CLUSTAL format seed alignment for MF_01100

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

5DNU_VIBCH      MQESHFFAHLARMKLIQRWPLMRSISSENISEHSLQVAFVAHALAVIKNKKFGGTLNPER
5DNU_VIBTL      MKQSHFFAHLARMKLIQRWPLMRSVSSENISEHSLQVAFVAHALALIKNKKFDGKLNPEH
5DNU_PECAS      MNQSHFFAHLSRLKLISRWPLMRNVRTENVSEHSLQVAFVAHALAVIKNRKFEGNLNTER
5DNU_PECCP      MNQSHFFAHLSRLKLISRWPLMRNVRTENVSEHSLQVAFVAHALAVIKNRKFEGNLNAER
5DNU_PHOLL      --MSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAFVAHALAIIKNRKFGGNVNAER
5DNU_PHOTE      --MSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAFVAHALAIIKNRKFSGNVNAER
5DNU_YERPB      --MSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAFVAHALAIIKNRKFNGNLNAER
5DNU_YERP3      --MSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAFVAHALAIIKNRKFNGNLNAER
5DNU_YERPY      --MSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAFVAHALAIIKNRKFNGNLNAER
5DNU_YERPE      --MSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAFVAHALAIIKNRKFNGNLNAER
5DNU_YERPP      --MSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAFVAHALAIIKNRKFNGNLNAER
5DNU_YERPG      --MSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAFVAHALAIIKNRKFNGNLNAER
5DNU_YERPA      --MSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAFVAHALAIIKNRKFNGNLNAER
5DNU_YERPN      --MSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAFVAHALAIIKNRKFNGNLNAER
5DNU_YERPS      --MSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAFVAHALAIIKNRKFNGNLNAER
5DNU_YERE8      --MSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAFVAHALAIIKNRKFNGNLNADR
5DNU_SALA4      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALCH      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALDC      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALEP      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALG2      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALHS      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALNS      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALPA      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALPK      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALPB      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALPC      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALSV      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALTY      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALTI      MKQSHFFAHLSRMKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAER
5DNU_SALAR      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQLNAEH
5DNU_CITK8      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQVNAER
5DNU_ECO7I      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECOHS      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECO5E      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECOLU      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECO57      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECO8A      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECOSE      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECOSM      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECO55      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECOLC      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECO24      MKQSHFFAHLSRLKLINRWPLMRNVLTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_SHIB3      MKQSHFFAHLSRLKLINRWPLMRNVLTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECOBW      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECODH      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECOLI      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_SHIFL      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_SHIF8      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_SHISS      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECOUT      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECO81      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECOK1      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECO45      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECOL6      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECOL5      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_ECO27      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_SHIDS      MKQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGNVNAER
5DNU_KLEP3      MSQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQVNAER
5DNU_KLEP7      MSQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFGGQVNAER
5DNU_ENT38      MSQSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAAIKNRKFNGNVNAER
5DNU_CROS8      MSQSHFFAYLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALAVIKNRKFQGNVNPER
5DNU_ERWT9      MIHSHFFAHLSRLKLINRWPLMRNVRTENVSEHSLQVAMVAHALALIKNARFAGNLNPER
5DNU_SHEON      --MSHLFAHLARMKLIQRWPLMYNVRTENVQEHSLQVAMVAHALVIISNRKFGTTLDAHQ
5DNU_PASMU      MKISHFFACLDRLRLIQRWSLMRNIEKENLAEHSLQVAFVAHALAVIKNKFYQGHLNPDR
5DNU_PHOPR      MEKSHFFAHLARMNLIQRWPLMRSVSTENISEHSLQVAFVAHALALIKNKKFDGNTNPER
5DNU_VIBPA      MKESHFFAHLARMKLIQRWPLMRSVSPENVSEHSLQVAFVAHALALIKNKKFGGTLNPER
5DNU_VIBVY      MQESHFFAHLARMKLIQRWPLMRSVSSENVSEHSLQVAFVAHALALIKNKKFGGHINAER
5DNU_VIBVU      --------------MLQTTLKYRNRCNICVREYKCCIGSFMSRFGLS-NMALTHYLTSII
                              ::.      .     : *:.  :. .   :    *        .  

5DNU_VIBCH      IALLAMYHDTSEVLTGDLPTPIKYFNPEIAKEYKKIEAAAERRLLDMLPEELRDDFRPFL
5DNU_VIBTL      IALLGMYHDTSEVLTGDLPTPVKYYNPDIAQEYKKIEAAAEQRLLSMLPEEFRDDFSPFL
5DNU_PECAS      IALLAMYHDASEVLTGDMPTPIKYYNAQIAHEYKKIEKIAQQKLIEMLPEELQQDYRMLL
5DNU_PECCP      IALLAMYHDASEVLTGDMPTPIKYYNAQIAHEYKKIEKIAQQKLVEMLPEELQQDYRMLL
5DNU_PHOLL      IALLAMYHDASEVITGDLPTPVKYHNPHIAREYKKIEKIAQKKLLEMLPTELQEDFRPIL
5DNU_PHOTE      IALLAMYHDASEVITGDLPTPIKYHNPHIAREYKKIEKIAQKKLLEMLPAELQEDFRPIL
5DNU_YERPB      IALLAMYHDASEVITGDLPTPIKYHNPKIAHEYKKIEKVAQQKLIEMLPKELQHDFRCLL
5DNU_YERP3      IALLAMYHDASEVITGDLPTPIKYHNPKIAHEYKKIEKVAQQKLIEMLPKELQHDFRCLL
5DNU_YERPY      IALLAMYHDASEVITGDLPTPIKYHNPKIAHEYKKIEKVAQQKLIEMLPKELQHDFRCLL
5DNU_YERPE      IALLAMYHDASEVITGDLPTPIKYHNPKIAHEYKKIEKVAQQKLIEMLPKELQHDFRCLL
5DNU_YERPP      IALLAMYHDASEVITGDLPTPIKYHNPKIAHEYKKIEKVAQQKLIEMLPKELQHDFRCLL
5DNU_YERPG      IALLAMYHDASEVITGDLPTPIKYHNPKIAHEYKKIEKVAQQKLIEMLPKELQHDFRCLL
5DNU_YERPA      IALLAMYHDASEVITGDLPTPIKYHNPKIAHEYKKIEKVAQQKLIEMLPKELQHDFRCLL
5DNU_YERPN      IALLAMYHDASEVITGDLPTPIKYHNPKIAHEYKKIEKVAQQKLIEMLPKELQHDFRCLL
5DNU_YERPS      IALLAMYHDASEVITGDLPTPIKYHNPKIAHEYKKIEKVAQQKLIEMLPKELQHDFRCLL
5DNU_YERE8      IALLAMYHDASEVITGDLPTPIKYYNPQIAHEYKKIEKVAQQKLIEMLPEELQHDFRCLL
5DNU_SALA4      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_SALCH      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_SALDC      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_SALEP      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_SALG2      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_SALHS      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_SALNS      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_SALPA      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_SALPK      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_SALPB      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_SALPC      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_SALSV      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_SALTY      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_SALTI      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELHDIFAPLI
5DNU_SALAR      IALLAMYHDTSEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMAPDELRDIFAPLI
5DNU_CITK8      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPDELRDIFAPLI
5DNU_ECO7I      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_ECOHS      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_ECO5E      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_ECOLU      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_ECO57      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_ECO8A      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_ECOSE      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_ECOSM      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_ECO55      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_ECOLC      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_ECO24      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_SHIB3      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_ECOBW      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_ECODH      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_ECOLI      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_SHIFL      IALLAMYHDASEVLTGDLPTPVKYFNAQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_SHIF8      IALLAMYHDASEVLTGDLPTPVKYFNAQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_SHISS      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVNMVPEELRDIFAPLI
5DNU_ECOUT      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELQDIFAPLI
5DNU_ECO81      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELQDIFAPLI
5DNU_ECOK1      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELQDIFAPLI
5DNU_ECO45      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELQDIFAPLI
5DNU_ECOL6      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELQDIFAPLI
5DNU_ECOL5      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELQDIFAPLI
5DNU_ECO27      IALLAMYHDASEVLTGDLPTPVKYFNSQIAKEYKAIEKIAQQKLVDMVPEELQDIFAPLI
5DNU_SHIDS      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAPLI
5DNU_KLEP3      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPDELRDIFEPLI
5DNU_KLEP7      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPDELRDIFEPLI
5DNU_ENT38      IALLAMYHDASEVLTGDLPTPVKYFNSQIAQEYKAIEKIAQQKLVDMVPEELRDIFAALI
5DNU_CROS8      IALLAMYHDASEVLTGDLPTPVKYFNSQIAHEYKAIEKIAQQKLIAMVPEELQDIFAPLL
5DNU_ERWT9      IALMAVYHDASEVLTGDLPTPVKYYNAQIAHEYKKIEKIAQHKLIEMLPEELRSAYAPLI
5DNU_SHEON      ATSLAIFHDASEILTGDLPTPVKYFNKEIEAEYKKIEAIAEQRMLDMVPDEFKEDYRSLF
5DNU_PASMU      IAVMAMYHDTSEIFTGDLPTPIKYFNPKITQAYKEIENAAEAHLLALLPKELQADFAPYL
5DNU_PHOPR      IALLGMFHDTSEVLTGDMPTPIKYYNPAIAEEYKKIELAAEQKLLSMLPEEFQEDYAPLL
5DNU_VIBPA      IALLAMYHDSSEVLTGDLPTPVKYYNPEIAKEYKKIEAAAEHKLLSMLPEEFQEDFAPFL
5DNU_VIBVY      VAVLAMYHDSSEVLTGDLPTPVKYYNPEIAKEYKKIEAAAEQKLLSMLPEEFQEDFRPFV
5DNU_VIBVU      HSFTSLAHQMLKRTNQDLPTPVKYYNPEIAKEYKKIEAAAEQKLLSMLPEEFQEDFRPFV
                 :  .: *:  :  . *:***:**.*  *   ** **  *: ::: : * *::  :   .

5DNU_VIBCH      ISNTADPDESAIVKQADAICAYLKCLEELSAGNHEYAQAKKRLDVTLRERHSEEMAYFLQ
5DNU_VIBTL      ISGTANKEEQSIVKQADTICAYLKCLEELSAGNHEYEQAKRRLEETLEQRKSPEMDYFLT
5DNU_PECAS      DDSYTSEEERAIVKQADALCAYLKCLEELSAGNAEFTLAKARLEKTLQLRHSSEMDYFMT
5DNU_PECCP      DDSYTSEEERAIVKQADALCAYLKCLEELSAGNAEFTLAKARLEKTLQLRHSPEMDYFMT
5DNU_PHOLL      DDSQHTTEETFIIKQADSLCAYLKCLEELSAGNHEFNLAIARLEKTLADRHSQEMDYFMK
5DNU_PHOTE      DDSQHTEEEISIVKQADALCAYLKCLEELSAGNSEFNLAKARLEKTLAARHSQEMDYFMT
5DNU_YERPB      DEHYYSEEEKALVKQADALCAYLKCLEELSAGNNEFIQAKARLEKTLAIRQSPEMDYFMA
5DNU_YERP3      DEHYYSEEEKALVKQADALCAYLKCLEELSAGNNEFIQAKARLEKTLAIRQSPEMDYFMA
5DNU_YERPY      DEHYYSEEEKALVKQADALCAYLKCLEELSAGNNEFIQAKARLEKTLAIRQSPEMDYFMA
5DNU_YERPE      DEHYYSEEEKALVKQADALCAYLKCLEELSAGNNEFIQAKARLEKTLAIRQSPEMDYFMA
5DNU_YERPP      DEHYYSEEEKALVKQADALCAYLKCLEELSAGNNEFIQAKARLEKTLAIRQSPEMDYFMA
5DNU_YERPG      DEHYYSEEEKALVKQADALCAYLKCLEELSAGNNEFIQAKARLEKTLAIRQSPEMDYFMA
5DNU_YERPA      DEHYYSEEEKALVKQADALCAYLKCLEELSAGNNEFIQAKARLEKTLAIRQSPEMDYFMA
5DNU_YERPN      DEHYYSEEEKALVKQADALCAYLKCLEELSAGNNEFIQAKARLEKTLAIRQSPEMDYFMA
5DNU_YERPS      DEHYYSEEEKALVKQADALCAYLKCLEELSAGNNEFIQAKARLENTLAIRQSPEMDYFMA
5DNU_YERE8      DEHYYSEEEKALVKQADALCAYLKCLEELSAGNNEFIQAKVRLEKTLAMRQSPEMDYFME
5DNU_SALA4      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALCH      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALDC      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALEP      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALG2      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALHS      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALNS      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALPA      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALPK      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALPB      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALPC      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALSV      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALTY      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFGLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALTI      DENAWSKEEQAIVKQADALCAYLKCLEELSAGNNEFRLAKTRLEKTLELRRSQEMDYFMA
5DNU_SALAR      DENAWSEEEQAIVKQADALCAYLKCLEELSAGNNEFKLAKTRLEKTLALRRSQEMDYFMA
5DNU_CITK8      DEHAYSEEEKSVVKQADALCAYLKCLEELSAGNNEFLLAKTRLEKTLASRRSEEMDYFMA
5DNU_ECO7I      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECOHS      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECO5E      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECOLU      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECO57      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECO8A      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECOSE      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECOSM      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECO55      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECOLC      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECO24      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_SHIB3      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECOBW      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECODH      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECOLI      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_SHIFL      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_SHIF8      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_SHISS      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECOUT      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECO81      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECOK1      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECO45      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECOL6      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECOL5      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_ECO27      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLEARRSQEMDYFME
5DNU_SHIDS      DEHAYSDEEKSLVKQADALCAYLKCLEELAAGNNEFLLAKTRLEATLAARRSQEMDYFME
5DNU_KLEP3      DEHHYSEEEQSIVKQADALCAYLKCLEELSAGNNEFLLAKGRLEKTLASRRSAEMDYFMQ
5DNU_KLEP7      DEHHYSEEEQSIVKQADALCAYLKCLEELSAGNNEFLLAKGRLEKTLASRRSAEMDYFMQ
5DNU_ENT38      DEHQCSEEERLLVKQADALCAYLKCLEELSAGNNEFLLAKSRLEKTLESRRSEEMDYFMQ
5DNU_CROS8      DEHHYTEDEKSLVKQADALCAYLKCLEELSAGNNEFLLAKSRLEKTLAQRHSAEMDYFMQ
5DNU_ERWT9      DEHQHSEAETAIVKQADALCAYLKCLEELSAGNNEFLTAKARLEKTLAQRRSQEMDYFME
5DNU_SHEON      ISDYADPTYKAIVKSADTLCAYLKCLEENRAGNTEFNTARKRLEAMLESNPNPAVKYFMD
5DNU_PASMU      DSTQFSAQEKHVVKQADLICAYVKAQFELENGNQEFKAAKARLETLMKTWHSDEMRYFIE
5DNU_PHOPR      DSHCINKDDYVIVKQADSLCAYLKCLEELNAGNHEFAQAKKRLEKTLQTRSTPEMEYFLN
5DNU_VIBPA      LSHSSHEEDSQIVKQADSICAYLKCLEELSAGNHEFALAKKRLDVTLQERKTPEMEYFLN
5DNU_VIBVY      ISQQTSEEEAQIVKQADSICAYLKCLEELSAGNHEFALAKKRLDITLAERKTPEMDYFLN
5DNU_VIBVU      ISQQTSEEEAQIVKQADSICAYLKCLEELSAGNHEFALAKKRLDITLAERKTPEMDYFLN
                 .         ::*.** :***:*.  *   ** *:  *  **:  :    .  : **: 

5DNU_VIBCH      TFAPSFELTLDEIS-----
5DNU_VIBTL      TFAPSFELSLDEIS-----
5DNU_PECAS      VFVPSFSLSLDEISQDSPL
5DNU_PECCP      VFVPSFSLSLDEISQDSPL
5DNU_PHOLL      VFVPGFSLSLDEISLDIPH
5DNU_PHOTE      VFVPGFSLSLDEISLDIPD
5DNU_YERPB      VFVPSFSLSLDEISLDSLD
5DNU_YERP3      VFVPSFSLSLDEISLDSLD
5DNU_YERPY      VFVPSFSLSLDEISLDSLD
5DNU_YERPE      VFVPSFSLSLDEISLDSLD
5DNU_YERPP      VFVPSFSLSLDEISLDSLD
5DNU_YERPG      VFVPSFSLSLDEISLDSLD
5DNU_YERPA      VFVPSFSLSLDEISLDSLD
5DNU_YERPN      VFVPSFSLSLDEISLDSLD
5DNU_YERPS      VFVPSFSLSLDEISLDSLD
5DNU_YERE8      VFVPSFSLSLDEISLDSLD
5DNU_SALA4      VFVPSFHLSLDEISQDSPL
5DNU_SALCH      VFVPSFHLSLDEISQDSPL
5DNU_SALDC      VFVPSFHLSLDEISQDSPL
5DNU_SALEP      VFVPSFHLSLDEISQDSPL
5DNU_SALG2      VFVPSFHLSLDEISQDSPL
5DNU_SALHS      VFVPSFHLSLDEISQDSPL
5DNU_SALNS      VFVPSFHLSLDEISQDSPL
5DNU_SALPA      VFVPSFHLSLDEISQDSPL
5DNU_SALPK      VFVPSFHLSLDEISQDSPL
5DNU_SALPB      VFVPSFHLSLDEISQDSPL
5DNU_SALPC      VFVPSFHLSLDEISQDSPL
5DNU_SALSV      VFVPSFHLSLDEISQDSPL
5DNU_SALTY      VFVPSFHLSLDEISQDSPL
5DNU_SALTI      VFVPSFHLSLDEISQDSPL
5DNU_SALAR      VFVPSFHLSLDEISQDSPL
5DNU_CITK8      VFVPSFHLSLDEISQDSPL
5DNU_ECO7I      VFVPSFHLSLDEISQDSPL
5DNU_ECOHS      VFVPSFHLSLDEISQDSPL
5DNU_ECO5E      VFVPSFHLSLDEISQDSPL
5DNU_ECOLU      VFVPSFHLSLDEISQDSPL
5DNU_ECO57      VFVPSFHLSLDEISQDSPL
5DNU_ECO8A      VFVPSFHLSLDEISQDSPL
5DNU_ECOSE      VFVPSFHLSLDEISQDSPL
5DNU_ECOSM      VFVPSFHLSLDEISQDSPL
5DNU_ECO55      VFVPSFHLSLDEISQDSPL
5DNU_ECOLC      VFVPSFHLSLDEISQDSPL
5DNU_ECO24      VFVPSFHLSLDEISQDSPL
5DNU_SHIB3      VFVPSFHLSLDEISQDSPL
5DNU_ECOBW      IFVPSFHLSLDEISQDSPL
5DNU_ECODH      IFVPSFHLSLDEISQDSPL
5DNU_ECOLI      IFVPSFHLSLDEISQDSPL
5DNU_SHIFL      VFVPSFHLSLDEISQDSPL
5DNU_SHIF8      VFVPSFHLSLDEISQDSPL
5DNU_SHISS      VFVPSFHLSLDEISQDSPL
5DNU_ECOUT      VFVPSFHLSLDEISQDSPL
5DNU_ECO81      VFVPSFHLSLDEISQDSPL
5DNU_ECOK1      VFVPSFHLSLDEISQDSPL
5DNU_ECO45      VFVPSFHLSLDEISQDSPL
5DNU_ECOL6      VFVPSFHLSLDEISQDSPL
5DNU_ECOL5      VFVPSFHLSLDEISQDSPL
5DNU_ECO27      VFVPSFHLSLDEISQDSPL
5DNU_SHIDS      VFVPSFHLSLDEISQDSPL
5DNU_KLEP3      VFVPSFQLSLDEISQDSPL
5DNU_KLEP7      VFVPSFQLSLDEISQDSPL
5DNU_ENT38      VFVPSFQLSLDEISQDSPL
5DNU_CROS8      VFVPSFHLSLDEISQDSPL
5DNU_ERWT9      VFVPSFSLSLDEISQESL-
5DNU_SHEON      CFVPSFTLNLDEINKML--
5DNU_PASMU      VFIPSFGKPIDEITL----
5DNU_PHOPR      TFVESFNLTLDEIS-----
5DNU_VIBPA      TFAPSFELSLDEIS-----
5DNU_VIBVY      TFAPSFELSLDEIS-----
5DNU_VIBVU      TFAPSFELSLDEIS-----
                 *  .*   :***.