPLI--SGVSPVFITKAL
Y2306_THEEB      ETALIPGISAAGQTPSDRQITALADGEFLLRG-IQPQYHYALPPLT--AGASPALISRAL
Y1350_PROMM      RTAEVEGISAAGATSAARRFTAVADAELLLKG-PDRPRLCSLPPLP--AGISPALISYVA
Y1869_SYNPX      RTAEREGISAAGATAASRRLTALADADLLLHG-PGKPRRWPLPPLP--AGVSPALLSHVA
Y435_PROMA       KTAEIEGISAAGATKESRRFTAVADAEFLLHG-PTASRRWPLPPLS--AGVSPALISYVA
Y439_PROMP       ETSQIQGISAAGIDSKARRRTALADAEFLLFG-AYKDHKYKLPFLN--SGVTPALISYVC
                        :. :*        *.  * : :                      :*. ::   

Y038_PYRAB       KELADFPIIVIRGGTYLAPLVPHVHISDV---VGRDFRKE--IALPEFGEIIKRAKLFGE
Y034_PYRHO       RELSNFPILVVRGGTYLAPLIPHVHISNV---VGRDFRRE--PALPEVEVIIERAKLLGK
Y303_PYRFU       RELANFPILVVRGGTYLAPKVPHVHISSI---VGRDFRRE--PALPEAGEIIERAKLLGQ
Y2213_SACS2      LSFTKSLKIVVNAGSRITPKIPYIDLQGE---PGKDIRKQ-ALSIEKVNIIIENGIKLGE
Y2143_SULTO      LEFVKIPRLVVNAGSRIKPNLPLIDLGGE---PGGDIRKG-SLRKEVAERILNNGVSLGE
Y372_PYRAE       AG--EVAKLVVNAGSRITPKVPYVDLGGE---PGRDFRRGPALSCEAARNILERGRALGC
Y3887_METAC      LKLTEAPYHFINSGLIVTPEVPCIDLKAK---PGEDIREPIAVRDV--QGIYERAKFLAK
Y708_METMA       LKLTDAPYHFINSGLIVTPDVPCIDLKAN---PGEDIREPVAVMDV--QGIYERAKLLAK
Y1572_HALSA      RELVGFESLVIDAGLAEPTGAPTVTTGIS---PGADIRDETPVPDA--EAAYSAAYEFGH
Y224_METKA       VNLASIPFLTVDAGAAVKPACPYIDLGGE---VARDFREGPALSEETYDRLLEFGKTLGK
Y1426_METTH      LELAEVPFMVADAGASVKPDVPYININSE---PGGDIRTGRAVTEP--QRIYERGLMVGR
Y078_THEAC       LDLTGLRSLIVNGGFSVRPKTAFFETYIE---PSRDPGLDRAV--MEAERVMEAGRRLGK
Y153_THEVO       LSLTNIRYIIVNGGFYAKPKTPFIETGLK---PSNNPAVKTAI--EDLDAAIHAGEHIGR
Y276_ARCFU       LRLTSIPLFVVNSGLMVPPKIPYIDLNAP---VGENIAESRAMDREKVEEVLERAKIVGR
Y2029_AERPE      ARAFNIPLLPVDAGSWTEARVPHAKLPSRV--TGGRIDVEPGLPSGASERLFREAYMLGS
Y1598_METJA      VELKNIKNLHIDAGAFVKPKIPFIEIDEK---PTGRIEEGKAMNNS--KELYMKGYLLGK
Y297_NOSS1       VEAFNMPVYLFNAGLPQSPAIPAIDLGGC---PAKCLSTGAAMELTTVEHLFKQGLLWGE
Y1500_SYNY3      VDALHTPVYLFNSGLPIPPAVPVINLDGQ---PARCLSTGQALPLALVEHLFQQGLQWGA
Y2306_THEEB      IEALALPLYVFDAGLPLPRLPEMIDLGGT---PARCLTTGQAMTPQMVAHLWEQGWSWGA
Y1350_PROMM      ARWIGVDPLVAAVGLTLSPPFPHLRLEVPGMGPAACLSTGEAMGLSRVHALWQRGFCLGR
Y1869_SYNPX      LQRLPMQPLVAALGLEHEATFPHLRLESPQAGPARCLSTGRAMDPERVERLWRKGMRLGA
Y435_PROMA       SDLIGVKSLIAQAGILQTPSFPCLSIESPSQGPSECITTGKAMDINRVENLFEEGMKMGL
Y439_PROMP       KKLICASQIVVPIGIKEKPYFSHLTVENYLAGPAKCLTTGKSMNKERVLSLYKKGLEIGK
                              *                                        .   . 

Y038_PYRAB       ELNKLPI-KELVIGESTPGGTTTAQAVLWALGYEA--RTSSASPNNPQELKERVIMEGFN
Y034_PYRHO       ELEKIA--NEIVIGESTPGGTTTAQAILWALGYEA--KTSSASPENPQELKEKVIKEGFK
Y303_PYRFU       ELERSGI-EELVIGESTPGGTTTAQAILWALGYEG--KTSSASPNNPQELKRRVIEEGFR
Y2213_SACS2      ELSNE-Y-ELIMIGESIPAGTTTAMATLLALGYDAMDKVSSASPDNPKELKRKVVEEALR
Y2143_SULTO      EFSNS-F-DFLIIGESIPAGTTTAMAVLVGLGYDALDKVSSASPENPKELKKKIVYEAIK
Y372_PYRAE       ELGR--L-GCIYIGESIPGGTTTAMAILVAMGYDAWGRTSSASPNNPKELKIAVVKEGLR
Y3887_METAC      RLRSQ-I-DHVVIGESIPGGTTTAMGVLNALGYNG--NVSSSADENPLELKKQVVEEGMK
Y708_METMA       RLRNQ-A-DHVVIGESIPGGTTTAMGVLMALGYNG--NVSSSADENPLELKKQVVEEGMK
Y1572_HALSA      GLHT----DELVIAETIPGGTTTAMGVLAALGEPR--IVSSSLPNNPVALKERVVDDALA
Y224_METKA       ELTRD-V-DFLTVGESVPGGTTTAMAVMTALGYETSEKFASSSHDSPHDIKERVVKEGLE
Y1426_METTH      TLSSL-T-EHLVVGESTPAGTTTALGVLTALGYDADFRVSASMPHNPHDLKREVVMAGLS
Y078_THEAC       ILDGN-F-KNIILGESFPGGTTTAYVVLRSLGIDS--GTSSSMPVDPDNLKKKVAEESFR
Y153_THEVO       LLDGV-F-ENIILAESVPGGTTTAYAVLKAIGINA--KTSSSMKEDPFSIKEKIAEMSFR
Y276_ARCFU       QLSKL-S-DVLIIGESIPAGTTTAAAVLKALGLNA--AVSSSMPENPVELKRKVVERAVE
Y2029_AERPE      SLARG-L-DWIAVGESIPGGTTVAAAVMEALGYRAADLVSSSGKDNPRELKKRVVAQALS
Y1598_METJA      NLDAE----LLIVGESVPGGTTTALGVLLGLGYDAEGKVSSGSINNPHELKIKVVREGLK
Y297_NOSS1       RLAAEVPEGYVILSECVVGGTTTALAMLTGLGINAAGKVNSSHPVCNHEQKWQLVQQGLE
Y1500_SYNY3      QLAQEHAESYLVLSECVVGGTTTALGVLLGLGIDAGGKVNSSHPHCNHQQKLALVRQSLE
Y2306_THEEB      KLSSQYP--WLIIAECVVGGTTTALALCESLGIPARDCVGSSHRQSNHTQKWSLVQKGLA
Y1350_PROMM      GLRRPLV-----LAECVPGGTTTAQAVLTGLGLQVADLISGSARQAPMILKQELVDRGLS
Y1869_SYNPX      QLRRPLL-----LAECVPGGTTTAQAVLKALGVPVNGLISGSARQPPQELKRHLVEQGLC
Y435_PROMA       ELASPLL-----LTECVPGGTTTALAVLTGLGITASELISGSSRTPPMTLKKKIVEKGLQ
Y439_PROMP       STKQPIF-----ISESVPGGTTTAQAVMEAFGLNVNNLIGSSLINAPRALKTKVIKAGLL
                             : *   .***.*     .:*        ..        *  :   .. 

Y038_PYRAB       RAGIEKGQ--------LSEKPLEALRQFGDPMIATVVGLSLGFR---KDIVLAGGTQMLA
Y034_PYRHO       RVGIEKGG--------LKDKPLEALKEFGDPMIATVLGLSLGFG---GDVVLAGGTQMLA
Y303_PYRFU       RAGIEFGG--------LKGNSLEALRQFGDPMMATVVGLSLGFK---GDVVLAGGTQMLA
Y2213_SACS2      NL---------------PTDPLQRLAKVSDPVLLGVAGISLGFR---GKILLAGGTQMTA
Y2143_SULTO      DL---------------PSDLMGKLAKLSDPMLLGVSGIALGFK---GKILLAGGTQMTA
Y372_PYRAE       RVSA-------------PLKPLEAVCEMGDPVHLAVAAIALGVSECGGVPVLAGGTQMAA
Y3887_METAC      ASGLTFGS--------LKDEPMKAIACMGDPMMPAVIGLVAGFQGTEVDVVLAGGTQMAA
Y708_METMA       ASGLTFGC--------LKDDPMKAIACMGDPMMPAVAGLVAGFQDTDTSVVLAGGTQMAA
Y1572_HALSA      ASGLEQGD--------LAGEPVAAVRQMGDPVLAVVAGLAAGALDAGIDVTLAGGTQLAT
Y224_METKA       AQGVEPGD--------L--DAHEAIRRFGDPMMPAVVGIIYG---SRTPVLLAGGTQMAP
Y1426_METTH      NAGIEKGD--------CSREPFRAVEAVGDPMIPAVAGICMG---STVPVTLAGGTQMTA
Y078_THEAC       RRNV--------------RSPLEAATEYGDNLMIFMIGLAESI--RSSKMILGGGTQMAN
Y153_THEVO       RKLE--------------KSPLGAVKEYGDNMMAVSLGISSSV--KRSKIIFGGGTQMAT
Y276_ARCFU       RVES--------------NDPIEVLSAVGDPVMVGVAGIALGS--EKP-VILAGGTQMVA
Y2029_AERPE      RLRECG-----------ARDVLEIVDCVGDPVHVSIAGLAVGAREAGAFVILAGGTQMGA
Y1598_METJA      KAGINE-----------KSSVFDVLNAVGDKMMPVVAGLAISFAERNKPVILAGGTQMSA
Y297_NOSS1       AGKEAGGQGVGCRGDKSPIDPLKLVAAVGDPMQVVVAGMAIAASR-GCGVMLAGGTQMLA
Y1500_SYNY3      HHSPH-------------LNAMEVVAAVGDPMQMVVAGMAIAASH-STGVMLAGGTQMLA
Y2306_THEEB      HLPPQ-------------ADPFTCVAAIGDPMQVVVAAMALRASQ-TCGVLLAGGSQMIA
Y1350_PROMM      KAALGFN-----------PPPQRVIAALGDPFQPVAVGLLLGAREAGQPVMLGGGSQMVA
Y1869_SYNPX      RAQLPAW-----------PSPQAVLAAVGDPFQAVAAGVLVSAQ---QPVLLGGGSQMAA
Y435_PROMA       SLSLGAK-----------PCPKELLAAVGDPFQPFAVGLLLGARKVKQPVLLGGGSQMLA
Y439_PROMP       KANLKNN-----------FDSLDVISSVGDPFQAFSLGLLIGARLAKQSVVLSGGSQMLA
                                             .* .     .:            :.**:*:  

Y038_PYRAB       VSAILKALG-ED-----MKRFMIATTRWVVNDRSATFVETAREIGII------------T
Y034_PYRHO       VSALLKSLG-ED-----LSRFMIATTRWVVEDPSATFIETAREIGII------------S
Y303_PYRFU       VAAILKGLG-ED-----LSRFMIATTRWVVEDKSATFIKTAREIGII------------S
Y2213_SACS2      AAAIVNEFDKSK-----LKDIIIGTTKWIVEDKSADMLSLAKQVGVK------------V
Y2143_SULTO      AAAIIKEFNKNK-----LKDIAIGTTKWIINDRSSDIIGLAKAVGIP------------I
Y372_PYRAE       AAALYKGLG-GD-----LAKLHVATTRWIAEDKSADFMGLMEIVGVKN-----------V
Y3887_METAC      VYAIIKH--LGFN----TEKLAIATTRYVVEDKSAHFVELTKTLEVPV-----------V
Y708_METMA       VYALIKH--MGLN----TEKIAIATTRYVVEDKSANFIQLTTTLGVPV-----------V
Y1572_HALSA      AGALVRH--DGV-----TEPMTLATTSFVAGDDSAGIDALAADQDLAV-----------T
Y224_METKA       ILAYLAE-EGQLD----PERVFVGTTKYVVEDEDSDIESLFRQVGDYV-----------L
Y1426_METTH      VCALMRAIDPDFD----FSDTAIATTIFVAEDSTSDINRIAEQIGDID-----------I
Y078_THEAC       AANLIAKVN---G----RTDQVVATTQWVFSHRSDLFRILGLEDRSII-----------S
Y153_THEVO       VMYLDRLIN---G----MRDRYISTTGWVYYHRTELFSDLGLSDYLAV-----------S
Y276_ARCFU       IANLIARM----G----EVEAVIATTKYVASDATADLSLSPFP--VIA-----------S
Y2029_AERPE      VLAILSRLGMLD-----PRSTAVATTKWIALDRGSSIRGIVESIAPGL-----------T
Y1598_METJA      VLAVIKEINKKVLD---KNLIAIGTTEFVLNDKKGDLKGIVEQIGNVP-----------V
Y297_NOSS1       VYALASAIAETYNLSWQPTAVVVATTRWVAEDSTGGTVEL--ALNIGKNSQYPQIMTPPL
Y1500_SYNY3      VYALIQALTRQQNLAVDFSRLVVGTTKWVCEDASGDTVGL--ANLLAPVS---------L
Y2306_THEEB      VYAFGRAIAQWRQLPWRPEQIVVGTTRWLIEDQTAQIHRL--AERV----------QCPL
Y1350_PROMM      VLALALAAMEPSHRQDMVDGIVLGTTSWLAEEAKRSDGRPGALECLIDCVGEFFGVRLLG
Y1869_SYNPX      VATLALASLPDQERKVLADRVLLGSTAWLALEWIRGGDMP-ALGCLLDEVGHRFGVSLAG
Y435_PROMA       VLATALASIDSSLKDDFVEDISIGTTYWLANESLSLSIGQSAFQSLIKLVEDSFEVSLLG
Y439_PROMP       VILLALEFIDSTEKQEFIDLVFIATTGWLVKDN--------SLGDLLDLITEKHNVNLLG
                                       :.:* ::  .                            

Y038_PYRAB       YSADLDFS-NSKFKGLRDYERGYVKEGVGAGGATWLAVKS---GFSPEDVSEKVEELYER
Y034_PYRHO       YVAELDFS-KSKFKGLRDYERGYVKEGVGAGGATWLAVKA---GYSPEDVSKKVEELYER
Y303_PYRFU       YAADLDFS-KSEFKGLRDYEKGYVKEGVGAGGATWLAVKA---GFSPEDVVRKVEELYRK
Y2213_SACS2      LASMLDLS-ISIHEGIRTYEKGYVKEGVGAGGSTIMAFIR---GVSNSTLVRKIDELYSE
Y2143_SULTO      LAAWLDFT-NSKFEGLKVYEKGFVKEGVGAGGASIYAMKR---GVTNEQILGKVEEIYQR
Y372_PYRAE       YIAGVSFA-GSKYEGLRAYERGAVKEGVAMGGALFYALSK---GKDVLRLVEAEYERLLS
Y3887_METAC      YIADPGFG-KSSLKGLHRYETGTIKEGAGAGGAMYLAGLF---GVTQDEFRSEVENVCKL
Y708_METMA       YVADPGFG-KSSMKGLHRYETGTIKEGAGAGGAMYLAGLF---GITQDQFRTEVENVCKL
Y1572_HALSA      -VTDPAFEARESHPAMAAYLDGEAKEGVGMGGALALAAEA---GIGMDSVRNAIISVYDR
Y224_METKA       FSADPGFS-ESKFRGFRLYEEGYVKEGVGAGGAQVAAALKTKGEITPKDVLRECERVYER
Y1426_METTH      YVVDPDFG-SASHRGLHEYLNGSVKEGVGAGGAMLLALLH---GIPVEMVRERIEELCNT
Y078_THEAC       VMDFGRMR----NNGLRLYNQGHVREGVGMGALYSYARIA---GFSREEIESAIDDFYTT
Y153_THEVO       AMDFSGMK----HPGLRYYQYGHVREGTGMGAAFLLARLM---NFEAEAIYKSVDDFYEQ
Y276_ARCFU       DPMLGKSR----YPGLRAYEEGFVKEGVGAGGMTSVAYAR---GITPEKFLEEVEKDYER
Y2029_AERPE      VAAAGFSLEGSRYRGLRMYEEGYAKEGVGAGGSLVISLLR---GAGVREILEAVESEYGR
Y1598_METJA      LASKFYFE-KAKIEGLKNYCKGSVKEGVGAGGIAVYSIVN---DLEPTKIREFIENKFYE
Y297_NOSS1       LATKLSFA-NSQYPQLQAYEQGFVKEGVGAGAACIAANLY--KNWQQHQLLQAIENQIQR
Y1500_SYNY3      LAPQLSFS-SSVYPQLQVYEQGFVKEGVGAGAMAIAAHLY--KNWGQEQLLELIENLITR
Y2306_THEEB      IYTQLDFS-LSRHPALRAYEQGFVKEGVGAGGCAIAGHLL--AGWRNSEMVDIVDRLADR
Y1350_PROMM      LATGLRFN-NSQHRALQDYELGYVKEGVGAGALALLAQL---QGASCEQLLEACDQAMNQ
Y1869_SYNPX      LASGLRFH-ASRQPALRDYEDGFVKEGVGAGALLLLAQL---QGQHSEALVEGCERALDQ
Y435_PROMA       LSAGLRFT-KSSKQVLRDYEIGYVKEGVGAGAFVLLAQN---NGVSCKKLIEECEFAVDQ
Y439_PROMP       LASPLNFK-SSKFKELSDYEIGYVKEGVGAGGMSILAFL---KGFSNEEIVSSCQVNLER
                                :  *  *  :**.. *.    .            .          

Y038_PYRAB       LMRMKSLT-----
Y034_PYRHO       LMGLR--------
Y303_PYRFU       LIS----------
Y2213_SACS2      LVGSNNLNT----
Y2143_SULTO      IT--TNLM-----
Y372_PYRAE       AGVAGNVN-----
Y3887_METAC      LKAGQ--------
Y708_METMA       LKAGH--------
Y1572_HALSA      V------------
Y224_METKA       WMDKF--------
Y1426_METTH      ILA----------
Y078_THEAC       FLR----------
Y153_THEVO       FI-----------
Y276_ARCFU       IVL----------
Y2029_AERPE      LLGG---------
Y1598_METJA      WYKE---------
Y297_NOSS1       LLDR---------
Y1500_SYNY3      ELGQVKEKKQQ--
Y2306_THEEB      WAKGM--------
Y1350_PROMM      LLGTSYS------
Y1869_SYNPX      LLASAVASEV---
Y435_PROMA       LDKI---------
Y439_PROMP       MKDLGQISINKDC