CLUSTAL format seed alignment for MF_01102

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

MNMC_ECOLI      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_ECODH      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_SHIB3      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_SHIBS      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_ECOLC      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_ECOHS      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_SHIFL      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_SHIF8      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_SHISS      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_ECO57      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_SHIDS      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_ECOK1      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_ECOUT      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_ECOL6      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_ECOL5      ---------------MKHYSIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_ECOSM      ---------------MKHYAIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_ECO24      ---------------MKHYAIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_CITK8      ---------------MKQYAIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_SALPA      ---------------MKQYAIQPATLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_SALTY      ---------------MKQYAIQPATLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_SALPB      ---------------MKQYAIQPATLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_SALCH      ---------------MKQYAIQPATLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_SALTI      ---------------MKQYAIQPATLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_SALAR      ---------------MKQYAIQPATLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_ENT38      ---------------MKQNVVQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_KLEP7      ---------------MKQNAIQPANLEFNAEGT----PVSRDFDDVYFSNDNGLEETRYV
MNMC_CROS8      ---------------MKPIAIQPASLTFNNEGT----PVSRDFDDVYFSNDDGLEETRYV
MNMC_YERPG      ---------------MNQRPIQTATLSWNEQGT----PVSEQFGDIYFSNEDGLEETHHV
MNMC_YERPY      ---------------MNQRPIQTATLSWNEQGT----PVSEQFGDIYFSNEDGLEETHHV
MNMC_YERPE      ---------------MNQRPIQTATLSWNEQGT----PVSEQFGDIYFSNEDGLEETHHV
MNMC_YERPA      ---------------MNQRPIQTATLSWNEQGT----PVSEQFGDIYFSNEDGLEETHHV
MNMC_YERPN      ---------------MNQRPIQTATLSWNEQGT----PVSEQFGDIYFSNEDGLEETHHV
MNMC_YERPP      ---------------MNQRPIQTATLSWNEQGT----PVSEQFGDIYFSNEDGLEETHHV
MNMC_YERPS      ---------------MNQRPIQTATLSWNEQGT----PVSEQFGDIYFSNEDGLEETHHV
MNMC_YERPB      ---------------MNQRPIQTATLSWNEQGT----PVSEQFGDIYFSNEDGLEETHHV
MNMC_YERP3      ---------------MNQRPIQTATLSWNEQGT----PVSEQFGDIYFSNEDGLEETHHV
MNMC_YERE8      ---------------MSHPPIQTATLSWNEQGT----PVSEQFGDIYFSNEDGLEETHYV
MNMC_SERP5      ---------------MSHAPIQTAALSWNEQGT----PVSKQFDDVYFSNQDGLEETRYV
MNMC_PECAS      ---------------MANLPIQHASLSWNAQGT----PVSQQFDDVYFSNQDGLAETRYV
MNMC_PHOLL      ---------------MKNSAICTATLSWNDQGT----PISTQFDDVYFSNQDGLEETRYV
MNMC_VIBCH      --------------MFIMSSISHAQLGWNDAGT----PVSDQFDDVYFSNVNGLAETRYV
MNMC_VIBC3      --------------MFIMSSISHAQLGWNDAGT----PVSDQFDDVYFSNVNGLAETRYV
MNMC_VIBCB      -----------------MTSIKNAELGWNEAGT----PVSDQFDDVYFSNVNGLEETRYV
MNMC_VIBPA      -----------------MTSIKNAELGWNEAGT----PVSDQFDDVYFSNVNGLEETRYV
MNMC_VIBVU      -----------------MTSITHAELGWNEVGT----PVSDQFDDVYFSNVNGLEETRYV
MNMC_VIBVY      -----------------MTSITHAELGWNEVGT----PVSDQFDDVYFSNVNGLEETRYV
MNMC_ALIF1      ---------MSQNHILPQNSITNAVLEWNESGT----PVSNDFDDVYFSNDNGLEETRYV
MNMC_PHOPR      ---------------MSDKHIKQTVLNSND-------------------NRISPSHVCDI
MNMC_AERHH      ---------------MSQTSLHHARLDWNEAGT----PVSSEFGDVYFSNDNGLSETRYV
MNMC_AERS4      ---------------MSQTSLHHARLDWNEAGT----PVSSDFGDVYFSNDNGLSETRYV
MNMC_PSYIN      ------------MSDAKYKLIKHAQIHWSDQLE----PFSSLFDDIYFNTEQGIDEANYV
MNMC_ACTPJ      -------------MVNVMNTLSFASLSFNSNNT----PVSEQFDDIYFSTQDGLEESYYV
MNMC_ACTP2      -------------MVNVMNTLSFASLSFNSNNT----PVSEQFDDIYFSTQDGLEESYYV
MNMC_HAEDU      -----------------MHKLTFAQLSFNSDNT----PVSEQFDDIYFSTEDGVQESYYV
MNMC_HAEIN      ----------------MTFSVQHAEIHFNQNHI----PVSDQFDDVYFSNENGLAETDYV
MNMC_HAEIG      ----------------MTFSVQHAEIHFNQNHI----PVSDQFDDVYFSNENGLAETDYV
MNMC_HAEI8      ----------------MTFSVQHAEIHFNRNHI----PVSDQFNDVYFSNENGLAETDYV
MNMC_HAEIE      ----------------MTFSVQHAEIHFNQNHI----PVSDQFDDVYFSNENGLAETDYV
MNMC_HAES1      -----------------MFTVTPAKIYLNQEKT----PVSEQFNDVYFSNQDGLAESEYV
MNMC_HISS2      -----------------MFTVTPAKIYLNQEKT----PVSEQFNDVYFSNQDGLAESEYV
MNMC_PASMU      -----------------MHKVQFADVHFNAENT----PVSAQFDDVYFSNQDGLAESHYI
MNMC_MANSM      -----------------MLKVTTAHIHFNRDNT----PVSEQFDDIYFSTADGLEESRYV
MNMC_ACTSZ      -----------------MHHIQTADLRFSADNT----PVSDRFDDIYFSTQDGVAESRYV
MNMC_CAUVC      -------------MTPT----APSPLVWRDDGL----PQSSLYGDVYFSSVDGLAETRAV
MNMC_CAUSK      -------------MSDP----TASPLIWRDDGM----PQSALYGDVYFSSADGLAETRAV
MNMC_MARMM      -------------MTPDGLYCDPAELDWSQPSG----PRARAYGDVYFSAEDGLEEARAV
MNMC_HYPNA      -------------MTRL---LTHPDIAWREDGT----PFATAFGDVYFSAQDGLAETRAV
MNMC_CUPNH      ----------------MPRALEPAEPILSAEGI----PYSPRYDDVYHSTEGGLAQAAHV
MNMC_CUPPJ      ----------------MSRALEPAEPILSAEGT----PYSPRYDDVYHSTEGGLAQAHYV
MNMC_CUPMC      ----------------MTRVLEPAEPILSNDGT----PYSPRYDDVYHSARGGLAQAHHV
MNMC_RALSO      ----------------MPRGLILATPQLPPDGT----PFSARYDDVYHSTEGGLAQAHHV
MNMC_BURCM      ----------------MPDRLVPATLARRDDGI----LVSPEYGELPRDASRARAHANRM
MNMC_BURA4      ----------------MPDRLVPATLARRDDGI----LVSPEYGELPRDASHARAHANRM
MNMC_BURCA      ----------------MPDRLVSATLALRDDGT----LVSPEFGELHRGASGTLARAHRT
MNMC_BURCH      ----------------MPDRLVSATLALRDDGT----LVSPEFGELHRGASGTLARAHRT
MNMC_BURCC      ----------------MPDRLVSATLALRDDGT----LVSPEFGELHRGASGTLARAHRT
MNMC_BURL3      ----------------MTDRLVPASLALRDDGT----LVSPEFGDLHLGASGALA--HRV
MNMC_BURVG      ----------------MPDRLVPATLAFRDDGT----LISPEYGDIYYNVAGAFAQANYV
MNMC_BURM1      ----------------MPDRLVPATLAFRDDGT----LVSPAYGDIYHSAAGAIAQANHV
MNMC_BURMA      ----------------MTDRIVPATLVFREDGT----VVSPLYGDIYHSAAGALAQADHV
MNMC_BURM9      ----------------MTDRIVPATLVFREDGT----VVSPLYGDIYHSAAGALAQADHV
MNMC_BURM7      ----------------MTDRIVPATLVFREDGT----VVSPLYGDIYHSAAGALAQADHV
MNMC_BURP0      ----------------MTDRIVPATLVFREDGT----VVSPLYGDIYHSAAGALAQADHV
MNMC_BURP1      ----------------MTDRIVPATLVFREDGT----VVSPLYGDIYHSAAGALAQADHV
MNMC_BURPS      ----------------MTDRIVPATLVFREDGT----VVSPLYGDIYHSAAGALAQADHV
MNMC_BURMS      ----------------MTDRIVPATLVFREDGT----VVSPLYGDIYHSAAGALAQADHV
MNMC_BURP6      ----------------MTDRIVPATLVFREDGT----VVSPLYGDIYHSAAGALAQADHV
MNMC_BURTA      ----------------MTDRIVPATLVFREDGT----VVSPLYGDIYHSAAGALAQADHV
MNMC_PARPJ      ----------------MTDPLIPAVLVFRDNGT----PFSPLYDDIYHSAVGGLEQARYV
MNMC_PARXL      ----------------MTDPLIPAVLAFRANGT----PFSPLYDDIYHSAVGGLEQAHYV
MNMC_PARP8      ----------------MTDPLVPAVLAFRDNGT----PYSPLYDDIYHSAVGGLAQADYV
MNMC_LEPCP      --------------MRRSNPITPARLGRSAEGL----PFSEDFGAPYHPSAGALAQAEQV
MNMC_METPP      ---------------MKTAPITPGRLAFSPDGV----PLAPEFGDVYHPAAGALQQAHHV
MNMC_BORBR      ----MNSRIFPAAMSAPYAPLQPAVVVHDEQGR----LYSAAYGDVYHSRDDAAGQAEHV
MNMC_BORPA      ----MNSRIFPAAMSAPYAPLQPAVVVHDEQGR----LYSAAYGDVYHSRDDAAGQAEHV
MNMC_BORPD      --------------MSSYSPLVPPAAGFDADGR----FRSVAYGDVYHSLSGALGQAEHV
MNMC_BORA1      -------------MSSAYQPLTPALTEVNEAGH----LASRQYGDVYNSPADAYGQAVDV
MNMC_AZOSB      ------------------MPITPASLSFAEDGT----PYSTAYGDVYHSSDGGLGQAHHV
MNMC_AROAE      ------------------MPIDPARLAFTDDGT----PCSAAFGDVYHARGGGLEQARFV
MNMC_DECAR      -----------------MEKLQPARLEFVAYDT----PYSAAFDDVYHSALGGPAQARHV
MNMC_THIDA      ----------------MLRTIVPARLEF-RDGV----PYSAAYGDVYHSADGGPGQARHV
MNMC_ACIAC      ---------------------MSEPIDWLPDGT----PFNPRFGDRYHS-HTGLAQAREV
MNMC_ACISJ      ---------------------MSEPIEWLEDGT----PYSPRFSDRYHSEHGGLEQARGT
MNMC_DELAS      -------------------MPMSEPIDWLPDGT----PYSPRFGDRYHSELGGLDQARHV
MNMC_POLNA      ---------------------MSERIEWLEDGTAGGSPYSPRFGDRYRSELGGLEQAREV
MNMC_POLSJ      ---------------------MPERIEWLEDGT----PYSPRFGDRYRSESGGLDQAREV
MNMC_MAGMM      ---------MSKQQAPNTTGIGTADLQWHSDET----PYSPRFDDIYYAPTHGAEESTHV
MNMC_LEPBJ      ------------------------MLSWKNDLT----PVSDRFDDIYFSPENGLEETRHV
MNMC_LEPBL      ------------------------MLSWKNDLT----PVSDRFDDIYFSPENGLEETRHV
MNMC_LEPIN      ------------------------MLTWKNNLT----PVSEQFDDIYFSPENGLEETKHV
MNMC_LEPIC      ------------------------MLTWKNNLT----PVSEQFDDIYFSPENGLEETKHV
MNMC_MARMS      --------------MLTSYQLESPALSWGEDGA----PHSNQFDDVYFDKESGLEETRHV
MNMC_HYDCU      ----MAASSLPSHNSKFEPKLERAQIAWSEEGV----PTSTMFDDVYYSKLDGLAEVNYI
MNMC_CAMJJ      --------------------MKKAKLIFKDNTP-----FSLDFDDFYFNSKDGLNESKFV
MNMC_CAMJ8      --------------------MKKAKLIFKDNTP-----FSLDFDDFYFNSKDGLNESKFV
MNMC_CAMJR      --------------------MKKAKLIFKDNTP-----FSLDFDDFYFNSKDGLNESKFV
MNMC_CAMJE      --------------------MKKAKLIFKDNTP-----FSLDFDDFYFNFKDGLNESKFV
MNMC_CAMJD      --------------------MKKAKLIFKDNTP-----FSLDFDDFYFNSKDGLNESKFV
MNMC_CAMC1      --------------------MKNANLSFKGQIP-----FNEEFDDIYFNTEKPWLESEFV
MNMC_CAMHC      -------------------------MKFINGIL-----FNENFKDFYSNFKNPFGESEFV
MNMC_CAMFF      ------------------------MITFRGDGL-----YNSKFDDIYFNTNEPLIECEHT
MNMC_LEGPA      -------------MSSPFVPIITADIDWRDDLP-----YSLQFDDIYYSAEGGINQSLYV
MNMC_LEGPH      -------------MSSPFVPIITADIDWRDDLP-----YSLQFDDIYYSAEGGINQSLYV
MNMC_LEGPL      -------------MSSPFVPIITADIDWRDDLP-----YSLQFDDIYYSAEGGINQSLYV
MNMC_LEGPC      -------------MSSPFAPIITADIDWRDDLP-----YSLQFDDIYYSAEGGINQSLYV
MNMC_ACIBT      --------------MNKSNRIQTAELDWEF-IDGIEVPISKQFGDVYFSKDNGLLETRHV
MNMC_ACIBY      --------------MNKSNRIQTAELDWES-IDGIEVPISKQFGDVYFSKDNGLLETRHV
MNMC_ACIBC      --------------MNKSNRIQTAELDWES-IDGIEVPISKQFGDVYFSKDNGLLETRHV
MNMC_ACIAD      --------------MCVSSSIQTAILDWQC-VDGIDIPVSRQFGDVYFSKDNGLLETRHV
MNMC_PSYA2      MSKP--ISMDTTKSMTPVHVISPANIEWQTDDAGNKVPVSGEFGDVYFSQADDLAESRHV
MNMC_PSYCK      MPKPASMAMNTTKSTTPAHVISPANIEWQTDDAGNEVPVSGEFGDAYFSQADGLAESHHV
MNMC_PSYWF      -----------------MDKVTPAKLSWREDELGNVVPVSEIFGDVYYSLVDGLNESRYV
MNMC_PSEAE      -----------------MSDFQHAQLDWDEN----GQPLSRAFGDVYFSRHSGLNETRHV
MNMC_PSEAB      -----------------MSDFQHAQLDWDEN----GQPLSRAFGDVYFSRHSGLNETRHV
MNMC_PSEA7      -----------------MSDFQHAQLDWDEN----GQPLSRVFGDVYFSRHSGLDETRHV
MNMC_PSEMY      -----------------MSDAHNAQLDWDEH----GQPLSRSYGDVYFSRANGLEETRHV
MNMC_PSEP1      ----------------MPTLLQHAQIDWDDQ----GRPHSRHYDDVYFAVNEGIEETKHV
MNMC_PSEPK      ----------------MPTLLQHAQIDWDDQ----GRPHSRHYDDVYFAVNEGIEETKHV
MNMC_PSEPG      ----------------MSTLLQHAQIDWDDQ----GRPHSRQYDDVYFAVNEGIEETKHV
MNMC_PSEPW      --------------MPASTLLQHAQIDWDDQ----GRPHSRQYGDVYFAINEGIAETQHV
MNMC_PSEE4      ----------------MSTLLQHAQIDWDDQ----GRPHSRQYDDVYFAINEGIDETLHV
MNMC_PSEF5      ----------------MIPELPHAQLDWDDQ----GRPRSRVFDDVYFSSESGLDETRHV
MNMC_PSEPF      ----------------MKPVMPHAQLDWDDQ----GRPRSRVFDDVYFSDQSGLDETRYV
MNMC_PSE14      -----------------MTITRHARIDWDEQ----GNPRSRDFSDVYFSTESGLDETRHV
MNMC_PSEU2      -----------------MTITRHAQIDWDEH----GNPRSRDFSDVYFSTESGLEETRHV
MNMC_PSESM      -----------------MTITRHARIDWDEQ----GNPRSHDFSDVYFSTESGLDETRHV
MNMC_PSEU5      -----------MNDHPAQDAFQHAELDWDEN----GLPQSRHYGDVYFSRASGLAETEHV
MNMC_CHRVO      ------------------MTHSHAQLVWQD-----GQPMSAVFGDVYFSRASGLEETRHV
MNMC_METFK      ---------------MSIPPFSQASLEWHE-----GQPYSAHFGDVYFSRESGLEETRHV
MNMC_NITMU      ------------------------MLDWQN-----GQLYSTRFGDVYFSRDSGLEEKQYV
MNMC_CHRSD      -------MPAVSRPLPPLTALAPPELEWRADDIS-DAPYASAYGDVYFSRHDGRAETGHV
MNMC_HAHCH      ---------------MKGPQLDYADLSWSDN----GAPISNAYGDIYFSKESGPEETDYV
MNMC_MARN8      -----------MITDLRPPAMEPAELIWQD-----GVPESARFGDVYFSRDDGLAETRYV
MNMC_IDILO      -------------------MNSNSSVQFNEQ----GVPVSTTFDDIYFSVESGVDESQYV
MNMC_PSEA6      ------------------MTIKTADIQFNADGT----PIATNFDDVYFSSFDGAAETEYV
MNMC_PSET1      -------------------MIKNANIHFNHQGT----PVANDFDDIYYSDDNGLAESYYV
MNMC_COLP3      -------------MKKLDKTNNSNKLSYQKDGT----PYCQRFDDIYFESESGYQQSDFV
MNMC_SHEB5      ---------------------MTAEPNKP----CQIKRDYQQLINLYPATADTDAHYLSK
MNMC_SHEB9      ---------------------MTAEPNKP----CQIKRDYQQLINLYPATAHTDAHYLSK
MNMC_SHEB8      ---------------------MTAEPNKP----CQIKRDYPQLINLYPATADTDAHYLSK
MNMC_SHEPC      ---------------------MTAEPNKP----CQIKRDYPQLINLYPATAHNDAHYLSK
MNMC_SHESW      ---------------------MTAEPNKP----CQIKRDYPQLINLYPATAHNDAHYLSK
MNMC_SHESM      ---------------------MTAKPQKS----CQFKRDYPQLINLYPPCALTTAQSLDN
MNMC_SHESR      ---------------------MTAKPQKS----CQFKRDYPQLINLYPPCALTTAQSLDN
MNMC_SHESA      ---------------------MTAKPHKS----CQFKRDYPQLINLYPPCALTTAQSLDN
MNMC_SHEON      ---------------------MTAKPHIS----CQFKRDYPQLINLYPTCTIATQHSLDN
MNMC_SHEDO      ------------------MPSCYEHSAQSPRPLSVLAEYFPKGYSVFYKANTETCPEANQ
MNMC_SHEFN      ---------------MNKTPLLSVSPNLHELHICELLGNNANQNSRYSHIVKQYIAEVLQ
MNMC_SHESH      ------------------------------------MPNMRHRVNSLTEEHEENMQMSKL
MNMC_SHEWM      ------------------------------------MPNMRRRVNSLAQECEKNTQMNQE
MNMC_SHELP      ------------------------------------MPNIPLRVNSLATEHPNNAQNSDK
MNMC_SHEAM      ------------------------------------MSDSVTSCLLLPILETMPMPVITT
MNMC_SACD2      --------MTKKLEHEYIAHTERPALTWDEQGQ----PYSTEYDDVYYSTTDALAETRFV
MNMC_DICNV      ------------------MLQTYAPIDFRNNDP-----YNTDFEDIYYNPALGFAESDHV
                                                                            

MNMC_ECOLI      FLGGNQLEVRFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_ECODH      FLGGNQLEVRFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_SHIB3      FLGGNQLEVRFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_SHIBS      FLGGNQLEVRFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_ECOLC      FLGGNQLEVRFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_ECOHS      FLGGNQLEVRFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_SHIFL      FLGGNQLEVRFPEHP-------HPLFVIAESGFGTGLNFLTLWKAFDQFREAHP------
MNMC_SHIF8      FLGGNQLEVRFPEHP-------HPLFVIAESGFGTGLNFLTLWKAFDQFREAHP------
MNMC_SHISS      FLGGNQLEVRFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_ECO57      FLGGNQLEARFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_SHIDS      FLGGNQLEARFPEYP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_ECOK1      FLGGNHLEARFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_ECOUT      FLGGNHLEARFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_ECOL6      FLGGNHLEARFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_ECOL5      FLGGNHLEARFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_ECOSM      FLGGNQLEARFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_ECO24      FLGGNQLEVRFPEHP-------HPLFVVAESGFGTGLNFLTLWQAFDQFREAHP------
MNMC_CITK8      FLGGNQLEERFPLHP-------RPLFVVAESGFGTGLNFLTLWQAFSQFRDAHP------
MNMC_SALPA      FLGGNRLAERFPVHS-------HPLFIVAESGFGTGLNFLTLWQAFDSFRSAHP------
MNMC_SALTY      FLGGNRLAERFPVHS-------HPLFIVAESGFGTGLNFLTLWQAFDSFRSAHP------
MNMC_SALPB      FLGGNRLAERFPVHS-------HPLFIVAESGFGTGLNFLTLWQAFDSFRSAHP------
MNMC_SALCH      FLGGNRLAERFPVHS-------HPLFIVAESGFGTGLNFLTLWQAFDSFRSAHP------
MNMC_SALTI      FLGGNRLAERFPVHS-------HPLFIVAESGFGTGLNFLTLWQAFDSFRSAHP------
MNMC_SALAR      FLGGNRLAERFPVHS-------HPLFIVAESGFGTGLNFLTLWQAFNNFRSEHP------
MNMC_ENT38      FLEGNHLNARFPLHP-------RSQFVVAESGFGTGLNFLTLWQAFDQFRADHP------
MNMC_KLEP7      FLGGNRLPERFPSHP-------RPLMIVAESGFGTGLNFLTLWQAFDVFVRDNP------
MNMC_CROS8      FLDGNQLPERFMTHP-------RDSFIVAESGFGTGLNFLTLWQAFAAFRDAHP------
MNMC_YERPG      FLKGNGFPARFASHP-------QQSCIFAETGFGTGLNFLTLWRDFALFRQQSP------
MNMC_YERPY      FLKGNGFPARFASHP-------QQSCIFAETGFGTGLNFLTLWRDFALFRQQSP------
MNMC_YERPE      FLKGNGFPARFASHP-------QQSCIFAETGFGTGLNFLTLWRDFALFRQQSP------
MNMC_YERPA      FLKGNGFPARFASHP-------QQSCIFAETGFGTGLNFLTLWRDFALFRQQSP------
MNMC_YERPN      FLKGNGFPARFASHP-------QQSCIFAETGFGTGLNFLTLWRDFALFRQQSP------
MNMC_YERPP      FLKGNGFPARFASHP-------QQSCIFAETGFGTGLNFLTLWRDFALFRQQSP------
MNMC_YERPS      FLKGNGFPARFASHP-------QQSCIFAETGFGTGLNFLTLWRDFALFRQQSP------
MNMC_YERPB      FLKGNGFPARFASHP-------QQSCIFAETGFGTGLNFLTLWRDFALFRQQSP------
MNMC_YERP3      FLKGNGFPARFASHP-------QQSCIFAETGFGTGLNFLTLWRDFALFRQQSP------
MNMC_YERE8      FLKGNGFPERFALHP-------RDNCVFAETGFGTGLNFLTLWRDFAQFRQLHP------
MNMC_SERP5      FLKGNRLPSRFAEHP-------RPLFIVAETGFGTGLNFLTLWQAFADFHATTP------
MNMC_PECAS      FLQGNQFPERFGTHP-------RTACVIAETGFGTGLNFLTLWQAFAHFRQQQP------
MNMC_PHOLL      FLNGNCFPQRFCTHS-------RSSCVIAETGFGTGLNFLTLWQAFDAFRQQNP------
MNMC_VIBCH      FLEQNHLPQRWHNDD-------QRRFVIAETGFGTGLNFLAVWQAFVAFREANP------
MNMC_VIBC3      FLEQNHLPQRWHNDD-------QRRFVIAETGFGTGLNFLAVWQAFVAFREANP------
MNMC_VIBCB      FLKQNHLPERWQEFD-------QRRFVIGETGFGTGLNFLAVWQWFTEFRREYP------
MNMC_VIBPA      FLKQNHLPERWQEFD-------QRRFVIGETGFGTGLNFLAVWQWFNEFRRNHP------
MNMC_VIBVU      FLKQNLIPERWQEFD-------RRRFVIGETGFGTGLNFLAVWQAFNDFRRANP------
MNMC_VIBVY      FLKQNLIPERWQEFD-------RRRFVIGETGFGTGLNFLAVWQAFNDFRRANP------
MNMC_ALIF1      FLQQNHLPQRWQEYD-------QRRFVIGETGFGTGLNFLAVWQWFKEFRSQYP------
MNMC_PHOPR      FLPQNGLSERWKAFT-------RRRFVIAETGFGTGLSFLTACQQFTQFRQANP------
MNMC_AERHH      FLQQNRLPARFSHHD-------SDIFVIGETGFGTGLNFLATMAAFLEQAPQ--------
MNMC_AERS4      FLQQNGLPARFSHHN-------SDSFVIGETGFGTGLNFLATMKAFLEQAPQ--------
MNMC_PSYIN      FFDGNKLGKRWLDYS-------AQHFSIAETGFGTGLNFLLTCQKFAEFIKLNP------
MNMC_ACTPJ      FQDGNQLWQKWQTHD-------VESFVIAETGFGTGLNFLAVADKFQQFLSEFP------
MNMC_ACTP2      FQDGNQLWQKWQTHD-------VESFVIAETGFGTGLNFLAVADKFQQFLSEFP------
MNMC_HAEDU      FQDGNQLWQKWQNHH-------RSAFVIAETGFGTGLNFLAVAEKFQQFRSTFP------
MNMC_HAEIN      FLQGNQLWERWITHK-------DANFVIAETGFGTGLNFFAVTKLFREFRQQHE------
MNMC_HAEIG      FLQGNQLWERWITHK-------EANFVIAETGFGTGLNFFAATKLFRKFRQQHE------
MNMC_HAEI8      FLQGNQLWERWISHN-------EANFVIAETGFGTGLNFFAVTQLFREFRQQHE------
MNMC_HAEIE      FLQGNQLWERWITHK-------EANFVIAETGFGTGLNFFAVTKLFREFRQQHE------
MNMC_HAES1      FQQGNHLWERWIVYQ-------EKHFVIAETGFGTGLNFLAVTSLFRQFRQQYP------
MNMC_HISS2      FQQGNHLWERWIVYQ-------EKHFVIAETGFGTGLNFLAVTSLFRQFRQQYS------
MNMC_PASMU      FQEGNQLWQRWQQTS-------EAHFVIAETGFGTGLNFFAVTQRFREFRLTYP------
MNMC_MANSM      FQEGNNLWRRWLQFG-------ENHFVIAETGFGTGLNFLAVTALFREFRTQYP------
MNMC_ACTSZ      FQQGNALWERWSACQ-------DIHFVIAETGFGTGLNFFAVTTLFRQFRRQNP------
MNMC_CAUVC      FLAGCGLPERFAE---------RRDFVVGELGFGSGLNIAALLDLWRREKPP--------
MNMC_CAUSK      FLAGCDLPAAWAG---------RDHFTVGELGFGTGLNIAALLDLWRREKAPHSM-----
MNMC_MARMM      FLRGCGLPEAWTG---------RRHYVVGELGFGTGLNALALWQLWRQTRPT--------
MNMC_HYPNA      FFKGCGLPEAWAG---------RAQFTVAETGFGTGLNFLALWQLWREHRPHP-------
MNMC_CUPNH      FLGGNGLPQAWAG---------QRQFVIVETGFGLGLNFLATWQAWRADPQRC-------
MNMC_CUPPJ      FLGGNGLPQAWAG---------RDQFVIVETGFGQGLNFLATWQAWRNDPQRC-------
MNMC_CUPMC      FLGGNGLPEGWAG---------REQFVIVETGFGQGLNFLATWQAWRSDPQRC-------
MNMC_RALSO      FLGGNGLPGGWQG---------KRSFTIVETGFGQGLNFLATWAAWRDDPQRC-------
MNMC_BURCM      L-AGTGLLARWQG---------RRTFTIVETGFGTGGRFLATWAAWRDDPARC-------
MNMC_BURA4      L-AGTGLPAHWRG---------RRTFTIVETGFGTGSRFLATWAAWRDDPARC-------
MNMC_BURCA      FVAGNGLPARWQR---------RRTFTIVTTAFGAGAGFLAAWVAWRDDPARC-------
MNMC_BURCH      FVAGNGLPARWQR---------RRTFTIVTTAFGAGAGFLAAWAAWRDDPARC-------
MNMC_BURCC      FVAGNGLPARWQR---------RRTFTIVTTAFGAGAGFLAAWAAWRDDPARC-------
MNMC_BURL3      FVAGNGLPTRWQD---------RRTFTIVATGFGAGGSFLAAWAAWRDDPARC-------
MNMC_BURVG      FIAGNRLPARWQG---------SRTFTIVETGFGTGTNFLATWAAWRDDPARC-------
MNMC_BURM1      FVAGNGLPARWQQ---------RRTFTIVETGFGTGCNFLATWAAWRDDPARC-------
MNMC_BURMA      FIRGNGLPERWRH---------ERAFTIIETGFGTGCNFLATWAAWRADPSHC-------
MNMC_BURM9      FIRGNGLPERWRH---------ERAFTIIETGFGTGCNFLATWAAWRADPSHC-------
MNMC_BURM7      FIRGNGLPERWRH---------ERAFTIIETGFGTGCNFLATWAAWRADPSHC-------
MNMC_BURP0      FIRGNGLPERWRH---------ERAFTIIETGFGTGCNFLATWAAWRADPSHC-------
MNMC_BURP1      FIRGNGLPERWRH---------ERAFTIIETGFGTGCNFLATWAAWRADPSHC-------
MNMC_BURPS      FIRGNGLPERWRH---------ERAFTIIETGFGTGCNFLATWAAWRADPSHC-------
MNMC_BURMS      FIRGNGLPERWRH---------ERAFTIIETGFGTGCNFLATWAAWRADPSHC-------
MNMC_BURP6      FIRGNGLPERWRH---------ERAFTIIETGFGTGCNFLATWAAWRADPSHC-------
MNMC_BURTA      FIRGNDLPERWRH---------KRTFTIVETGFGTGCNFLATWAAWRADPSHC-------
MNMC_PARPJ      FLRGNSLPDRWQG---------RRIFTVLETGFGMGINFLMTWAAWRADPLRC-------
MNMC_PARXL      FLRGNALPERWQE---------RRVFTVVETGFGMGINFLVTWAAWRADSSRC-------
MNMC_PARP8      FLKGNDLPSRWQK---------RRLFTVLETGFGMGINFLVTWAAWRADPDRC-------
MNMC_LEPCP      FLRGTDLPARWAG---------QARHVILETGFGLGHNFLATWAAWRRDPRRC-------
MNMC_METPP      FLGGNRLPARWGG---------RGRFVILETGFGLGNNFLATWDAWQRDPQRC-------
MNMC_BORBR      FLRGNGLPQRWRG---------RARFTVCETGFGMGLNFLTLWQAWRDDPARP-------
MNMC_BORPA      FLRGNGLPQRWRG---------RARFTVCETGFGMGLNFLTLWQAWRDDPARP-------
MNMC_BORPD      FLRGNGLPQRWRG---------RQAFTVCETGFGLGLNFLALWDAWRNDPARP-------
MNMC_BORA1      FLHGNDLPQRWRG---------RRHFTVCETGFGLGTNFLALWRAWREDPGRC-------
MNMC_AZOSB      FLAGNGLPERWRG---------RERFVIVETGFGLGLNFLASWAAWRKDPQRS-------
MNMC_AROAE      FIAGNGLPARWQG---------REHFAILETGFGFGLNFLATWDAWRADPKRC-------
MNMC_DECAR      FLAGNELPARWQD---------KYRFVILETGFGTGLNFLATWQAWRDDPQRC-------
MNMC_THIDA      FLAGCGLPAAWAG---------RDSFVVLETGFGTGLNFLATWAAWRDDPARP-------
MNMC_ACIAC      FLRGCGLPGAWAG---------QAMWRVLETGFGCGLNFLATWAAWRADPARP-------
MNMC_ACISJ      FLAGCGLPQAWQN---------QPQWRVLETGFGLGLNFLVTWAAWRADPHRP-------
MNMC_DELAS      FLGGCGLPAAWAD---------APQWRILETGFGFGLNFLVAWEAWKADPRRP-------
MNMC_POLNA      FLKGCGLPNAWAG---------QPQWCVLETGFGLGLNFLVTWAAWKADPLRP-------
MNMC_POLSJ      FLKGCGLPAAWAG---------QPQWCVLETGFGLGLNFLVTWQAWKTDPLRP-------
MNMC_MAGMM      FLEGINAPACWQQ---------RPHYTLAETGFGTGLNFLLTLDLWLATAPAH-------
MNMC_LEPBJ      FIGGNDLPDRWRNS--N----IQNPFCILELGFGTGLNFFATWKEYLKQD-NRF------
MNMC_LEPBL      FIGGNDLPDRWRNS--N----IQNPFCILELGFGTGLNFFATWKEYLKQD-NRF------
MNMC_LEPIN      FIKGNDLYNRWRNW--N----IQNAFCILELGFGTGLNFLTTWKEYLEYK-DRF------
MNMC_LEPIC      FIKGNDLYNRWRNW--N----IQNAFCILELGFGTGLNFLTTWKEYLEYK-DRF------
MNMC_MARMS      FLKNNQLSGRWASL--Q----KNA-FVIAETGFGTGLNFLCAWQAFLTEAASDK------
MNMC_HYDCU      FLKHNQLPERFETL--L----PNSRFCILETGFGAGLNFLTTCLLWLEKSPADA------
MNMC_CAMJJ      YTHSFEWKN-------------QENFIIAESGFGIGLNFFLTLKRFLQTTPSK-------
MNMC_CAMJ8      YTHSFEWKN-------------QENFIIAESGFGIGLNFFLTLKRFLQTTPSK-------
MNMC_CAMJR      YTHSFEWKN-------------QENFIIAESGFGIGLNFFLTLKRLLETTPSK-------
MNMC_CAMJE      YTHSFEWKN-------------QENFIIAESGFGIGLNFFLTLKRFLETTPSK-------
MNMC_CAMJD      YTHSFEWKN-------------QENFIITESGFGIGLNFFLTLKRFLETTPSK-------
MNMC_CAMC1      FTSALDEIWQ-----------SKDSFIVAETGFGAGLNFFTLCKKFKN------------
MNMC_CAMHC      FGSAVNEILK-----------TQNRVIVAELGFGLGRNFLNIAAKFKN------------
MNMC_CAMFF      YSSVLDEIN-------------AKFIVVAEAGFGTGLNFFSTVLKFLSL-----------
MNMC_LEGPA      FIEGNNLINRWQQLPTN----ESNVFTIAETGFGTGMNFLLTWKLWEKFAP---------
MNMC_LEGPH      FVEGNNLINRWQQLPTN----ESNVFTIAETGFGTGMNFLLTWKLWEKFAP---------
MNMC_LEGPL      FVEGNNLINRWQQLPTN----ESNVFTIAETGFGTGMNFLLTWKLWEKFAP---------
MNMC_LEGPC      FVEGNNLINRWQQLPTN----ESNVFTIAETGFGTGMNFLLTWKLWEKFAP---------
MNMC_ACIBT      FLNGNDLTERLANLQDF------EYFSVGETGFGTGLNILALWQLWQQVR----------
MNMC_ACIBY      FLNGNDLSERLANLQDF------EYFSVGETGFGTGLNILALWQLWQQVR----------
MNMC_ACIBC      FLNGNDLSERLANLQDF------EYFSVGETGFGTGLNILALWQLWQQVR----------
MNMC_ACIAD      FLNGNNLTERLADLKPY------QYFCVGETGFGTGLNILAVWQLWQQVR----------
MNMC_PSYA2      FLVHNQLPTRLANLIPK------QCFTICELGFGTGLNLLATWQLWRQLR----------
MNMC_PSYCK      FLAHNQLPTRLANLIPK------QCFTIYELGFGTGLNLLATWQLWRQLR----------
MNMC_PSYWF      FLTQNKLPERFEALFSRANSSAASNFSIAELGFGTGLNILATWQLWEHSKQQFHTYFNSQ
MNMC_PSEAE      FLATNRLAERFAALG------DGEVLCIGETGFGTGLNFLCAWQLFERVAPAG-------
MNMC_PSEAB      FLATNRLAERFAALG------DGEVLCIGETGFGTGLNFLCAWQLFEQVAPAG-------
MNMC_PSEA7      FLATNRLAERFAALG------DGEALCIGETGFGTGLNFLCAWQLFERVAPPG-------
MNMC_PSEMY      FLAHNQIIERCQALP------AGGRLVIGETGFGTGLNFLCAWQAFAEHAPRD-------
MNMC_PSEP1      FLGQTRLAERFAHLA------PHACTVIGETGFGTGMNFFCAWQLFDQHAHSD-------
MNMC_PSEPK      FLGQTRLAERFANLA------PHACTVIGETGFGTGMNFFCAWQLFDQHAHSD-------
MNMC_PSEPG      FLGQTRLAERFANLA------PHTCGVIGETGFGTGMNFFCAWQLFDQHAHRD-------
MNMC_PSEPW      FLEQTRLRQRFANLA------PHGCLVIGETGFGTGMNFFCAWQLFAETAHAD-------
MNMC_PSEE4      FIEQNQLRQRFAELK------PHDCLVIGETGFGTGMNFFCAWQLFAELAPAG-------
MNMC_PSEF5      FIEQNRLGQRFAALA------DGERFVIGETGFGTGLNFLCAWQLFQQQAPTG-------
MNMC_PSEPF      FLEQNRLAERFAALS------AGGRLVIGETGFGTGLNFLCAWQLFEQHAVAG-------
MNMC_PSE14      FLVQNDLRRRFSELP------EDGRLIIGETGFGTGLNFLCAWQLFDECAPAE-------
MNMC_PSEU2      FLVQNDLRRRFTELQ------DGGRLIIGETGFGTGLNFLCAWQLFDECAPAN-------
MNMC_PSESM      FLVQNDLRRRFTELP------VGGRLIVGETGFGTGLNFLCAWQLFDECAPVD-------
MNMC_PSEU5      FLAQNDLPRRFAAMQ------PDECLVIGETGFGTGLNFLCAWQLFERSASAR-------
MNMC_CHRVO      FLRHNQLEERFAALP------PSGSFAIAETGFGTGLNFLCAWQCFEARAPAG-------
MNMC_METFK      FLRHNQLAERWQTMQ------QDA-FTIVETGFGTGLNFLCAWQMWEHTAPSH-------
MNMC_NITMU      FLQGNRLADRFESLQ------PDTAFSIGETGFGTGLSFLCTWRLFIQIAPLR-------
MNMC_CHRSD      FVEGNRLPERFAAWR------ETRAFVIGETGFGTGLNMLCAWACFERHAPAE-------
MNMC_HAHCH      FLTGNRLRERFSNAP------PGSLFTIAETGFGSGLNFLMAWALWRECGPAD-------
MNMC_MARN8      FIERNGLPGRFAELD------RNSHFVIAETGFGTGLNFLATWAEWLAQRPDDQDH----
MNMC_IDILO      FLAQNGLPRRWLSLP------AHYSFTIAETGFGTGLNFLLTWKRFLEQAPAN-------
MNMC_PSEA6      FLHNNLLPQRWQQW-------SKPTFVIAETGFGTGLNLLVTLAVFKQHLAQHPASTF--
MNMC_PSET1      FYQQNNIDTRLQSH-------DQAHFVIAETGFGTGLNFLNTCQHFTDHLARQQVQKQL-
MNMC_COLP3      FIQKNKIGLRLQI--------AKQTFTVAETGFGTGLNFLLTLQAYQKAQQVSSFQLA--
MNMC_SHEB5      LSIYQQRVFEAHSQQ--------KLLILGQIGLGNGLELLS---WWRTQANPS-------
MNMC_SHEB9      LSIYQQRVFEAHSQQ--------KLLILGQIGLGNGLELLS---WWRTQANPS-------
MNMC_SHEB8      LSIYQQRVFEAHSQQ--------KLLVLGQIGLSNGLELLS---WWRAHSHLS-------
MNMC_SHEPC      LSIYQQRVFEAHSQQ--------KLLVLGQMGLGNGLELLS---WWRTQTNPN-------
MNMC_SHESW      LSIYQQRVFEAHSQQ--------KLLVLGQMGLGNGLELLS---WWRTQTNPN-------
MNMC_SHESM      LTRLRLSRLTTQSTQPI-----QGLCVMGQWGLGDGLELLSLLQHWQTQTQTQ-------
MNMC_SHESR      LTRLRLSRLTTQSTQPI-----QGLCVMGQWGLGDGLELLSLLQHWQTQTQTQTQ-----
MNMC_SHESA      FTRLRRSRLTTPSAQLG-----QELYVMGQWGLGDGLELLSLLHHWQTQTQSN-------
MNMC_SHEON      LNRLRHQCLTALLTQPS-----PHLCVMGQWGLGDGIELLSFIHYWQTLAKTQ-------
MNMC_SHEDO      YSKALVDFYTQELNQAE-----DTNLTLGQMGLGDGVSLLLLWQSLLQCRKNNP------
MNMC_SHEFN      SSDD-----KIAATNTQ-----PHLLTLGQLGFGDGHEIILLLAALQEANLQNPL-----
MNMC_SHESH      TGHLSSISTLFPVKNDA-----SQTLTLGQLGLGCPCQLVSLWHYLRKNSPSRA------
MNMC_SHEWM      TANFSEFYRLLSNIAVG-----KQSLTFGQLGLGSVEQLLAVHSWLSSAPTSVR------
MNMC_SHELP      MPTFDAIFSHLSAIASH-----NSHQIIALLPSSDANWPAALIAERLTQAGSKQ------
MNMC_SHEAM      LFMFYYPFRTGSTNFSA-----PIVSPLALLSGQLSIKGGKIMPISRHRVNFFNP-----
MNMC_SACD2      FLDKNNLAARWPHLT------HQQTFTVCETGFGAGLNFLATWQLWRSTRPSG-------
MNMC_DICNV      FIAGNHLRERFSALP------EYGRFTLAETGFGTGLNMINAAAHFLECAPKTA------
                                           .                                

MNMC_ECOLI      --------------QAQLQRLHFISFEKFPLTRADLALAHQHWPELAP------------
MNMC_ECODH      --------------QAQLQRLHFISFEKFPLTRADLALAHQHWPELAP------------
MNMC_SHIB3      --------------QAQLQRLHFISFEKFPLTRADLALAHQHWPELAP------------
MNMC_SHIBS      --------------QAQLQRLHFISFEKFPLTRADLALAHQHWPELAP------------
MNMC_ECOLC      --------------QARLQRLHFISFEKFPLTRADLALAHQHWPELAP------------
MNMC_ECOHS      --------------QARLQRLHFISFEKFPLTRADLALAHQHWPELAP------------
MNMC_SHIFL      --------------QAQLQRLHFISFEKFPLTRADLALAHQHWPELAP------------
MNMC_SHIF8      --------------QAQLQRLHFISFEKFPLTRADLALAHQHWPELAP------------
MNMC_SHISS      --------------QAQLQRLHFISFEKFPLTRADLALAHQHWPELAP------------
MNMC_ECO57      --------------QAQLQRLHFISFEKFPLTRADLALAHQHWPELAP------------
MNMC_SHIDS      --------------QAQLQRLHFISFEKFPLTRSDLVLAHQHWPELAP------------
MNMC_ECOK1      --------------QAQLQRLHFISFEKFPLTRADLALAHQHWPELAP------------
MNMC_ECOUT      --------------QAQLQRLHFISFEKFPLTRADLALAHQHWPELAP------------
MNMC_ECOL6      --------------QAQLQRLHFISFEKFPLTRADLALAHQHWPELAP------------
MNMC_ECOL5      --------------QAQLQRLHFISFEKFPLARADLVLAHQHWPELAP------------
MNMC_ECOSM      --------------QAQLQRLHFISFEKFPLARADLALAHHHWPELAP------------
MNMC_ECO24      --------------QAQLQRLHFISFEKFPLTRADLALAHLHWPELTP------------
MNMC_CITK8      --------------EATLQRLHFISFEKFPLTQADLALAHQHWPELAP------------
MNMC_SALPA      --------------QATLQRLHFISFEKFPLTRDDLALAHQHWPELAP------------
MNMC_SALTY      --------------QATLQRLHFISFEKFPLTRDDLALAHQHWPELAP------------
MNMC_SALPB      --------------QATLQRLHFISFEKFPLTRDDLALAHQHWPELAP------------
MNMC_SALCH      --------------QATLQRLHFISFEKFPLTRDDLALAHQHWPELAP------------
MNMC_SALTI      --------------QATLQRLHFISFEKFPLTRDDLALAHQHWPELAP------------
MNMC_SALAR      --------------QATLQRLHFVSFEKFPLTRDDLALTHQHWPELAP------------
MNMC_ENT38      --------------EATLQRLHFISFEKYPLIGHDLKLAHQHWPELAQ------------
MNMC_KLEP7      --------------NVTLQRLHFISFEKYPLKAEDLRLAHQRWPELAP------------
MNMC_CROS8      --------------DATLQRLHFISFEKFPLTPADLKSAHAHWPELAP------------
MNMC_YERPG      --------------NATLRRLHYISFEKYPLHVADLASAHARWPELAS------------
MNMC_YERPY      --------------NATLRRLHYISFEKYPLHVADLASAHARWPELAS------------
MNMC_YERPE      --------------NATLRRLHYISFEKYPLHVADLASAHARWPELAS------------
MNMC_YERPA      --------------NATLRRLHYISFEKYPLHVADLASAHARWPELAS------------
MNMC_YERPN      --------------NATLRRLHYISFEKYPLHVADLASAHARWPELAS------------
MNMC_YERPP      --------------NATLRRLHYISFEKYPLHVADLASAHARWPELAS------------
MNMC_YERPS      --------------NATLRRLHYISFEKYPLHVADLASAHARWPELAS------------
MNMC_YERPB      --------------NATLRRLHYISFEKYPLHVADLASAHARWPELAS------------
MNMC_YERP3      --------------NATLRRLHYISFEKYPLHVADLASAHARWPELAS------------
MNMC_YERE8      --------------AAKLQRLHYISFEKYPLQVADLAAAHQRWPELAC------------
MNMC_SERP5      --------------DATLQRLHFISFEKFPLLQADLAAAHARWPELAP------------
MNMC_PECAS      --------------QATLRHLHFISFEKFPLRQHDLAAAHAQWPELAE------------
MNMC_PHOLL      --------------DAPLKRLHFISFEKYPLKTNDLKAAHQRWPELEI------------
MNMC_VIBCH      --------------DAKLKELHFISFEKYPLSKSDLIQAHQAWPELAQ------------
MNMC_VIBC3      --------------DAKLKELHFISFEKYPLSKSDLIQAHQAWPELAQ------------
MNMC_VIBCB      --------------EATLKELHFVSFEKYPLSKADLEKAHQSWPELAE------------
MNMC_VIBPA      --------------DAALKELHFISFEKYPLSLADLKKAHEAWPELAE------------
MNMC_VIBVU      --------------DATLKELHFVSFEKFPLSKQDLIKAHQAWPELAE------------
MNMC_VIBVY      --------------DATLKELHFISFEKFPLSKQDLIKAHQAWPELAE------------
MNMC_ALIF1      --------------DAPLKELHFVSFEKFPVTKSDLIKAHQAWPELAQ------------
MNMC_PHOPR      --------------TATVKELHFISFEQHPLTKSDLIKATEKWPEFAH------------
MNMC_AERHH      --------------SGNGARLHFISFEKYPLTREDLRKALAAWPELAT------------
MNMC_AERS4      --------------TGNGARLHFISFEKFPLTRDDLHKALTAWPELAP------------
MNMC_PSYIN      --------------NNPLKKLHFSSFEKYPLTKPDLIIALQQWPQLTA------------
MNMC_ACTPJ      --------------NSKLKRLYFISFEKFPLTSEQLATIHKNYPQFAT------------
MNMC_ACTP2      --------------NSKLKRLYFISFEKFPLTSEQLATIHKNYPQFAT------------
MNMC_HAEDU      --------------DSPLKRLYFISFEKYPLTQQQLADIHQHYPQFTQ------------
MNMC_HAEIN      --------------NHPLKRLNFISFEKYPLKITALLQAHLACPQFED------------
MNMC_HAEIG      --------------NHPLKRLNFISFEKYPLKITALSQAHLACPQFED------------
MNMC_HAEI8      --------------NHPLKRLNFISFEKYPLKITALSQAHLAYPQFED------------
MNMC_HAEIE      --------------NHPLKRLNFISFEKYPLKITALLQAHLAYPQFED------------
MNMC_HAES1      --------------DFPLKRLFFISFEKYPLPKDQLQQIHRLYPQFSA------------
MNMC_HISS2      --------------HSPLKHLFFISFEKYPLPKVQLQQIHQFYPQFSA------------
MNMC_PASMU      --------------DAPLKRLFFISFEKYPLPLAQLKRAHQAYPEFQS------------
MNMC_MANSM      --------------DSPLKRLFFISFEKYPMSCADLRSAHQAYPQFNS------------
MNMC_ACTSZ      --------------QSPLSRLHFISFEKYPISAEQLAITYQTFSEFSA------------
MNMC_CAUVC      -----------------GGRLHIFSIEAHPLSRDEAARILAHWPELGE------------
MNMC_CAUSK      ---------------QGGQRLHIFSIEAHPITRDEAARALAVWPELGE------------
MNMC_MARMM      -----------------DGWLDFVTVEKHPLDRDAAARAFAAWPELSD------------
MNMC_HYPNA      -----------------AARLSFVSFEGYPLRAEDAARAFAAWPELSP------------
MNMC_CUPNH      ------------------GTLHFVSIEKHPFTREGLAQLHA--GLDGL------------
MNMC_CUPPJ      ------------------RRLHFVSIEKHPFTREGLAQLHA--GLADM------------
MNMC_CUPMC      ------------------RRLHFVSIEKHPFTREGLARLHAHAGLGDL------------
MNMC_RALSO      ------------------GRLDFVSVEKHPFDRAGLALVHA--QEGAL------------
MNMC_BURCM      ------------------ERLHFVAIEAHPFTREDLRRAVSHLVADTT------------
MNMC_BURA4      ------------------ERLHFVAIEPHPFARDDLRRAVSNFVADTT------------
MNMC_BURCA      ------------------ERLHVVAVEPHPFSRDDLHRAVSHMVVDTT------------
MNMC_BURCH      ------------------ERLHVVAVEPHPFSRDDLHRAVSHMVVDTT------------
MNMC_BURCC      ------------------ERLHVVAVEPHPFSRDDLHRAVSHMVADTT------------
MNMC_BURL3      ------------------ERLHFVAVEPHPFSRDDLRRAATHIVADTT------------
MNMC_BURVG      ------------------ERLHFVSFEKHPFTRDDLRRALSHIVAGTT------------
MNMC_BURM1      ------------------ERLHFVSVEKHPFSREDLRRAAAHIVANTT------------
MNMC_BURMA      ------------------ERLHFVSVEKHPFAREDLRRAAAHIVAYTTITTITP------
MNMC_BURM9      ------------------ERLHFVSVEKHPFAREDLRRAAAHIVAYTTITTITP------
MNMC_BURM7      ------------------ERLHFVSVEKHPFAREDLRRAAAHIVAYTTITTITP------
MNMC_BURP0      ------------------ERLHFVSVEKHPFAREDLRRAAAHIVAYTTITTITP------
MNMC_BURP1      ------------------ERLHFVSVEKHPFAREDLRRAAAHIVAYTTITTITP------
MNMC_BURPS      ------------------ERLHFVSVEKHPFAREDLRRAAAHIVAYTTITTITP------
MNMC_BURMS      ------------------ERLHFVSVEKHPFAREDLRRAAAHIVAYTT---ITP------
MNMC_BURP6      ------------------ERLHFVSVEKHPFAREDLRRAAAHIVAYTT---ITP------
MNMC_BURTA      ------------------ERLHFVSVEKHPFARDDLRRAAAHIVAYTT------------
MNMC_PARPJ      ------------------ERLHFVSTEKHPFTVGDLRKAVAATISDPE------------
MNMC_PARXL      ------------------ERLHFVSTEKHPFTVDDLRKVYAATISDPE------------
MNMC_PARP8      ------------------ERLHFVSTEKHPFSREDLIAATNSSVADAS------------
MNMC_LEPCP      ------------------ERLVYLAIDKHPPAPADLADVHRDSPLADL------------
MNMC_METPP      ------------------ERLVFVSIEKHPLTREDLARAHAASPLPEL------------
MNMC_BORBR      ------------------RRLHMLSLEGHPFAREDLLAVLRAHAPAGL------------
MNMC_BORPA      ------------------RRLHMLSLEGHPFAREDLLAVLRAHAPAGL------------
MNMC_BORPD      ------------------RCLHMVSIEAHPFARDALRDWLRQLAPDIL------------
MNMC_BORA1      ------------------GRLHMLSIEGHPLTREAYEAVLDTQVPEPL------------
MNMC_AZOSB      ------------------ERLHFVSCELHPFRVEDLALLHARWPEFAP------------
MNMC_AROAE      ------------------ERLHFVSVERHPFTREDLATLHARWPELAP------------
MNMC_DECAR      ------------------RRLHFISFEKHPFTLADLATCQQAWPEFAE------------
MNMC_THIDA      ------------------SRLHFLSVEKHPFQAADLARIHAQWPEFAE------------
MNMC_ACIAC      ------------------RLLHFVSCEAFPVSADDLLRSMQGHGELEP------------
MNMC_ACISJ      ------------------QRLHFVSCEAWPVSAADLLRAAPIDSTLQS------------
MNMC_DELAS      ------------------RLLHFVSAEAFPVSADAMRQAMPREPGLRL------------
MNMC_POLNA      ------------------RLLHFVSTEAYPASADDVLRSALTHPELIP------------
MNMC_POLSJ      ------------------RLLHFVSTEAFPASAADVLRSVQVHPELLP------------
MNMC_MAGMM      ------------------GRLHYIAVEAYPMDQAALARAHAPFAWLAP------------
MNMC_LEPBJ      -------------------RLHFISVEKFPLSRKEISKAVSAFPELEE------------
MNMC_LEPBL      -------------------RLHFISVEKFPLSRKEISKAVSAFPELEE------------
MNMC_LEPIN      -------------------RLHFISIEKFPLNREEISKALSIFSELVE------------
MNMC_LEPIC      -------------------RLHFISIEKFPLNREEISKALSIFSELVE------------
MNMC_MARMS      -------------------QLHFISVEKYPMTKSMLTDALKMWPSISH------------
MNMC_HYDCU      -------------------QLHFISLEKFPLTRSELAKAHHAFEEVSE------------
MNMC_CAMJJ      ----------------RPKKLFYISVEAFYIEKEQLREIYQKLGFYEEFK----------
MNMC_CAMJ8      ----------------RPKKLFYISIEAFYIEKEQLREIYQKLGFYEEFK----------
MNMC_CAMJR      ----------------RPKKLFYISVEAFYIEKEQLREIYQKLEFYEEFK----------
MNMC_CAMJE      ----------------RPKKLFYISVEAFYIEKEQLREIYQKLEFYEEFK----------
MNMC_CAMJD      ----------------RPKKLFYISVEAFYIEKEQLREIYQKLRFYEEFK----------
MNMC_CAMC1      ----------------SSKKLHFVSIEKSPIKKEDLLKIYENLGIFKAY-----------
MNMC_CAMHC      ----------------SDKILHFVSIEKFPLQKEILAKFYENFKFEGA------------
MNMC_CAMFF      ----------------NSTELHYIAVEKYPFKKSELREIYLKFEILKPF-----------
MNMC_LEGPA      ----------------QNARLHYISCDKHPLKKNDLIKCLQKWPELSVQ-----------
MNMC_LEGPH      ----------------QNARLHYISCDKHPLKKNDLIKCLQKWPELSVQ-----------
MNMC_LEGPL      ----------------QNARLHYISCDKHPLKKDDLIKCLQKWPELSVQ-----------
MNMC_LEGPC      ----------------QNARLHYISCDKHPLKKNDLIKCLQKWPELSVQ-----------
MNMC_ACIBT      --------------PNNHSHLHAISVEKFPLSKADLIRALNVW----DELKP--------
MNMC_ACIBY      --------------PNNHSHLHAISVEKFPLSKADLIRALNVW----DELKP--------
MNMC_ACIBC      --------------PNNHSHLHAISVEKFPLSKADLIRALNVW----DELRP--------
MNMC_ACIAD      --------------PDNHSHLHVISVEKFPLSKSDLERALRAW----PELII--------
MNMC_PSYA2      ----------LTHPHLANARLHFITTEKHPVPFSDLAKILAPWAQRAPELAP--------
MNMC_PSYCK      ----------LTHPHLASARLHFITTEKHPVPFSDLAKILAPLGQRTPELAL--------
MNMC_PSYWF      TNLQTSSQDHLKGSRSLTPRLHIISTEKHPLTHADLSRSLESWKHKDTSLVP--------
MNMC_PSEAE      ------------------ARLEFVSVEKFPLAAADLRRALALWPELAP------------
MNMC_PSEAB      ------------------ARLEFVSVEKFPLAAADLRRALALWPELAP------------
MNMC_PSEA7      ------------------ARLEFVSVEKFPLAAADLRRALALWPELAP------------
MNMC_PSEMY      ------------------ARLHFVSVEKFPLTQTDLQRALALWPELAP------------
MNMC_PSEP1      ------------------ARLHFVSVEKYPLDHADMARAVRLWPELAA------------
MNMC_PSEPK      ------------------ARLHFVSVEKYPLDHADMARAVRLWPELAA------------
MNMC_PSEPG      ------------------ARLHFVSVEKYPLGHADMARAVSLWPELAA------------
MNMC_PSEPW      ------------------ARLHFVSVEKYPLGHADMARAMRLWPELAA------------
MNMC_PSEE4      ------------------ARLHFVSVEKYPLSRDDLARAMQLWPELAA------------
MNMC_PSEF5      ------------------ARLHFVSVEKYPLSPADLQRALALWPELAS------------
MNMC_PSEPF      ------------------ARLHFVSVEKFPLSPADLQRALALWPDLKR------------
MNMC_PSE14      ------------------ARLQFVSVEKYPLSRADLQRALALWPELSR------------
MNMC_PSEU2      ------------------ARLQFVSVEKYPLSHADLQRALALWPELSP------------
MNMC_PSESM      ------------------ARLHFVSVEKYPLSQGDLQRALVLWPELSR------------
MNMC_PSEU5      ------------------ARLHFVSVEKHPLTFADMQRALALWPELQA------------
MNMC_CHRVO      ------------------ARLHFVSAEKFPLTPSDLAQALALWPELEP------------
MNMC_METFK      ------------------VRLHFVSIEKFPLSHADLARALALWPELRQ------------
MNMC_NITMU      ------------------TSLDFFSVEKYPLDEKELSAALALWPELGP------------
MNMC_CHRSD      ------------------ARLHLVSTEKYPLPRDALARALAIWPDMAA------------
MNMC_HAHCH      ------------------GHLHFTSVEFCPLAREDLVRCHQAWPQLAE------------
MNMC_MARN8      ------------------AILHFISVERYPLALADLEKALESWPGLQP------------
MNMC_IDILO      ------------------TRLHFVSFEKFPLSRQQLEQAYQLLEPIAE------------
MNMC_PSEA6      -------------------TLHYISTEKFPLTHTDLVQALNAFVQFED------------
MNMC_PSET1      --------------NYGVKRLHFIAFEKHPLSVSDLSKILTAWPELNL------------
MNMC_COLP3      -------------------PLHFISVEKYPLTKEQLVQSLSILPQLQS------------
MNMC_SHEB5      ------------------QRLLLKVFEPNPINAYELKSLWDQSL-----ALVKETPFEPH
MNMC_SHEB9      ------------------QRLLLKVFEPNPINAYELKSLWDQSL-----TLVKETPFEPH
MNMC_SHEB8      ------------------QRLLLKVFEPNPINAYELKLLWDQSA-----CLTKE------
MNMC_SHEPC      ------------------QRLLLKVFEPNPINAYELKLLWDQSA-----SLAKV------
MNMC_SHESW      ------------------QRLLLKVFEPHPINAYELKLLWDQSA-----SLAKV------
MNMC_SHESM      ----------------GNTRLLVKVFEPNPINDYELKLLWDQSQ-----SLISK------
MNMC_SHESR      --------------PQGNTRLLVKVFEPNPINDYELKLLWDQSQ-----SLISK------
MNMC_SHESA      ------------------TRLLVKVFEPNPINDYELKLLWDQSQ-----SLIST------
MNMC_SHEON      ----------------NLPRLLLKVFEPNPINYYELKLLWDQSQ-----SLILH------
MNMC_SHEDO      --------------ELSRLKVHLLIFEPHAISALELKQLWQALG-----LFDAN------
MNMC_SHEFN      --------------IQQQTRIHISVFEQGPVNCKQLQHTWQQQG-----LLDSD------
MNMC_SHESH      ----------------VNIKIFESQFDALADFNLKLASLTSPDPRLPRD-----------
MNMC_SHEWM      ----------------IKLKVFEAQLDTLPLFISQLSSYTPPSS----------------
MNMC_SHELP      ----------------HLQKQHLHLHLFAQHQASWLKALAESET----------------
MNMC_SHEAM      --------------MPEFFAIDMAMPLSLPLPEGPCVVLFEALP----------------
MNMC_SACD2      -------------------RMHFISFEKHPLNSAQIAKALNRWPQFAA------------
MNMC_DICNV      -------------------ALNLISCEAYPIELETLKRIHHHWHHHEL------------
                                                                            

MNMC_ECOLI      -------------WAEQLQAQWPM----PLPGCHRLLLDEGRVTLDLWFGDINELTSQLD
MNMC_ECODH      -------------WAEQLQAQWPM----PLPGCHRLLLDEGRVTLDLWFGDINELTSQLD
MNMC_SHIB3      -------------WAEQLQAQWPM----PLPGCHRLLLDEGRVTLDLWFGDINELTSQLD
MNMC_SHIBS      -------------WAEQLQAQWPM----PLPGCHRLLLDEGRVTLDLWFGDINELTSQQD
MNMC_ECOLC      -------------WAEQLQAQWPM----PLPGCHRLLLDEGRVTLDLWFGDINELTSQLD
MNMC_ECOHS      -------------WAEQLQAQWPM----PLPGCHRLLLDEGRVTLDLWFGDINELTSQLD
MNMC_SHIFL      -------------WAEQLQAQWPM----PLPGCHRLLLDESRVTLDLWFGDINELTSQLD
MNMC_SHIF8      -------------WAEQLQAQWPM----PLPGCHRLLLDEGRVTLDLWFGDINELTSQLD
MNMC_SHISS      -------------WAEQLQAQWPM----PLPGCHRLLLNEGRVTLDLWFGDINELTSQLD
MNMC_ECO57      -------------WAEQLQAQWPM----PLPGCHRLLLDEGRVTLDLWFGDINELISQLD
MNMC_SHIDS      -------------WAEQLQAQWPM----PLPGCHRLLLDEGRVTLDLWFGDINELTSQLD
MNMC_ECOK1      -------------WAEQLQAQWPL----PLPGCHRLLLDEGRITLDLWFGDINELTSQLD
MNMC_ECOUT      -------------WAEQLQAQWPL----PLPGCHRLLLDEGRITLDLWFGDINELTSQLD
MNMC_ECOL6      -------------WAEQLQAQWPL----PLPGCHRLLLDEGHVTLDLWFGDINELTSQLD
MNMC_ECOL5      -------------WAEQLQAQWPL----PLSGCHRLLLDEGRVTLDLWFGDINELTSQLD
MNMC_ECOSM      -------------WAEQLQAQWPM----PLPGCHRLLFDEGHVTLDLWFGDINELTSQLD
MNMC_ECO24      -------------WAEQLQAQWPM----PLPGCHRLLLDEGRVTLDLWFGDINELTSQLD
MNMC_CITK8      -------------WAQQLHAQWPL----PLAGCHRLILDDGRVTLDLWFGDINELTGKLD
MNMC_SALPA      -------------WAEQLQAQWPL----PLPGCHRLLLDRGRVTLDLWFGDINELTDQLD
MNMC_SALTY      -------------WAEQLQAQWPL----PLPGCHRLLLDRGRVTLDLWFGDINELTDQLD
MNMC_SALPB      -------------WAEQLQAQWPL----PLPGCHRLLLDRGRVTLDLWFGDINELTDQLD
MNMC_SALCH      -------------WAEQLQAQWPL----PLPGCHRLLLDRSRVTLDLWFGDINELTDQLD
MNMC_SALTI      -------------WAEQLQAQWPL----PLPGCHRLLLDRGRVTLDLWFGDINELTDQLD
MNMC_SALAR      -------------WAEQLQAQWPL----PLAGCHRLLLDQGRVTLDLWFGDINELTDQLD
MNMC_ENT38      -------------WAEQLQAQWPL----PLGGCHRLLLDEGRVTLDLWFGDINELTDQLD
MNMC_KLEP7      -------------WAQQLQAQWPS----AFGGCHRLLLDGGRVTLDLWFGDINELTRELD
MNMC_CROS8      -------------WAQQLQAQWPM----ALPGCQRLVLDGGRVTLDLWLGDINELVDTLD
MNMC_YERPG      -------------FAEQLRAQWPL----PLAGCHRILLADGAITLDLWFGDVNTLLPTLD
MNMC_YERPY      -------------FAEQLRAQWPL----PLAGCHRILLADGAITLDLWFGDVNTLLPTLD
MNMC_YERPE      -------------FAEQLRAQWPL----PLAGCHRILLADGAITLDLWFGDVNTLLPTLD
MNMC_YERPA      -------------FAEQLRAQWPL----PLAGCHRILLADGAITLDLWFGDVNTLLPTLD
MNMC_YERPN      -------------FAEQLRAQWPL----PLAGCHRILLADGAITLDLWFGDVNTLLPTLD
MNMC_YERPP      -------------FAEQLRAQWPL----PLAGCHRILLADGAITLDLWFGDVNTLLPTLD
MNMC_YERPS      -------------FAEQLRAQWPL----PLAGCHRILLADGAITLDLWFGDVNTLLPTLD
MNMC_YERPB      -------------FAEQLRAQWPL----PLAGCHRILLADGAITLDLWFGDVNTLLPTLD
MNMC_YERP3      -------------FAEQLRAQWPL----PLAGCHRILLADGAITLDLWFGDVNTLLPTLD
MNMC_YERE8      -------------FAEQLRAQWPL----PLAGCHRILLAEGAITLDLWFGDVNTLLPQLD
MNMC_SERP5      -------------YADELRAQWPL----PLPGCHRLLLAEGRITLDLWFGDVNELLPHFD
MNMC_PECAS      -------------FADELRQQWPL----ALPGCHRLILAQGSITLDLWFGDVNVILPELD
MNMC_PHOLL      -------------FSQQLYQQWPQ----PLAGCHRLIMANGAVTLDLWFGDVNDLLPTMD
MNMC_VIBCH      -------------FAQKLHKHYPL----AIPECQRIVLNDGLVTLDLWFGDIKDCLPKVA
MNMC_VIBC3      -------------FAQKLHKHYPL----AIPECQRIVLDDGLITLDLWFGDIKDCLPKVA
MNMC_VIBCB      -------------FAEKLQQHYPA----AVPECHRIVLEDGAITLDLWFGDIKDCMPLVP
MNMC_VIBPA      -------------YAEKLQKHYPA----AVPECHRIVLEDGAITLDLWFGDIKDCMPQVP
MNMC_VIBVU      -------------LAEKLHRHYPP----AVPECHRIVLDNGAVTLDLWLGDIKDCLPSVP
MNMC_VIBVY      -------------LAEKLHRHYPP----AVPECHRIVLDNGAVTLDLWLGDIKDCLPSVP
MNMC_ALIF1      -------------FAEQLQEHYPA----AVPDCHRLVLEDGMITLDLWFGDIKDCMPQIW
MNMC_PHOPR      -------------FSQQLHAHYPP----AVSDCHRIVLDEGLITLDLWFGNITDSMPQVW
MNMC_AERHH      -------------FSQPLIEQWPL----PVAGCHRLLFAGGRIRLDLWFGDIKEMLPQVP
MNMC_AERS4      -------------FSQALIAQWPL----PVPGCHRLHFAGGRIRLDLWLGDIKEMLPQVP
MNMC_PSYIN      -------------FITPLLAQYPI----ALKGCHRLVLNEFNITLDLWFGDIADTLPSLH
MNMC_ACTPJ      -------------LSQKMTACWQP----RQTGCQRYHFEQ--IYLDVWFGDMLDNLPQLG
MNMC_ACTP2      -------------LSQKMTACWQP----RQTGCQRYHFEQ--IYLDVWFGDMLDNLPQLG
MNMC_HAEDU      -------------LSATLIACWQP----RQAGCQRYHFDD--VYLDIWFGEMLENLPQLG
MNMC_HAEIN      -------------LSAHLQRYWPS----LILGCHRIHFGE--TTLDLWFGDVSENLPQLG
MNMC_HAEIG      -------------LSAHLQRYWPS----LILGCHRIHFEE--TTLDLWFGDVSENLPQLG
MNMC_HAEI8      -------------LSAHLQRYWPS----LILGCHRIHFGE--TTLDLWLGNVSENLPQLG
MNMC_HAEIE      -------------LSAHLQRYWPS----LILGCHRIHFGE--TTLDLWLGDVSENLPQLG
MNMC_HAES1      -------------LSQQLCDYCLD----AIQGCQRFHFAE--TTLDLWFGDIADNLPQLG
MNMC_HISS2      -------------LSQQLCDYCLE----AIQGCQRFHFAE--TTLDLWFGDIVDNLPQLG
MNMC_PASMU      -------------LAQQLQQSWLE----PIVGCYRFHFAE--TTLDLWFGDMAENLPQLG
MNMC_MANSM      -------------LAEQLRQNWLQ----PIVGCYRFHFEE--TVLDLWFGDIADNLPQLG
MNMC_ACTSZ      -------------LAAQLQQWWQING-IPIEGCYRYHFGE--TTLDIWFGDVNTQLPQLG
MNMC_CAUVC      -------------AAQVLLDHWP----GRARGFHRVDLPGFDAVLDLAVMDVVEALEAWD
MNMC_CAUSK      -------------AASVLLDHWP----GLARGFHRIDLPGFDATFDLAVMDVEPALAAWD
MNMC_MARMM      -------------LASRLLTQWP----SRLRGPQRLVFPEDGFAITIFQDEVEAALSQMT
MNMC_HYPNA      -------------LADQLLARWP----GPVRGVRHLAFEADGIELILHLGDIAQTLPASG
MNMC_CUPNH      -----------QPLAQALQAQWP----LALPGLHRLAFDGGRVVLTLALGDIEQMLPRLA
MNMC_CUPPJ      -----------LPLAQQLQAAWP----DALPGLHRLAFEDGGVTLTLALGDIEAVLPKLV
MNMC_CUPMC      -----------LPLSDQLQQQWP----DALPGLHRLSFEDGAVTLTLALGDVETMLPKLV
MNMC_RALSO      -----------ASLAEALRQAWP----VPVPGVHRLVFDAGRVTLTLMLGDAETLLPQLS
MNMC_BURCM      ----------ISENADALIDAWP----MHVPGLHRLEFDAGRVVLTLAFGDARDMLQRLV
MNMC_BURA4      ----------ISENADALLDAWP----MHVPGLHRLEFDAGRVVLTLAFGDAHDMLQRLV
MNMC_BURCA      ----------ISADVDALLDAWP----ILVPGLHRLEFDEGRVVLTLAFGDTIDLLKKLV
MNMC_BURCH      ----------ISADVDALLDAWP----ILVPGLHRLEFDEGRVVLTLAFGDTIDLLKKLV
MNMC_BURCC      ----------ISADVDALLDAWP----MRVPGLHRLEFDAGRVVLTLAFGDTIDLLKKLV
MNMC_BURL3      ----------ISADVEALADAWP----MLVPGLHRLEFDEGRVVLTLAFGESIDMLGKIV
MNMC_BURVG      ----------LSEQATLLADAWP----PAVPGFHRIEFEGGRVVLTLALGDARELLPKLV
MNMC_BURM1      ----------ISASVDALADAWP----PLVPGLHRLEFDAGRVVLTLVFGDALERLPTLV
MNMC_BURMA      ----------IAPLVDELANAWP----ALTPGVHRLEFDDGRVTLTLVFGDALDVLPNLA
MNMC_BURM9      ----------IAPLVDELANAWP----ALTPGVHRLEFDDGRVTLTLVFGDALDVLPNLA
MNMC_BURM7      ----------IAPLVDELANAWP----ALTPGVHRLEFDDGRVTLTLVFGDALDVLPNLA
MNMC_BURP0      ----------IAPLVDELANAWP----ALTPGVHRLEFDDGRVTLTLVFGDALDVLPNLA
MNMC_BURP1      ----------IAPLVDELANAWP----ALTPGVHRLEFDDGRVTLTLVFGDALDVLPNLA
MNMC_BURPS      ----------IAPLVDELANAWP----ALTPGVHRLEFDDGRITLTLVFGDALDVLPNLA
MNMC_BURMS      ----------IAPLVDELANAWP----ALTPGVHRLEFDDGRVTLTLVFGDALDVLPNLA
MNMC_BURP6      ----------IAPLVDELANAWP----ALTPGVHRLEFDDGRVTLTLVFGDALDVLPNLA
MNMC_BURTA      ----------IEPLVDALANAWP----ALTPGVHRLEFDEGRVTLTLAFGDALDVLPNLA
MNMC_PARPJ      ----------IAALAQALANAWP----TLVPGTHRLEFDEGRVVLTLVFGDAQERLPALR
MNMC_PARXL      ----------IAALAQALADAWP----MLVPGTHRLEFEEGRVVLTLVFADAQDSVPALR
MNMC_PARP8      ----------IAALAEQLANAWP----TLVPGTHRLEFEEGRVILTLVFGDAVQTLPTLW
MNMC_LEPCP      --------------AAQLIAAWP----LATPDLHLLDFEGGRVQLMLALGDIHDVLPGLQ
MNMC_METPP      --------------ARALVSAWP----LSTPNLHPIAFEGGRVQLLLGFGDVALLLPQLV
MNMC_BORBR      -----------QALATQLAAQWP----PLLPGLHRLEFEGGALTLTLGFGAAQQLAPRLT
MNMC_BORPA      -----------QALATQLAAQWP----PLLPGLHRLEFEGGALTLTLGFGAAQQLAPRLT
MNMC_BORPD      -----------QGLAGQLADQWP----ACLPGLHRLEFEGGAVTLTLAFGAASALAPHLR
MNMC_BORA1      -----------RAGARELLAQWP----KLLPGLHRLEFEHGAVTLTLALGDIGQVAPRLS
MNMC_AZOSB      -------------LAAELQANWP----CLAPGVHRLHLDGGRVCLTLYFGDARDGLAQLD
MNMC_AROAE      -------------LAAELADHWP----TLTPGMHRLHLNRGRVVLTLLFGDARELLPRLE
MNMC_DECAR      -------------LAAELQQKWP----PLVPGMHRLHLNDGQVILTLTFGDAATQLRSID
MNMC_THIDA      -------------LSEVLRGNWP----MLLPGFHRVALDGGRVQLTLMLGEAAECLHEVE
MNMC_ACIAC      -------------LARALHAQYW----GLLPGVHRLAFEGGQVLLTLYIGDAQAMLRQQQ
MNMC_ACISJ      -------------LAQQLAAQYW----GLLPGVHRLSFDGGQVLLTLYIGDAQALLRQQQ
MNMC_DELAS      -------------LAEELATRFQ----GLLPGVHRLAFEQGRVLLTLYIGDAQAMLRRQQ
MNMC_POLNA      -------------FAEQLKRQLW----GLLPGVHRLVFEGGQVLLTLCIGDTKAMLREPS
MNMC_POLSJ      -------------LARQLHDQLW----GLLPGFHRLVFEEGRVMLTLCIGDAKAMLREQS
MNMC_MAGMM      -------------HSAALVQAWP----PAVAGFHQRSLAQGRVTLTLLFGPAASMLAQLS
MNMC_LEPBJ      -------------IKEEFLSSYQ----DLIPGMNYFRFLEGKIHLTLFLGDVSDALCEIS
MNMC_LEPBL      -------------IKEEFLSSYQ----DLIPGMNYFRFLEGKIHLTLFLGDVSDALCEIS
MNMC_LEPIN      -------------IKKEFLSSYQ----DLIPGMNYFQFLGGKIHFSLFLGDVSSALCEIS
MNMC_LEPIC      -------------IKKEFLSSYQ----DLIPGMNYFQFLGGKIHFSLFLGDVSSALCEIS
MNMC_MARMS      -------------LSQQLIDAYP----EVCHGLHRIELEQGRIQLTLWFGEAEDGFAALD
MNMC_HYDCU      -------------PSNALLDVYP----LHLPGWHDVFLYDQRIRLTLWFGHVMKGLPEFD
MNMC_CAMJJ      ------------ELLEQFLKFYP----KAKEGIYRFYF--EDCFLDLVFEDI-AVLKELD
MNMC_CAMJ8      ------------ELLEQFLKFYP----KAKEGIYRFYF--EDCFLDLVFEDI-TILKELD
MNMC_CAMJR      ------------ELLEQFLKFYP----KAKEGIYRFYF--EDCFLDLVFEDI-AVLKELD
MNMC_CAMJE      ------------ELLEQFLKFYP----KAKEGIYRFYF--EDCFLDLVFEDI-AVLKELD
MNMC_CAMJD      ------------ELLEHFLKFYP----KAKEGIYRFYF--EDCFLDLVFEDI-TILKELD
MNMC_CAMC1      --------------VKKLVSLYP----PLISGIHRINF-APNITLDLCYGEADQILPELD
MNMC_CAMHC      ---------------KKLLKLYP----TLESGFHRIKF-SKNITLDLLFGDAECVLKECE
MNMC_CAMFF      --------------FDEFIEQYE----ILDGALIRIKLLNERVILDLYFGDILDAFDELS
MNMC_LEGPA      --------------TEKLIEHYP----VLTPGYHHLAFNNNQITLTLMLGDVLECYEQLL
MNMC_LEGPH      --------------AEKLIAHYP----VLTPGYHHLTFSNNQITLTLMLGDVLECYEQLL
MNMC_LEGPL      --------------TEKLIEHYP----VLTPGYHHLAFSNNRITLTLMLGDVLECYEQLL
MNMC_LEGPC      --------------AEKLIEHYP----VLTPGYHHLAFSNNQITLTLMLGDVLECYEQLL
MNMC_ACIBT      -------------LSKQLIEQYP----LPLAGCHRLSFPEERFSIDLWLGDAQDIFPSMV
MNMC_ACIBY      -------------LSKQLIEQYP----LPLAGCHRLSFPEERFSIDLWLGDAQDIFPSMV
MNMC_ACIBC      -------------LSKQLIEQYP----FPLAGCHRLSFPEERFSIDLWLGDAQDIFPSMV
MNMC_ACIAD      -------------LAEQLIEQYP----FPIAGCHRLNFPDERFSLDLWLGDAHDVFPSIV
MNMC_PSYA2      -------------LIEQLLASYP----PLIAGCHRLNFIEDNLTLDIWLGDASDSLASLD
MNMC_PSYCK      -------------LIEQLLTSYP----PLIAGCHRLDFIDDNLTLDIWLGDANDSLASLD
MNMC_PSYWF      -------------FVDQLLALYP----TLISGCHRLQLAED-VTLDLWLGDACFSLQQLA
MNMC_PSEAE      -------------WSEALLGQYL----AVHPGFQRLAFAGGRVGLTLLLGDA----LECL
MNMC_PSEAB      -------------WSEALLGQYL----AVHPGFQRLAFAGGRIGLTLLLGDA----LECL
MNMC_PSEA7      -------------WSEPLLGQYL----ALHPGFQRLAFAGGRVGLTLLLGDA----LECL
MNMC_PSEMY      -------------YAEQLLAQYR----AIHPGFQRLLLDGGRVVLTLMIGDV----LECL
MNMC_PSEP1      -------------YTEPLLEQYV----AVHPGFQQFTFAGGRVTLTLLIGDV----LEQL
MNMC_PSEPK      -------------YTEPLLEQYV----AVHPGFQQFTFTGGRVTLTLLIGDV----LEQL
MNMC_PSEPG      -------------YTEPLLEQYV----AVHPGFQQFTFANGRVTLTLLIGDV----LEQL
MNMC_PSEPW      -------------FTEPFLRQYV----AVHQGFQQFTFDQGRITLTLLIGDV----LEQL
MNMC_PSEE4      -------------FTQPLLEQYV----AIHPGFQQFSLDGGQVTLNLMIGDA----LEQL
MNMC_PSEF5      -------------FSAPLLEQYV----AVHGGFQRIVLEGGRVILTLLIGDA----LEQL
MNMC_PSEPF      -------------FSDQLLKHYV----AIHQGFQRIVLDNGRITLTLLIGDA----LEQL
MNMC_PSE14      -------------FARQLLDQYV----AVHEGFQRLAFDDGRVTLTLLIGDA----LQML
MNMC_PSEU2      -------------FAGQLLDQYV----AVHEGFQRLVFAGGRVTLTLLIGDA----LQML
MNMC_PSESM      -------------FADQLLGQYV----AIHEGFQRLVFDNGRVTLTLLIGDA----LQML
MNMC_PSEU5      -------------QAEQLLEQYV----ALNPGYQRLVFAGGRVVLTLLIGDV----LECL
MNMC_CHRVO      -------------WSSQLLAQYD----VLTPGWHRFVLAGGRVTLTLMIGDV----LEVL
MNMC_METFK      -------------YSTALLAQYH----QIVPGWQRLVFCQGRVQLTLLVGDV----LALL
MNMC_NITMU      -------------YADELMLRWQ----RRVPGWNRWSFAGGRVRLTLAIEDV----TRAL
MNMC_CHRSD      -------------RAGVLLDQWP----EPVGGVHRLWLSS-RVVLDLHFGDA----AERL
MNMC_HAHCH      -------------FARQLRAQYP----APMQGVHRCRFVDQGVTLTLYLGDV----VDWL
MNMC_MARN8      -------------LARELIDNYP----PLIKGTHRLVLGGGAIRLTLCFGDV----LDAW
MNMC_IDILO      -------------FSQSFLEHYP----ATDPGCHRIILSQGRVILDLWIGDLNELLPEWL
MNMC_PSEA6      -------------DAKALIAQYP----MPLDGCHRMSFLNNRVIVDLWLGDIHDSLPQWH
MNMC_PSET1      -------------LSEQLISQYP----INLAGCHRLEFNNGTIVLDLYFGDALESIKTMS
MNMC_COLP3      -------------LALTFINSYPDCPVEEFGQEFKTTFFNGQVRLTLIFDDAAQGFSSLN
MNMC_SHEB5      LESKQASALECKPELSQLAQTLLDAEPTAIIGCQRLIFDDGRTTIDLHFGDIQTQLSSLS
MNMC_SHEB9      LESKQASALECKSKLSQLAQTLLDAEPTAIIGCQRLIFDDGRTTIDLHFGDIQTQLSSLT
MNMC_SHEB8      ------------PELEPLAQRLLHAEPAAIIGCQRLIFDDGRFTIDLHFGDIQSQLSSLI
MNMC_SHEPC      ------------PELELLAQCLLHTEPTAIIGCQRLIFDDGRTTIDLHFGDIQSQLSSLI
MNMC_SHESW      ------------PELELLAQRLLHTEPTAIIGCQRLIFDDGRTTIDLHFGDIQSQLSSLI
MNMC_SHESM      ------------SHLQPIANAILKAKPARIIGCQRLIFDDGRITVDLHFGDLHTALSQLP
MNMC_SHESR      ------------SHLQPIANAILKAKPARIIGCQRLIFDDGRITVDLHFGDLHSALSQLP
MNMC_SHESA      ------------PHLQPIANAILKAKPARIIGCQRLIFDDGRITVDLHFGDLHTSLTNLP
MNMC_SHEON      ------------PHLQPIANAIIEAKPARIIGCQRLIFDDGRISLDLDFGDLQTMLVNQP
MNMC_SHEDO      ------------SPVAPQAEQFIAGKMAQINGAQRFILEQGQLRIDVHFGDLHSNLTELM
MNMC_SHEFN      ------------HHLFDFTQALLNGEIAAIEGCQRLSLLQNQIIIDLYQGSPLAQAKTIA
MNMC_SHESH      ------------DEQSTMVEALLRADIVAIEGCQRLIFDDGRVILDIYLGDTLSQLKCIL
MNMC_SHEWM      -------------KQGSFIQTLTEADPIEILGCQRLIFDDGRFVIDLYLNSPIASLKSMR
MNMC_SHELP      -------------LASPAKEQIKAICDARVSGSHRLKLVNARLIIDIHLGDPLTQLKDLV
MNMC_SHEAM      --------------EPPLWQWLLAAAQVNSAYPETNAAYASNASITSIQHTSKKPLQIIM
MNMC_SACD2      -------------LSEQLCALYPP---SSAPGFHHITLDEGQVQLTLYFGDAKTGLEQLV
MNMC_DICNV      --------------RIALYQNYPH-----RASGMHLIRLHPRVCLLLLWGDATRCYQACM
                                                            .               

MNMC_ECOLI      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_ECODH      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_SHIB3      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_SHIBS      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_ECOLC      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_ECOHS      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_SHIFL      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_SHIF8      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_SHISS      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_ECO57      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_SHIDS      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_ECOK1      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_ECOUT      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_ECOL6      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_ECOL5      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_ECOSM      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_ECO24      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_CITK8      ESLNQ----------------KVDAWFLD------------------------------G
MNMC_SALPA      ATLNQ----------------TVDAWFLD------------------------------G
MNMC_SALTY      ATLNQ----------------TVDAWFLD------------------------------G
MNMC_SALPB      ATLNQ----------------TVDAWFLD------------------------------G
MNMC_SALCH      ATLNQ----------------TVDAWFLD------------------------------G
MNMC_SALTI      ATLNQ----------------TVDAWFLD------------------------------G
MNMC_SALAR      ATLNQ----------------KVDAWFLD------------------------------G
MNMC_ENT38      DSLNQ----------------KVDAWFLD------------------------------G
MNMC_KLEP7      DSLNQ----------------QVDAWFLD------------------------------G
MNMC_CROS8      DTHNR----------------QVDAWFLD------------------------------G
MNMC_YERPG      DSLNN----------------QVDAWFLD------------------------------G
MNMC_YERPY      DSLNN----------------QVDAWFLD------------------------------G
MNMC_YERPE      DSLNN----------------QVDAWFLD------------------------------G
MNMC_YERPA      DSLNN----------------QVDAWFLD------------------------------G
MNMC_YERPN      DSLNN----------------QVDAWFLD------------------------------G
MNMC_YERPP      DSLNN----------------QVDAWFLD------------------------------G
MNMC_YERPS      DSLNN----------------QVDAWFLD------------------------------G
MNMC_YERPB      DSLNN----------------QVDAWFLD------------------------------G
MNMC_YERP3      DSLNN----------------QVDAWFLD------------------------------G
MNMC_YERE8      SSLNN----------------QVDAWFLD------------------------------G
MNMC_SERP5      ASMHR----------------QIDAWFLD------------------------------G
MNMC_PECAS      DTQNH----------------QVDAWFLD------------------------------G
MNMC_PHOLL      SSLHG----------------KIDAWFLD------------------------------G
MNMC_VIBCH      TQEQG----------------LVDAWFLD------------------------------G
MNMC_VIBC3      TQEQG----------------LVDAWFLD------------------------------G
MNMC_VIBCB      YAEQG----------------LIDAWFLD------------------------------G
MNMC_VIBPA      YNEQG----------------LIDAWFLD------------------------------G
MNMC_VIBVU      YGEEG----------------IIDTWFLD------------------------------G
MNMC_VIBVY      YGEEG----------------IIDTWFLD------------------------------G
MNMC_ALIF1      MDDKG----------------LIDAWFLD------------------------------G
MNMC_PHOPR      TNDDG----------------IVDAWFTDFSQIEAADIHQTTEGTTTESITIENNASESS
MNMC_AERHH      HPADG----------------LVDAWYLD------------------------------G
MNMC_AERS4      HGEQG----------------LVDTWYLD------------------------------G
MNMC_PSYIN      VYDCG----------------LFDCWYLD------------------------------G
MNMC_ACTPJ      DLYTN----------------RIDAWFLD------------------------------G
MNMC_ACTP2      DLYTN----------------RIDAWFLD------------------------------G
MNMC_HAEDU      DLYNA----------------TVDSWFLD------------------------------G
MNMC_HAEIN      DYMNE----------------RINAWFLD------------------------------G
MNMC_HAEIG      DYMNE----------------RIDAWFLD------------------------------G
MNMC_HAEI8      DYMNE----------------RIDAWFLD------------------------------G
MNMC_HAEIE      DYMNE----------------RIDAWFLD------------------------------G
MNMC_HAES1      DYMQN----------------RIDAWFLD------------------------------G
MNMC_HISS2      DYMQN----------------RIDAWFLD------------------------------G
MNMC_PASMU      DYMCN----------------KIDAWFLD------------------------------G
MNMC_MANSM      DYMVN----------------KIDAWFLD------------------------------G
MNMC_ACTSZ      DYMQN----------------RIDAWFLD------------------------------G
MNMC_CAUVC      GLADA--------------------WFLDGFSP---------------------------
MNMC_CAUSK      GAADA--------------------WFLDGFSP---------------------------
MNMC_MARMM      RPVDA--------------------WFLDGFAP---------------------------
MNMC_HYPNA      FRADA--------------------WFLDGFSP---------------------------
MNMC_CUPNH      AGADA--------------------FYLDGFAP---------------------------
MNMC_CUPPJ      AGADA--------------------FYLDGFSP---------------------------
MNMC_CUPMC      LGADA--------------------FYLDGFSP---------------------------
MNMC_RALSO      CAADA--------------------FYLDGFSP---------------------------
MNMC_BURCM      ARADA--------------------FYLGNVAS---------------------------
MNMC_BURA4      ARADA--------------------FYLGNLAS---------------------------
MNMC_BURCA      ARADA--------------------FFLDGAAA---------------------------
MNMC_BURCH      ARADA--------------------FFLDGAAA---------------------------
MNMC_BURCC      ARADA--------------------FFLDGAAA---------------------------
MNMC_BURL3      ARADA--------------------FCLDGLAS---------------------------
MNMC_BURVG      ARADA--------------------FYLDGFAP---------------------------
MNMC_BURM1      ARADA--------------------FYLDGFAP---------------------------
MNMC_BURMA      LRAHA--------------------FYLDGFAP---------------------------
MNMC_BURM9      LRAHA--------------------FYLDGFAP---------------------------
MNMC_BURM7      LRAHA--------------------FYLDGFAP---------------------------
MNMC_BURP0      LRAHA--------------------FYLDGFAP---------------------------
MNMC_BURP1      LRAHA--------------------FYLDGFAP---------------------------
MNMC_BURPS      LRAHA--------------------FYLDGFAP---------------------------
MNMC_BURMS      LRAHA--------------------FYLDGFAP---------------------------
MNMC_BURP6      LRAHA--------------------FYLDGFAP---------------------------
MNMC_BURTA      LRADA--------------------FYLDGFAP---------------------------
MNMC_PARPJ      LRADA--------------------FYLDGFAP---------------------------
MNMC_PARXL      LRADA--------------------FYLDGFAP---------------------------
MNMC_PARP8      LRADA--------------------FYLDGFSP---------------------------
MNMC_LEPCP      AEAHS--------------------LYLDGFVP---------------------------
MNMC_METPP      VSVDA--------------------FFLDGFAP---------------------------
MNMC_BORBR      ARVDA--------------------YFLDGFAP---------------------------
MNMC_BORPA      ARVDA--------------------YFLDGCAP---------------------------
MNMC_BORPD      ARVDA--------------------YFLDGFAP---------------------------
MNMC_BORA1      ACVDA--------------------FFLDGFAP---------------------------
MNMC_AZOSB      ARADA--------------------FLLDGFSP---------------------------
MNMC_AROAE      CGADA--------------------FFLDGFSP---------------------------
MNMC_DECAR      ASVDA--------------------FFLDGFSP---------------------------
MNMC_THIDA      ARVDA--------------------FYLDGFAP---------------------------
MNMC_ACIAC      PVADA--------------------VYLDGFSP---------------------------
MNMC_ACISJ      PTADS--------------------VYLDGFDP---------------------------
MNMC_DELAS      ITADS--------------------IYLDGFTP---------------------------
MNMC_POLNA      FEADS--------------------VYLDGFSP---------------------------
MNMC_POLSJ      FEADS--------------------VYLDGFNPG--------------------------
MNMC_MAGMM      ATVDG--------------------WYLDGFAP---------------------------
MNMC_LEPBJ      GKADA--------------------IFLDGFAP---------------------------
MNMC_LEPBL      GKADA--------------------IFLDGFAP---------------------------
MNMC_LEPIN      GKVDA--------------------IFLDGFAP---------------------------
MNMC_LEPIC      GKVDA--------------------IFLDGFAP---------------------------
MNMC_MARMS      ADVDA--------------------WFLDGFAP---------------------------
MNMC_HYDCU      VQVDA--------------------WFLDGFTP---------------------------
MNMC_CAMJJ      FKADI--------------------WYLDGFSP---------------------------
MNMC_CAMJ8      FKADI--------------------WYLDGFSP---------------------------
MNMC_CAMJR      FKADV--------------------WYLDGFSP---------------------------
MNMC_CAMJE      FKADV--------------------WYLDGFSP---------------------------
MNMC_CAMJD      FKADV--------------------WYLDGFSP---------------------------
MNMC_CAMC1      FAADI--------------------WFLDGFAP---------------------------
MNMC_CAMHC      FKADI--------------------WLMDGFSP---------------------------
MNMC_CAMFF      FRADA--------------------WYLDGFSP---------------------------
MNMC_LEGPA      FCGDINLEHQLR-------ESYVNAWYLDGFSP---------------------------
MNMC_LEGPH      FCGDINLEHQLR-------ESYVNAWYLDGFSP---------------------------
MNMC_LEGPL      FCGDINLEHQLR-------ESYVNAWYLDGFSP---------------------------
MNMC_LEGPC      FCGDINLEQQLR-------ESYVNAWYLDGFSP---------------------------
MNMC_ACIBT      KTKAVN------------------AWFLDGFAP---------------------------
MNMC_ACIBY      KTKAVN------------------AWFLDGFAP---------------------------
MNMC_ACIBC      KTKAVN------------------AWFLDGFAP---------------------------
MNMC_ACIAD      KTHSVD------------------AWFLDGFAP---------------------------
MNMC_PSYA2      GVVTTQ-------------RPYINAWFLNGFAH---------------------------
MNMC_PSYCK      STVATQ-------------RPYINAWFLDGFAP---------------------------
MNMC_PSYWF      NSYDTLPY-----------GAHIDAWYLDGFAP---------------------------
MNMC_PSEAE      PQLDAR----------------VDAWFLDGFAP---------------------------
MNMC_PSEAB      PQLDAR----------------VDAWFLDGFAP---------------------------
MNMC_PSEA7      PQLDAR----------------IDAWFLDGFAP---------------------------
MNMC_PSEMY      PQLDAR----------------IDAWFLDGFAP---------------------------
MNMC_PSEP1      PQLDAQ----------------IDVWFLDGFAP---------------------------
MNMC_PSEPK      PQLDAQ----------------IDVWFLDGFAP---------------------------
MNMC_PSEPG      PQLDAQ----------------IDVWFLDGFAP---------------------------
MNMC_PSEPW      PQLDAR----------------IDVWFLDGFAP---------------------------
MNMC_PSEE4      PQLDAR----------------IDAWFLDGFAP---------------------------
MNMC_PSEF5      PQLDAQ----------------VDAWFLDGFAP---------------------------
MNMC_PSEPF      PQLDGQ----------------IDAWFLDGFAP---------------------------
MNMC_PSE14      PQLDGQ----------------IDAWFLDGFAP---------------------------
MNMC_PSEU2      PQLDGQ----------------MDAWFLDGFAP---------------------------
MNMC_PSESM      PQLDGQ----------------IDAWFLDGFAP---------------------------
MNMC_PSEU5      PSLDAR----------------IDAWFLDGFAP---------------------------
MNMC_CHRVO      PQLDAR----------------VDAWFLDGFAP---------------------------
MNMC_METFK      PQLSSH----------------ADAWFLDGFAP---------------------------
MNMC_NITMU      PETHG-----------------IDAWFLDGFSP---------------------------
MNMC_CHRSD      SRLDGR----------------VDAWFLDGFSP---------------------------
MNMC_HAHCH      SDCSFK----------------ADAWFLDGFSP---------------------------
MNMC_MARN8      NELEFV----------------ADAWFLDGFAP---------------------------
MNMC_IDILO      PQAQKQ----------------IDAWFLDGFAP---------------------------
MNMC_PSEA6      TNENG----------------LVDAWYLDGFAP---------------------------
MNMC_PSET1      YPRSG----------------IVDAWFLDGFAP---------------------------
MNMC_COLP3      CSKEG----------------LVDAWYLDGFTP---------------------------
MNMC_SHEB5      HSPMHP----------------VQHWLILPHL----------------------------
MNMC_SHEB9      HSPMHP----------------VQHWLILPHL----------------------------
MNMC_SHEB8      HSPMHP----------------VQHWLILPHL----------------------------
MNMC_SHEPC      HSPLHP----------------VQHWLVLPHL----------------------------
MNMC_SHESW      HSPLHP----------------VQHWLVLPHL----------------------------
MNMC_SHESM      HSADHP----------------IQQWLVLPHL----------------------------
MNMC_SHESR      HSPAHL----------------IQQWLVLPHL----------------------------
MNMC_SHESA      HSPAHP----------------IQQWLVLPHL----------------------------
MNMC_SHEON      HCGTYP----------------IQQWLILPHL----------------------------
MNMC_SHEDO      TP-EHR----------------VTHWHCLPHIAHTQTEFAETQ-----------ASQLQF
MNMC_SHEFN      TPNKQR----------------ITHWFALPHT----------------------------
MNMC_SHESH      PTSVKGDMTDN--------SALIAHWNITEKVK---------------------------
MNMC_SHEWM      LPTCDGSDDDK--------SPLFDLWTISQTNSN--------------------------
MNMC_SHELP      SPSLA--------------SQAIQGWLANTQAT---------------------------
MNMC_SHEAM      LLKDEA----------------ELNALAMDAS----------------------------
MNMC_SACD2      LAHGAINKIENRSSCIGDKQQLVDAWYFDGFTP---------------------------
MNMC_DICNV      ARVNA--------------------WFLDGFAP---------------------------
                                                                            

MNMC_ECOLI      FAPAKNPDMWTQNLFNAMARLARPGGTLATFTSA-----GFVRRGLQDAGFTMQKR----
MNMC_ECODH      FAPAKNPDMWTQNLFNAMARLARPGGTLATFTSA-----GFVRRGLQDAGFTMQKR----
MNMC_SHIB3      FAPAKNPDMWTQNLFNAMARLARPGGTLATFTSA-----GFVRRGLQDAGFTMQKR----
MNMC_SHIBS      FAPAKNPDMWTQNLFNAMARLARPGGTLATFTSA-----GFVRRGLQDAGFTMQKR----
MNMC_ECOLC      FAPAKNPDMWTQNLFNAMARLARPGGTLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_ECOHS      FAPAKNPDMWTQNLFNAMARLARPGGTLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_SHIFL      FAPAKNPDMWTQNLFNAMARLARPGGTLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_SHIF8      FAPAKNPDMWTQNLFNAMARLARPGGTLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_SHISS      FAPAKNPDMWTQNLFNAMARLARPGGTLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_ECO57      FAPAKNPDMWTQNLFNAMARLARPGGTLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_SHIDS      FAPAKNPDMWTQNLFNAMARLARPSGTLATFTSA-----GFVRRGLQDAGFTMQKR----
MNMC_ECOK1      FAPAKNPDMWTQNLFNAMARLARPGSTLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_ECOUT      FAPAKNPDMWTQNLFNAMARLARPGSTLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_ECOL6      FAPAKNPDMWTQNLFNAMARLARPGSTLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_ECOL5      FAPAKNPDMWTQNLFTAMARLARPGGTLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_ECOSM      FAPAKNPDMWTQNLFKAMARLARPGGTLATFTSA-----GFVRRGLQEAGFSMQKR----
MNMC_ECO24      FAPAKNPDMWTQNLFNAMARLARPGGTLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_CITK8      FAPAKNPDMWTQNLFSTMARLARPGGTLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_SALPA      FAPAKNPDMWTPNLFNAMARLARPGATLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_SALTY      FAPAKNPDMWTPNLFNAMARLARPGATLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_SALPB      FAPAKNPDMWTPNLFNAMARLARPGATLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_SALCH      FAPAKNPDMWTPNLFNAMARLARPGATLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_SALTI      FAPAKNPDMWTPNLFNAMARLARPGATLATFTSA-----GFVRRGLQEAGFTMQKH----
MNMC_SALAR      FAPAKNPDMWTPNLFNTMARLARPGATLATFTSA-----GFVRRGLQEAGFTMQKR----
MNMC_ENT38      FAPAKNPDMWSEHLFAAMARLARPGATLATFTCA-----GFVRRGLQDAGFTMQKC----
MNMC_KLEP7      FAPAKNPDMWTQDLFSAMARLARPGGTLATFTSA-----GFVRRGLQEAGFTMRKS----
MNMC_CROS8      FAPSKNPEMWTPGLFTAMARLARPGGTLATFTSA-----GFVRRGLIEAGFDVVKR----
MNMC_YERPG      FAPAKNPDMWNEQLFNAMARMTRPGGTFSTFTAA-----GFVRRGLQQAGFNVTKV----
MNMC_YERPY      FAPAKNPDMWNEQLFNAMARMTRPGGTFSTFTAA-----GFVRRGLQQAGFNVTKV----
MNMC_YERPE      FAPAKNPDMWNEQLFNAMARMTRPGGTFSTFTAA-----GFVRRGLQQAGFNVTKV----
MNMC_YERPA      FAPAKNPDMWNEQLFNAMARMTRPGGTFSTFTAA-----GFVRRGLQQAGFNVTKV----
MNMC_YERPN      FAPAKNPDMWNEQLFNAMARMTRPGGTFSTFTAA-----GFVRRGLQQAGFNVTKV----
MNMC_YERPP      FAPAKNPDMWNEQLFNAMARMTRPGGTFSTFTAA-----GFVRRGLQQAGFNVTKV----
MNMC_YERPS      FAPAKNPDMWNEQLFNAMARMTRPGGTFSTFTAA-----GFVRRGLQQAGFNVTKV----
MNMC_YERPB      FAPAKNPDMWNEQLFNAMARMTRPGGTFSTFTAA-----GFVRRGLQQAGFNVTKV----
MNMC_YERP3      FAPAKNPDMWNEQLFNAMARMTRPGGTFSTFTAA-----GFVRRGLQQAGFNVTKV----
MNMC_YERE8      FAPAKNPDMWNDVLFNAMARMARPGGTFATFTAA-----GFVRRGLQQAGFDVAKI----
MNMC_SERP5      FAPSKNPDMWTEQLFAAMARFARPGGSLATFTAA-----GFVRRGLQQAGFEVIKS----
MNMC_PECAS      FAPSKNPDMWTDNLFQAMARLCRKEGTFATFTAA-----GFVRRGLQQAGFHVSKV----
MNMC_PHOLL      FAPAKNPQMWSEQLFTAMAQFAHPEGTFATFTSA-----GIVRRGLQQAGFNVSKI----
MNMC_VIBCH      FAPSKNPEMWNQNLFAGMAKLAKHGCTCATFTSA-----GFVRRGLIDAGFAMKKV----
MNMC_VIBC3      FAPSKNPEMWNQGLFAGMAKLAKHGCTCATFTSA-----GFVRRGLIDAGFAMKKV----
MNMC_VIBCB      FAPSKNPEMWNQNLFNGMAKLAKQDCTVATFTAA-----GFVRRGLNEAGFAMKKV----
MNMC_VIBPA      FAPSKNPEMWNQNLFNNMAKLAKQDCTVATFTAA-----GFVRRGLNEAGFAMKKV----
MNMC_VIBVU      FAPSKNPEMWNQDLFNGMAKLARSECRVATFTSA-----GFVRRGLIEAGFAMKKV----
MNMC_VIBVY      FAPSKNPEMWNQDLFNGMAKLARSECRVATFTSA-----GFVRRGLIEAGFAMKKV----
MNMC_ALIF1      FAPSKNPEMWNQTLFNNMASLAKKGCTCATFTAA-----GFVRRGLIEAGFDMKKV----
MNMC_PHOPR      ATESNAALLKSLTIINSIAILARENSTIHAITYHQGNQQDVLEQSLTEAGFDMTESHNHR
MNMC_AERHH      FSPAKNPEMWTQALFDGLARLARPHATIATFTCA-----GFVRRGLIAAGFAMQKV----
MNMC_AERS4      FAPAKNPEMWTQDLFDGLARLARPGATLSTFTSA-----GFVRRGLIAAGFAMKKV----
MNMC_PSYIN      FAPSKNPEMWNDDLFQLISQSCKKDATIATFTAA-----SFVRKGLIKAGFEMGKQ----
MNMC_ACTPJ      FSPDKNPEMWNETLYRQMFSLTKNGGSFATFTAA-----STVRKGLQAVGFEVKKR----
MNMC_ACTP2      FSPDKNPEMWNETLYRQMFSLTKNGGSFATFTAA-----STVRKGLQAVGFEVKKR----
MNMC_HAEDU      FSPDKNPTMWHEQLYQHMFRLTRVGGSFATFTAA-----SHVRCGLQAVGFTVYKR----
MNMC_HAEIN      FAPSKNPEMWNDDLYNLMFRFTKPNGTFATFTAA-----SAVRKGLESAGFNVTKR----
MNMC_HAEIG      FAPSKNPEMWNDDLYNLIFRFTKPNGTFATFTAA-----SAVRKGLESAGFNVTKR----
MNMC_HAEI8      FAPSKNPEMWNDDLYKLMFRFTKPNGSFATFTAA-----SAVRKGLESAGFNVTKR----
MNMC_HAEIE      FAPSKNPEMWNDDLYNLMFRFTKPNGSFATFTAA-----SAVRKGLESAGFNVTKR----
MNMC_HAES1      FSPSKNPQMWNDKLYQQIFYYSKPQGTFATFTAA-----SAVRKGLISAGFEVQKR----
MNMC_HISS2      FSPSKNPQMWNDELYQQMFYYSKPQGTFSTFTAA-----SAVRKGLVSAGFEVQKR----
MNMC_PASMU      FAPSKNPQMWQDTLYQHMYRYTKTQGTFSTFTAA-----SAVRKGLIHAGFTVTKR----
MNMC_MANSM      FAPSKNPEMWNENLYKQMFRYTKPAGTFATFTAA-----SAVKKGLESAGFSLQKR----
MNMC_ACTSZ      FSPSKNPDMWNETVYRLMYRYTKPQGTFATFTAA-----SAVKKGLESAGFRVEKR----
MNMC_CAUVC      ---ALNPAMWRDEVLAAVGARSAPGARAATFTVA-----GAVRRGLSAAGFEIAKR----
MNMC_CAUSK      ---ALNPAMWREEILAAVAARSAPGARAATFTVA-----GAVRRGLSAAGFQVDRR----
MNMC_MARMM      ---DRNAAMWSQAVFNRLGELSVPGTRVGTFTVA-----GFVRRGLAEAGFDVAKR----
MNMC_HYPNA      ---AKNAGMWAGDIFPLIAARSAPGARAATFTVA-----GDVRRGLAEAGFEVRKA----
MNMC_CUPNH      ---ARNTEMWSPQVFRGLARLARPGARLATWAAA-----GFVRRGLKEVGFEVSRA----
MNMC_CUPPJ      ---SRNADMWSPLVFRGLARLARPGATLATYTAA-----GFVRRGLREAGFDARKA----
MNMC_CUPMC      ---SRNAEMWSDTVFRGLARLARIGATLATYTAA-----GFVRRGLTAAGFEAHKA----
MNMC_RALSO      ---AKNPDLWQPGVFKQLARIARGGATLATYTAA-----GAVRHGLREAGFEVRKA----
MNMC_BURCM      ---AAHGDVLSADVIRALARIAADGATYATHSHD-----DTVKHALEQTGFTSRDV----
MNMC_BURA4      ---AAHGDVLSADVIRALARIAADGATYATHSHD-----DAVKHALEQTGFTSRDV----
MNMC_BURCA      ---SG-------DGIRALAKLAGEHATFATHAKS-----DDVKHALGETGFTFREV----
MNMC_BURCH      ---SG-------DGIRALAKLAGEHATFATHAKS-----DDVKHALGETGFTFREV----
MNMC_BURCC      ---SS-------DGIRALAKLAGEHATFATHAKS-----DDVKHALGETGFTFREV----
MNMC_BURL3      ---SSDADLQSTDVVRALSKIAGEHATFAVHASS-----DALKHALGKSGFTYREV----
MNMC_BURVG      ---AKNADLWSADVFRALARVAADDATFATYSSA-----GVVKQALVEAGFAYRKM----
MNMC_BURM1      ---SKNADLWSIDVFRALARMADEHATFATYSSS-----GVVKRALDEAGFAYRKV----
MNMC_BURMA      ---SKNADLWSPAIFKSLAKLADERATFATYTSS-----GAVKRALDEAGFAYRKV----
MNMC_BURM9      ---SKNADLWSPAIFKSLAKLADERATFATYTSS-----GAVKRALDEAGFAYRKV----
MNMC_BURM7      ---SKNADLWSPAIFKSLAKLADERATFATYTSS-----GAVKRALDEAGFAYRKV----
MNMC_BURP0      ---SKNADLWSPAIFKSLAKLADERATFATYTSS-----GAVKRALDEAGFAYRKV----
MNMC_BURP1      ---SKNADLWSPAIFKSLAKLADERATFATYTSS-----GAVKRALDEAGFAYRKV----
MNMC_BURPS      ---SKNADLWSPAIFKSLAKLADERATFATYTSS-----GAVKRALDEAGFAYRKV----
MNMC_BURMS      ---SKNADLWSPAIFKSLAKLADERATFATYTSS-----GAVKRALDEAGFAYRKV----
MNMC_BURP6      ---SKNADLWSPAIFKSLAKLADERATFATYTSS-----GAVKRALDEAGFAYRKV----
MNMC_BURTA      ---SKNADLWSPAIFKSLAKLADEHATFATYTSS-----GAVKRALDEAGFAYRKV----
MNMC_PARPJ      ---ARNPELWTPMIFKALARLAGEGATFATCSSA-----GDIKRALIQCGFEYRKV----
MNMC_PARXL      ---ARNPELWTSAIFKALARLAGEGATFATYSSA-----GDIKRALTQCGFEYRKV----
MNMC_PARP8      ---DRNPDLWTPAVFKSLARLAGDEATFATYTSS-----GDVKRSLQQAGFEYRKV----
MNMC_LEPCP      ---ARNPAMWSADVFKRIARLAAPGAMAASGHAD-----SAVRDGLVRQGFEVRAT----
MNMC_METPP      ---ARNPEMWEPRRLQRLGRLAAPGATAATWSAA-----RVVRDGLSAAGFTVETT----
MNMC_BORBR      ---RGNPAMWDPHMLQALARLAAPDATLASWCSA-----GQVRQALQQAGFAVRRA----
MNMC_BORPA      ---RGNPAMWDPHMLQALARLAAPDATLASWCSA-----GQVRQALQQAGFAVRRA----
MNMC_BORPD      ---DRNPELWQPALMRDLARMAAPDATLATWACA-----GSVRQALRDAGFRVRKQ----
MNMC_BORA1      ---SKNPAMWDTYVLRRLLRLGAADATLATWTSA-----GFVRRGLQEAGFDIQRL----
MNMC_AZOSB      ---AKNPDLWSARIFHLLARLAAADATLATWSVA-----GEVREGLRRAGFEVEKA----
MNMC_AROAE      ---ACNPELWSAALLAELGRLAASGATLATWSVS-----GDVRRALAAAGFDCEKA----
MNMC_DECAR      ---PKNPELWSPHFCKGLARLTAPGATLATWSVA-----GHVRQALKDAEFDVAKR----
MNMC_THIDA      ---DRNTDLWQPQLFETLAWLANPGATAATYTVA-----APVLQGLTQAGFACEKR----
MNMC_ACIAC      ---QVNPELWDVHTLKAVARCCRRGTRLATWSVA-----GAVREGLAQCGFRVQKV----
MNMC_ACISJ      ---QHNPQMWDIHTLKAVARCCRRGTRLATWTVA-----RGVRDGLVQCGFEVQKV----
MNMC_DELAS      ---ELNPDLWSADTLRALARHCRRGTQLSTWCVA-----RTVRDGLAQHGFQVRKV----
MNMC_POLNA      ---QRNPDIWDVHTFKAVARCCRRGTRIATWTIA-----RSVRDALAQCGFVVKKV----
MNMC_POLSJ      LKPADSPDIWDLHTFKAVARCCRRGTRVATWTVA-----RSVRDALAQCGFVVKKT----
MNMC_MAGMM      ---SRNPEMWSDTLFAQLSRLSRLGTRLASFTVA-----GTVKRGLRAQGFTLHKA----
MNMC_LEPBJ      ---SKNPEMWEESVLGNLKNVSKFGTTFSTFTVA-----RTVRNSLSYAGFTLEKR----
MNMC_LEPBL      ---SKNPEMWEESVLGNLKNVSKFGTTFSTFTVA-----RTVRNSLSYAGFTLEKR----
MNMC_LEPIN      ---SKNPEMWDKSVLENLKYVSKKGTTLSTFTVA-----RMVRDSLSFSGFKLEKR----
MNMC_LEPIC      ---SKNPEMWDKSVLENLKYVSKKGTTLSTFTVA-----RMVRDSLSFSGFKLEKR----
MNMC_MARMS      ---SKNPEMWSDNLFKHIHRLSHQGTTFSTFTAA-----GIVRRGLKNVGFDVRKV----
MNMC_HYDCU      ---RKNPDMWQSELYLQMARLSNEATTFATFTAA-----GDVRRGLAQYGFEVEKA----
MNMC_CAMJJ      ---NKNSQMFDGNLIFEVARLSKKNTQICTFSSA-----SFLQKNLKKYGFRVEKT----
MNMC_CAMJ8      ---NKNSQMFDENLIFEVARLSKKNTQICTFSSA-----SFLQKNLKKYGFRVEKT----
MNMC_CAMJR      ---NKNLQMFDENLIFEVARLSKKNTQICTFSSA-----SFLQKNLKKYGFRVEKT----
MNMC_CAMJE      ---NKNSQMFDENLIFEVARLSKKNTQICTFSSA-----SFLQKNLKKYGFRVEKT----
MNMC_CAMJD      ---NKNSQMFDENLIFEVARLSKKNTQICTFSSA-----SFLQKNLKKYGFRVEKT----
MNMC_CAMC1      ---SKNGSIWSEDVFKQIARLSRVGTIARTYSCA-----KIVKVGLKNAGFLLSLK----
MNMC_CAMHC      ---SKNPDMWSDEITSQIARLCRIKAKIATYSAS-----KKVQKSLENAGFCVVKT----
MNMC_CAMFF      ---TKNPDMWSKEVFDRLSKFCKNRAKVRTFSSA-----KIVQNRFLEHGFSIKKL----
MNMC_LEGPA      ---SKNQSMWSDNLFTVIAMLSKESTTVATYSAS-----SIVKTALTNAGFVIEKR----
MNMC_LEGPH      ---SKNQSMWSDNLFTVIAMLSKESTTVATYSAS-----SIVKTALTNAGFVIEKR----
MNMC_LEGPL      ---SKNQSMWSDNLFTVIAMLSKESTTVATYSAS-----SIVKTALTNAGFVINKR----
MNMC_LEGPC      ---SKNQSMWSDNLLTVIAMLSKEGTTVATYSAS-----SIVKTALTNAGFVIEKR----
MNMC_ACIBT      ---SCNPDMWEQNVLNNIVRLSDYGTTFASFSVA-----GVLKRGLKAHGIDISRP----
MNMC_ACIBY      ---SCNPDMWEQNVLNNIVRLSNYGTTFASFSVA-----GVLKRGLKAHGIDISRP----
MNMC_ACIBC      ---SCNPDMWEQNVLNNIVRLSDYGTTFASFSVA-----GILKRGLKAHGVDITRP----
MNMC_ACIAD      ---SCNPELWETQVLNQIVRLSDYGTTFASFSVA-----GILKRGLKAHGIHISRP----
MNMC_PSYA2      ---SCNETLWTERIFSQIQRLSRADTTAATYSCA-----GIVKRGLQSQGFVIKKS----
MNMC_PSYCK      ---SCNEILWTERIFSHMQRLSRAGTTAATYSCA-----GIIKRGLQSQGFVIKKS----
MNMC_PSYWF      ---ACNESLWADQIFEQVKRLSKPGTTAATFSSA-----GVVKRGLMAAGFEIKKT----
MNMC_PSEAE      ---AKNPDMWSPVLFAELARLSAPQATLGTFTSA-----GFVRRGLVEAGFAMQRV----
MNMC_PSEAB      ---AKNPDMWSPALFAELARLSAPQATLGTFTSA-----GFVRRGLIEAGFAMQRV----
MNMC_PSEA7      ---AKNPDMWSPALFAELARLSAPQATLGTFTSA-----GFVRRGLIEAGFAMQRV----
MNMC_PSEMY      ---AKNPEMWTDSLFTELARLSAPGATLATFTSA-----GFVRRGLIAAGFAVQRV----
MNMC_PSEP1      ---AKNPDMWTPELFAQLARLSHPGTVLGTFTTT-----GWVRRSLVEAGFAMKKV----
MNMC_PSEPK      ---AKNPDMWTPELFAQLARLSHPGTVLGTFTTT-----GWVRRSLVEAGFAMKKV----
MNMC_PSEPG      ---AKNPDMWTPELFAQLARLSHPGTVLGTFTTT-----GWVRRSLVEAGFAMKKV----
MNMC_PSEPW      ---AKNPDMWTPELFTQLARLSHAGTALGTFTTT-----GWVRRSLIEAGFTMKKV----
MNMC_PSEE4      ---AKNPDMWTPELFTQLARLSRPGTTLGTFTTT-----GWVRRSLIEAGFTMKKV----
MNMC_PSEF5      ---AKNPDMWTAELFAELARLAAPGSTISTFTST-----GWVRRLLNSAGFKMKRT----
MNMC_PSEPF      ---AKNPEMWTAELFAELARLAAPGSTISTFTST-----GWVRRLLNAAGFKMKRT----
MNMC_PSE14      ---AKNPEMWTPELFAELARLSAPSATIGTFTST-----GWVRRSLNAAGFKMKRV----
MNMC_PSEU2      ---AKNPEMWTPELFAELARLSTSSTTIGTFTST-----GWVRRSLNAAGFKMKRV----
MNMC_PSESM      ---AKNPDMWTPELFAELARLSTPSTTIGTFTST-----GWVRRSLNAAGFKMKRV----
MNMC_PSEU5      ---AKNPQMWQPALFSEMARLSAPGATLGTFTSA-----GFVRRGLIEAGFDMQRV----
MNMC_CHRVO      ---SKNPDMWQQALFEQMARLSGPGASFATFTSA-----GAVRRGLAGAGFEVRKA----
MNMC_METFK      ---SRNPEMWQEALFDNMAAFSHKHTTFATFTSA-----GIVKRGLQAAGFEVHKV----
MNMC_NITMU      ---ARNPEMWTLQIFHWIARASRAGATFATYTSA-----GVVRRGLEQAGFQVKKI----
MNMC_CHRSD      ---AKNPDMWQPELFAAMAQVSRPGATFATFTCA-----GVVKRGLRDAGFTWRKT----
MNMC_HAHCH      ---KQNPEMWSESLFPLIASHAAQGCTVATFSAA-----GFIRRGLKEHGFNVSKA----
MNMC_MARN8      ---SLNPDMWLEKAIHQIRAHSQPGTTLATFTSV-----GRVRRALADEGFEMAKV----
MNMC_IDILO      ---AKNPEMWQPTLFDAMKQTAHSGTTFATFTAA-----GSVKRALQQNGFEVQKV----
MNMC_PSEA6      ---SKNPQMWSPQLFEQMARLASNGCTFATFTAA-----GFVKRGLRDAGFEVEKR----
MNMC_PSET1      ---SKNPDMWQQSLFNAMVNISKVGATLATFTAA-----GFVRRGLSDAGFTMQKV----
MNMC_COLP3      ---AKNPDMWSKDLFSQIGRLSKDQATLTTFTVA-----GFVKRQLRDIGFRLEKL----
MNMC_SHEB5      ------LQALHHQSHWQMAKLSDDSATIATIGLSESSGLSETTVKRFQACGFTVSDINEL
MNMC_SHEB9      ------LQALYHQSQWQMAKLSDDSATIATIGLSESSELSETTVNRFQACGFTVSDINEL
MNMC_SHEB8      ------LQALHHQSHWQMAKLSDDSATIATIGLSESSGLSETTVNRFQACGFTVSDINEL
MNMC_SHEPC      ------QNGLHQQIHWQMAKLSDDSATVATIGLNESSGLSETTVNRFQACGFEVRDFTCA
MNMC_SHESW      ------QNGLHQQIHWQMAKLSDDSATVATIGLNESSGLSETTVNRFQACGFEVRDFTCA
MNMC_SHESM      ------AAQLNGKQVWQMARLSTDDAQLIGVNL------AETLQQLAHKSGFSTLNVSQD
MNMC_SHESR      ------AAQLNGKQVWQMARLSTDDAQLIGVNL------AETVRQLAHQSGFSTLNVSQD
MNMC_SHESA      ------ASQLSGKLAWQMARLSADDAQLIGVNL------AETVQQLAHSSGFSTLNVSQD
MNMC_SHEON      ------APQLSRKILWQMARLSADDAHFIGVEL------AETTQNLAKTCGFSPLTITAD
MNMC_SHEDO      NQVQSNANQLNQAILWQMGRLSQDNASLYLDGENFKPSASDNNALTDCTLIKMATQAGFS
MNMC_SHEFN      NQEAHSDQYFHQRSVWEYGRLSVDNATFLA--------ASTNDENIAPTIKKQLAFCGF-
MNMC_SHESH      ------AGSLDQAMLWQIAKLSRDNAALSFTDPESKETRQMMALARSVGLRTLETTVSET
MNMC_SHEWM      RVESGMEQEISQALLWQVAKVSQDSAPVYNFNLK--QGKEIRQLCQKTGF----SLISYR
MNMC_SHELP      ----------DEALIWQMARLSQDNAEFLLLENNDVNLDKTSNNANTNLLTQLIIKAGFT
MNMC_SHEAM      ----------HPLSPFAMAASHIKGGQRFHLDDNCWLDFYLCEPNKAATLATFDKASIDV
MNMC_SACD2      ---AKNPSIWQPCIFTLAAELSKSTTTFATFTSA-----RSVRDAIENAGFKWQKV----
MNMC_DICNV      ---SKNPQMWQPELFREIARLSQPNATLATFTVA-----AQVREQLTAVGFNVHKQ----
                                                                            

MNMC_ECOLI      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_ECODH      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_SHIB3      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_SHIBS      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_ECOLC      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_ECOHS      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_SHIFL      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_SHIF8      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_SHISS      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_ECO57      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_SHIDS      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_ECOK1      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_ECOUT      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_ECOL6      ------------------KGFGRKREMLCGVMEQTLPFPC--------------------
MNMC_ECOL5      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_ECOSM      ------------------KGFGRKREMLCGVMEQTLPLPC--------------------
MNMC_ECO24      ------------------KGFGRKREMLCGVMEQALPLPC--------------------
MNMC_CITK8      ------------------KGFGRKREMLCGVMAHALTFPS--------------------
MNMC_SALPA      ------------------KGFGRKREMLCGVMEQHRMPTL--------------------
MNMC_SALTY      ------------------KGFGRKREMLCGVMEQHLMPTL--------------------
MNMC_SALPB      ------------------KGFGRKREMLCGVMEQHLMPTL--------------------
MNMC_SALCH      ------------------KGFGRKREMLCGVMEQHLMPTL--------------------
MNMC_SALTI      ------------------KGFGRKREMLCGVMEQHLMPTL--------------------
MNMC_SALAR      ------------------KGFGRKREMLCGVMERCLTPTI--------------------
MNMC_ENT38      ------------------KGFGRKREMLTGVMAQDNALPA--------------------
MNMC_KLEP7      ------------------KGFGRKREMLTGEMAQTLSFPA--------------------
MNMC_CROS8      ------------------KGFGRKREMLTGALSHDAPPPA--------------------
MNMC_YERPG      ------------------KGFGQKREMLTGTLPQQIHAPT--------------------
MNMC_YERPY      ------------------KGFGQKREMLTGTLPQQIHAPT--------------------
MNMC_YERPE      ------------------KGFGQKREMLTGTLPQQIHAPT--------------------
MNMC_YERPA      ------------------KGFGQKREMLTGTLPQQIHAPT--------------------
MNMC_YERPN      ------------------KGFGQKREMLTGTLPQQIHAPT--------------------
MNMC_YERPP      ------------------KGFGQKREMLTGTLPQQIHAPT--------------------
MNMC_YERPS      ------------------KGFGQKREMLTGTLPQQIHAPT--------------------
MNMC_YERPB      ------------------KGFGQKREMLTGTLPQQIHAPT--------------------
MNMC_YERP3      ------------------KGFGQKREMLTGTLPQQIHAPT--------------------
MNMC_YERE8      ------------------KGFGQKREMLTGILPQRLNTQS--------------------
MNMC_SERP5      ------------------KGFGQKREMLIGELPADAPAVAH-------------------
MNMC_PECAS      ------------------KGFGQKREMLSGLLPDTLPITS--------------------
MNMC_PHOLL      ------------------KGFGRKREMLAGVLATQKYQPL--------------------
MNMC_VIBCH      ------------------KGFGTKREMIAGSLSEKVPYTN--------------------
MNMC_VIBC3      ------------------KGFGTKREMIAGSLSEKVPYTN--------------------
MNMC_VIBCB      ------------------KGFGTKREMIAGSMEQREAHSN--------------------
MNMC_VIBPA      ------------------KGFGTKREMIAGSMEQREKQSN--------------------
MNMC_VIBVU      ------------------KGFGTKREMIAGCMETRQQQSR--------------------
MNMC_VIBVY      ------------------KGFGTKREMIAGCMETRQPQSR--------------------
MNMC_ALIF1      ------------------KGFGHKREMIAGTLTERTTKAN--------------------
MNMC_PHOPR      ------------------NSISPTHRLLVGSVKNRQYQAN--------------------
MNMC_AERHH      ------------------KGHGSKREMLAGERAEKQPQQT--------------------
MNMC_AERS4      ------------------KGHGSKWAMLAGERVDKKPQRT--------------------
MNMC_PSYIN      ------------------KGYDKKREMLIGHISTEALAANKLKQHGQY------------
MNMC_ACTPJ      ------------------KGFGKKREMLWGEKPQQSETA-------PV------------
MNMC_ACTP2      ------------------KGFGKKREMLWGEKPQQSETA-------PV------------
MNMC_HAEDU      ------------------KGFAKKREMLCGEKAQKSQTA-------EV------------
MNMC_HAEIN      ------------------KGFGKKRECLSGLKIQSKSTA--------L------------
MNMC_HAEIG      ------------------KGFGKKRECLSGLKIQSKSTA--------L------------
MNMC_HAEI8      ------------------KGFGKKRECLSGLKIQSKSTV--------L------------
MNMC_HAEIE      ------------------KGFGKKRECLSGLKIQSKSTA--------L------------
MNMC_HAES1      ------------------KGYGKKRECLCGIKNSTQQQN--------A------------
MNMC_HISS2      ------------------KGYGKKRECLCGIKNAIPQQN--------T------------
MNMC_PASMU      ------------------KGYGKKRECLQGVKAQQQPAD--------I------------
MNMC_MANSM      ------------------KGFGKKRECLQGFKPLNAEQN------PAV------------
MNMC_ACTSZ      ------------------AGFGKKRECLYGEKPAENAPHFTA---SQV------------
MNMC_CAUVC      ------------------PGFGRKRERLEAWRPGVRPVA------QRP------------
MNMC_CAUSK      ------------------PGFGRKKQRLEAVAPGVAASP------PRP------------
MNMC_MARMM      ------------------PGFGRKRERLEAVWPGEAVDG------SLA------------
MNMC_HYPNA      ------------------EGHGRKRQRLEAVYPDADEPVI-----PLP------------
MNMC_CUPNH      ------------------PGFGGKWQMTVASFRPQWKARR-----HA-------------
MNMC_CUPPJ      ------------------PGFGGKRDMTVATFCPVWKSRR-----HA-------------
MNMC_CUPMC      ------------------PGFGGKRDMTVARFAPVWKNRR-----HA-------------
MNMC_RALSO      ------------------PGFGRKRDMTVAAFPTHWRTRR------G-------------
MNMC_BURCM      ------------------EDCAGEPALRVGEYAPRWRMRR-----HE-------------
MNMC_BURA4      ------------------EDGAGEPALRVGEYAPRWRMRR-----HE-------------
MNMC_BURCA      ------------------DD------RLVGDYAPRWRARR-----HE-------------
MNMC_BURCH      ------------------DD------RLVGDYAPRWRARR-----HE-------------
MNMC_BURCC      ------------------DD------RLVGDYAPRWRARR-----HE-------------
MNMC_BURL3      ------------------DD------LLVGEYAPRWRARR-----HE-------------
MNMC_BURVG      ------------------PGLAGKFAMLVGEYAPRWRMRR-----HE-------------
MNMC_BURM1      ------------------DGFAGKRAMLVGEYAPRWRMRR-----HE-------------
MNMC_BURMA      ------------------DGFAGKRAMLVGEFAPRWRVRR-----HE-------------
MNMC_BURM9      ------------------DGFAGKRAMLVGEFAPRWRVRR-----HE-------------
MNMC_BURM7      ------------------DGFAGKRAMLVGEFAPRWRVRR-----HE-------------
MNMC_BURP0      ------------------DGFAGKRAMLVGEFAPRWRVRR-----HE-------------
MNMC_BURP1      ------------------DGFAGKRAMLVGEFAPRWRVRR-----HE-------------
MNMC_BURPS      ------------------DGFAGKRAMLVGEFAPRWRVRR-----HE-------------
MNMC_BURMS      ------------------DGFAGKRAMLVGEFAPRWRVRR-----HE-------------
MNMC_BURP6      ------------------DGFAGKRAMLVGEFAPRWRVRR-----HE-------------
MNMC_BURTA      ------------------EGFAGKRAMLVGEFAPRWRVRR-----HE-------------
MNMC_PARPJ      ------------------DGFGWKRAMLVGHFAPRWRVRR-----HE-------------
MNMC_PARXL      ------------------DGFGWKRAMLVGRFAPRWRVRR-----HE-------------
MNMC_PARP8      ------------------DGFGWKRAMLVGRFAPRYRVRR-----HE-------------
MNMC_LEPCP      ------------------GADA-----TVARYAPRFQPEP-----P--------------
MNMC_METPP      ------------------AGTGGKRDITVARFTPRHIAVP-----PP-------------
MNMC_BORBR      ------------------PGFGGKWHMTLGQRLPGVATPD-----D--------------
MNMC_BORPA      ------------------PGFGGKWHMTLGQRLPGVATPD-----D--------------
MNMC_BORPD      ------------------PGYGGKWHMTVGVRESAQPEAP-----ADA------------
MNMC_BORA1      ------------------TGARGKRHITVGRRSAWAGKHA-----P--------------
MNMC_AZOSB      ------------------PGFGGKRQMLRGRYLGRGHRPA-----PA-------------
MNMC_AROAE      ------------------PGFDGKRQMCRGRHRDVGTGPA-----PA-------------
MNMC_DECAR      ------------------PGYIGKRQMLVGRFRSRRPDRH-----VA-------------
MNMC_THIDA      ------------------RGYGRKRHCMSARFAGR--SRA-----EV-------------
MNMC_ACIAC      ------------------PGLPPKRSNLQAEFDPAWEPRP-----VQ-------------
MNMC_ACISJ      ------------------PGVRPKRDNLQATYAPRWEPRA-----GQ-------------
MNMC_DELAS      ------------------DGVPPKRHNLHAVFDPAWQPRG-----PR-------------
MNMC_POLNA      ------------------PGTPPKRDNLQGEYQPAWEVKK-----SR-------------
MNMC_POLSJ      ------------------PGIPPKRDNLQGEFNPAWEPKK-----SM-------------
MNMC_MAGMM      ------------------PGFGQKRECLRGVLENPLPHKP-----NIP------------
MNMC_LEPBJ      ------------------PGFGKKREMLTGKYSNYPSETKESLPKEKP------------
MNMC_LEPBL      ------------------PGFGKKREMLTGKYSNYPSETKESLPKEKP------------
MNMC_LEPIN      ------------------PGFGRKREMLIGSYSDSFLESN---PKEKP------------
MNMC_LEPIC      ------------------PGFGRKREMLIGSYSDSFLESN---PKEKP------------
MNMC_MARMS      ------------------KGFGQKREMTVGELNSSTAPLSARMSQGQA------------
MNMC_HYDCU      ------------------PGYAQKREMCFGRYAHSRP-----FSSKAP------------
MNMC_CAMJJ      ------------------KGFR-KREMIKAYLENELEFKDKE---AYF------------
MNMC_CAMJ8      ------------------KGFR-KREMIKAYLENELEFKDKE---AYF------------
MNMC_CAMJR      ------------------KGFR-KREMIKAYLENELEFKDKE---AYF------------
MNMC_CAMJE      ------------------KGFR-KREMIKAYLENELEFKDKE---AYF------------
MNMC_CAMJD      ------------------KGFR-KREMIKAYLENELEFKDKE---AYF------------
MNMC_CAMC1      ------------------EGYARKRQMSSAVLEKKD-ENLKD---AWF------------
MNMC_CAMHC      ------------------PGFNGKREMIRAYFNGNS-GEIKD---YFF------------
MNMC_CAMFF      ------------------KGHYKKREILEASLEHSSPKILKE---PWY------------
MNMC_LEGPA      ------------------KGFGPKRHMICAHYEKAYSSPKKN---RHT------------
MNMC_LEGPH      ------------------KGFGPKRHMICAHYEKAYSSSKKN---RHT------------
MNMC_LEGPL      ------------------KGFGPKRHMICAHYEKAYSSSKKN---RHT------------
MNMC_LEGPC      ------------------KGFGPKRHMLCAYYEKAYSSSKKN---RHT------------
MNMC_ACIBT      ------------------RGFGHKREMLKAVWKAPVSEEILLEPVSD-------------
MNMC_ACIBY      ------------------RGFGHKREMLKAIWKAPVSEEILFEPVSD-------------
MNMC_ACIBC      ------------------RGFGHKREMLKAVWKAPVSEEILLEPVRD-------------
MNMC_ACIAD      ------------------RGFGHKREMLKAIWPFPDHEST--TTVKG-------------
MNMC_PSYA2      ------------------KGFGPKPEMLTAVMSEMSSLDEPIS--------------ALS
MNMC_PSYCK      ------------------KVLGSKREMLTAVMSEMSSLDKPIS--------------TLS
MNMC_PSYWF      ------------------KGFGRKREMLTATKLEPVAVSDDTSDNQGATEYDAKSTLALR
MNMC_PSEAE      ------------------PGYGQKREMLSGTYQG-----PPANAGKPW------------
MNMC_PSEAB      ------------------PGYGQKREMLGGTYQG-----PPANAGKPW------------
MNMC_PSEA7      ------------------PGYGQKREMLGGTYQG-----PPASAGKPW------------
MNMC_PSEMY      ------------------KGFGHKREMLAGPFQA-----EPAPRSAPW------------
MNMC_PSEP1      ------------------PGIGKKWEVMSGAYVG----PLPGP-CAPW------------
MNMC_PSEPK      ------------------PGIGKKWEVMSGAYVG----PLPGP-CAPW------------
MNMC_PSEPG      ------------------PGIGKKWEVMSGAYVG----PVPGP-KAPW------------
MNMC_PSEPW      ------------------PGIGKKWEVMSGEYTG----PPNAPMSAPW------------
MNMC_PSEE4      ------------------PGIGKKWEVMHGVYTG----AAAAP-AAPW------------
MNMC_PSEF5      ------------------PGIGHKWEVLRGEFLGWPEDAPAPARARPW------------
MNMC_PSEPF      ------------------PGIGHKWEILRGEFLGWPEGVAPPAAAKPW------------
MNMC_PSE14      ------------------PGIGHKWEVLRGTFIAWPEDVAHPPAAKPW------------
MNMC_PSEU2      ------------------PGIGHKWEVLRGTFIAWPEDVAHPPAAKPW------------
MNMC_PSESM      ------------------PGIGHKWEVLRGAFIAWPEGVTSVPAAKPW------------
MNMC_PSEU5      ------------------PGYGHKREILRGHLQS----STAQMADKPW------------
MNMC_CHRVO      ------------------PGHGAKRHISHGWIAT----PPDAGWQAPW------------
MNMC_METFK      ------------------AGHGRKRDMLCGRFTL--------------------------
MNMC_NITMU      ------------------SGFGHKREMLQGDLPG--------------------------
MNMC_CHRSD      ------------------PGFGRKREMLCGEIAAP---PDDRRRASTP------------
MNMC_HAHCH      ------------------PGFGYKRDMTVGVFQAE-------------------------
MNMC_MARN8      ------------------PGFGRKREMLTGRLPTS-------------------------
MNMC_IDILO      ------------------AGFGRKRDMLCGHYLSA-------------------------
MNMC_PSEA6      ------------------KGHGRKREMLAGIIARELETKVNRQQARYYQRGAYMNSTSVN
MNMC_PSET1      ------------------KGFAHKRSMLIGTLKHTNDTQS--------------------
MNMC_COLP3      ------------------LAKGKKKEMLSAVMQSNPITNK--------------------
MNMC_SHEB5      ATKAL-GINALGIHQPVTLINHQPDAVLLHERQVLRQQDVKAYAFNPM------------
MNMC_SHEB9      GTKAL-G-----IHQPVTLINHQPDAVLLHERQVLRQQDAKAYAFNPM------------
MNMC_SHEB8      G-----------IHQPVTLINHQPDAVLLHERQVLRQQDAKAYAFNPM------------
MNMC_SHEPC      E----------------IQTNPQPDAILLHERHVLRRQDAKAYAFNPM------------
MNMC_SHESW      E----------------IQTNPQPDAILLHERHVLRRQDAKAYAFNPM------------
MNMC_SHESM      ALNG--------DASDALQSHIITDEILLHERKLLRQQADTAQAFTPK------------
MNMC_SHESR      TSNG--------DASDALQSQIITDEILLHERKLLRQQADTAQAFTPK------------
MNMC_SHESA      ALNG--------DASDALPSQIITDEILLHERKLLRQQADTAQAFTPK------------
MNMC_SHEON      MLCG--------EQIDSIASQIVTDDILLHERKLLRQQANNHQAFTPR------------
MNMC_SHEDO      RYSP----------NLFQASSDSCNAIPLGERRALRQQQENRQAHCPV------------
MNMC_SHEFN      ---------------LSSTSFKSTDDIAIAERNALRQQLQQQFAYNPL------------
MNMC_SHESH      ------TVPETQQQTENKNLDTASDAIPLQERRALRHAQSDKFQYCPV------------
MNMC_SHEWM      ------SQNEEMTPKLTSDLSSLDTQICLQERKALRHAQAQDSLYTPV------------
MNMC_SHELP      CYRLNLSLKDDQLVTLAEKPSLASLEIAMVERRALRRQQLDKFAFNPL------------
MNMC_SHEAM      LICP------------KGEFEQAALELAHQGSILIGDTKPDMPAALPI------------
MNMC_SACD2      ------------------PGFGLKREMLFGTFEQHPFAQVDPNKAPTTAHRSYRKRNGVQ
MNMC_DICNV      ------------------TGFAQKRHMLSAVYERPLSVEK--------------------
                                                                            

MNMC_ECOLI      SAPWFNR--TGSS-KREAAIIGGGIASALLSLALLRRGWQVTLYCADEAPA-LGASGNRQ
MNMC_ECODH      SAPWFNR--TGSS-KREAAIIGGGIASALLSLALLRRGWQVTLYCADEAPA-LGASGNRQ
MNMC_SHIB3      SAPWFNR--TGSS-KREAAIIGGGIACALLSLALLRRGWQVTLYCADEAPA-LGASGNRQ
MNMC_SHIBS      SAPWFNR--TGSS-KREAAIIGGGIACALLSLALLRRGWQVTLYCADEAPA-LGASGNRQ
MNMC_ECOLC      SAPWFNR--TGSS-KREAAIIGGGIASALLSLALLRRGWQVTLYCADEAPA-LGASGNRQ
MNMC_ECOHS      SAPWFNR--TGSS-KREAAIIGGGIASALLSLALLRRGWQVTLYCADEAPA-LGASGNRQ
MNMC_SHIFL      STPWFNR--TGSS-KREVAIIGGGIASALLSLALLRRGWQVALYCADEAPA-LGASGNRQ
MNMC_SHIF8      STPWFNR--TGSS-KREVAIIGGGIASALLSLALLRRGWQVALYCADEAPA-LGASGNRQ
MNMC_SHISS      STPWFNR--TGSS-KREVAIIGGGIASALLSLALLRRGWQVALYCADEAPA-LGASGNRQ
MNMC_ECO57      STPWFNR--TGSS-KREVAIIGGGIASALLSLALLRRGWQVTLYCADEAPA-LGASGNRQ
MNMC_SHIDS      STPWFNR--TGSS-KREVAIIGGGIASALLSLALLRRSWQVTLYCADEAPA-LGASGNRQ
MNMC_ECOK1      STPWFNR--TGSN-KQEAAIIGGGIASALLSLALLRRGWQVTLYCADEAPA-LGASGNRQ
MNMC_ECOUT      STPWFNR--TGSN-KQEAAIIGGGIASALLSLALLRRGWQVTLYCADEAPA-LGASGNRQ
MNMC_ECOL6      STPWFNR--MGSN-KQEAAIIGGGIASALLSLALLRRGWQVTLYCADEAPA-LGASGNRQ
MNMC_ECOL5      STPWFNR--TGSN-KQEAAIIGGGIASALLSLALLRRGWQVTLYCADEAPA-LGASGNRQ
MNMC_ECOSM      STPWFNR--TGSN-KQEAAIIGGGIASALLSLALLRRGWQVTLYCADEAPA-LGASGNRQ
MNMC_ECO24      STPWFNR--TGSS-KREAAIIGGGIASALLSLALLRRGWQVTLYCADEAPA-LGASGNRQ
MNMC_CITK8      PTPWFTR--SGSA-KRDVAIIGGGIASALLSLALLRRGWQVTLYCSDEQPA-QGASGNRQ
MNMC_SALPA      SAPWFYR--SGSE-KRETAIIGGGIASALLSLALLRRGWQVTLYCADDQPA-QGASGNRQ
MNMC_SALTY      SAPWFYR--SGSE-KRETAIIGGGIASALLSLALLRRGWQVTLYCADDQPA-QGASGNRQ
MNMC_SALPB      SAPWFYR--SGSE-KRETAIIGGGIASALLSLALLRRGWQVTLYCADDQPA-QGASGNRQ
MNMC_SALCH      YAPWFYR--SGSE-KRETAIIGGGIASALLSLALLRRGWQVTLYCADDQPA-QGASGNRQ
MNMC_SALTI      SAPWFYC--SGSE-KRETAIIGGGIASALLSLALLRRGWQVTLYCADDQPA-QGASGNRQ
MNMC_SALAR      SAPWFYR--SGSE-KRETAIIGGGIASALLSLALLRRGWQVTLYCADDKPA-RGASGNQQ
MNMC_ENT38      RAPWFAR--SGLE-NRETAIIGGGIASALLAFALLQRGWRVTLYCADKSPA-NGASGNRQ
MNMC_KLEP7      RVPWFAR--SSSD-AREAAIIGGGIASALLSLALLRRGWQVTLYCADEAPA-QGASGNRQ
MNMC_CROS8      RAPWYAR--RPASGDKDVAVVGGGIASALLALGLLRRGWQVTLYCEDDAPA-QGASGNRQ
MNMC_YERPG      -APWYHR--PAATRCDDIAIIGGGIVSALTALALQRRGAVVTLYCADAQPA-QGASGNRQ
MNMC_YERPY      -APWYHR--PAATRCDDIAIIGGGIVSALTALALQRRGAVVTLYCADAQPA-QGASGNRQ
MNMC_YERPE      -APWYHR--PAATRCDDIAIIGGGIVSALTALALQRRGAVVTLYCADAQPA-QGASGNRQ
MNMC_YERPA      -APWYHR--PAATRCDDIAIIGGGIVSALTALALQRRGAVVTLYCADAQPA-QGASGNRQ
MNMC_YERPN      -APWYHR--PAATRCDDIAIIGGGIVSALTALALQRRGAVVTLYCADAQPA-QGASGNRQ
MNMC_YERPP      -APWYHR--PAATRCDDIAIIGGGIVSALTALALQRRGAVVTLYCADAQPA-QGASGNRQ
MNMC_YERPS      -APWYHR--PAATRCDDIAIIGGGIVSALTALALQRRGAVVTLYCADAQPA-QGASGNRQ
MNMC_YERPB      -APWYHR--PAATRCDDIAIIGGGIVSALTALALQRRGAVVTLYCADAQPA-QGASGNRQ
MNMC_YERP3      -APWYHR--PAATRCDDIAIIGGGIVSALTALALQRRGAVVTLYCADAQPA-QGASGNRQ
MNMC_YERE8      -EPWYHR--PLATRCDDIAIIGGGIVSALTALALLRRSAKVTLYCADALPA-QGASGNRQ
MNMC_SERP5      PTPWLLR--PAADNTDDIAIIGGGVASALTALALLRRGAKVTLYCADPQAA-EGASGNRQ
MNMC_PECAS      PTPWYSR--PAASTTDDIAIIGGGIASVLTALALQRRGANVTLYCAESQPA-TGASGNRQ
MNMC_PHOLL      PAPWFAR--PSASHNDDIAIIGGGIAGILTALALLRRGAQVTLYCQDVAPA-QGASGNRQ
MNMC_VIBCH      IAPEFRF--EATHGLQEVAIIGGGIASATLATTLARRGVAVTLYCADEKPA-QGASGNRQ
MNMC_VIBC3      IAPEFRF--EATHGLQEVAIIGGGIASATLATTLARRGVAVTLYCADEKPA-QGASGNRQ
MNMC_VIBCB      HLPWFNR--TASTNHDSIAIIGGGIASAALAKTLVRRGQNVTLYCKDAQPA-EGASGNRQ
MNMC_VIBPA      HLAWFNR--TASSNLDSIAIIGGGIASAALAKTLVRRGQNVTLYCKDTQPA-EGASGNRQ
MNMC_VIBVU      HAPYFNR--TSASHLDSIAIIGGGIASAALAKALVQRGQKVTLYCKHAQAA-EGASGNRQ
MNMC_VIBVY      HAPYFNR--TSASHLDSIAIIGGGIASAALAKALVQRGQKVTLYCKHAQAA-EGASGNRQ
MNMC_ALIF1      HEVWYAR--STKENITDVAIIGGGVASAALATTLIRRGVKVSVYCKDEKSA-QGASGNKQ
MNMC_PHOPR      SKPWFTR--TSATDASDVAIIGGGVASATTALALIRRGVNVTLYCADSLPA-EGASGNRQ
MNMC_AERHH      IAPWYAR--PAGR-AGEVLIIGGGIASAMTALSLVERGRRVTLLCQDGEPA-TGASGNRQ
MNMC_AERS4      IVPWYAR--PAGR-DGEVVIIGGGIASAMTALSLVERGRKVTLLCEDHELA-TGASGNRQ
MNMC_PSYIN      YRPAKSE--NTAQKKTDVAIIGGGIASACLSLALIRRGYKVTLYCKESSLA-FGASGNQQ
MNMC_ACTPJ      NYPYFYSESQTEA--NDIAVVGGGVASLFVVLSLLEKGKKVTLYCKDNALA-QNASGNLQ
MNMC_ACTP2      NYPYFYSESQTEA--NDIAVVGGGVASLFVVLSLLEKGKKVTLYCKDNALA-QNASGNLQ
MNMC_HAEDU      NFPYFYSPPAIVN--DDIAIVGGGIASLFVALSLLERGKQVTLYCQDSQVA-QKASGNAQ
MNMC_HAEIN      STPWYLAQPAKME-KQDVAIIGGGIASLCAAISLIKRGAKVTIYCEDDALA-LNASGNKQ
MNMC_HAEIG      STPWYLAQPAKME-KQDFAIIGGGIASLCAAISLVKRGAKVTIYCEDAALA-LNASGNKQ
MNMC_HAEI8      STPWYLAQPAKME-KQDVAIIGGGIASFCAAISLVKRGAKVTIYCEDDALA-LNASGNKQ
MNMC_HAEIE      STPWYLAQPAKME-QQDVAIIGGGIASLCAAISLVKRGAKVTIYCEDDSLA-LNASGNKQ
MNMC_HAES1      KFPWYLNQPASLL-SEDIAIIGGGIASLFTALSLLKRGAKVTLYCEDEQLA-LNASGNKQ
MNMC_HISS2      KAPWYLSQPASLL-SEDIAIIGGGIASLFTALSLLKRGAKITLYCEDEQLA-LNASGNKQ
MNMC_PASMU      HAPWALVQPAELTENADIALIGGGIASVFSALSLLERGAKVTVYCEDNSLA-ANASGNKQ
MNMC_MANSM      HTPWLLSRSATLSENTDIAIIGGGISSLFSAISLLQRGANVTLYCEDEQPA-LNASGNKQ
MNMC_ACTSZ      NTPWFLPQAAKFDGAADVAIIGGGIASLFSALSLLERGADVTLYCEDDELA-LNASGNKQ
MNMC_CAUVC      ---E------------TLAIIGGGIAGAALARAARAAGLEVTVID---DADAVAASGNPA
MNMC_CAUSK      ---R------------RLAVIGGGIAGAAMARAARAEGLEAMMFD---DGQAPAS-GNPA
MNMC_MARMM      ---NV---------DGPVAVLGAGIAGASLVHALRRRGIETVLIDA--HGVASGASGAPA
MNMC_HYPNA      ---R------------RVAILGAGIAGATIASGLKLAGMEAVVFDP-APEPARGASGNAL
MNMC_CUPNH      -----PPLPAQ-WAERHAIVIGAGLAGCAVTERLAARGWRVTLFDGHDGPA-RQTSAHRA
MNMC_CUPPJ      -----PTPAPE-WKVRHAIVIGAGLAGCAVTERLASRGWQVTLFDVHDGPA-RQTSSHRA
MNMC_CUPMC      -----PPEAAQ-WAERHAIVIGAGLAGCAVTERLAARGWRVTLLDAHDGPA-RQTSCHRA
MNMC_RALSO      -----PAEAPV-WPERHAIVLGAGLAGCSVAERLAARGWRITLIDEHEAPA-GGASAHRA
MNMC_BURCM      -----PPRALP-VAAREAIVIGAGLAGCAVVERLAARGWNITLIERHERIA-SEASGNPA
MNMC_BURA4      -----PPRALP-VASREAIVIGAGLAGCAVVERLAARGWNITLIERHEQIA-SEASGNPA
MNMC_BURCA      -----PPRALP-VAARRAIVIGAGLAGCAVVERLAARGWDVTLIERHERIA-SEASGNPA
MNMC_BURCH      -----PPRALP-VAARRAIVIGAGLAGCAVVERLAARGWDVTLIERHERIA-SEASGNPA
MNMC_BURCC      -----PPRALP-VTTRRAIVIGAGLAGCAVVERLAARGWDVTLIERHERIA-SEASGNPA
MNMC_BURL3      -----PPLALP-VATRRAIVIGAGLAGCAVVERLAARGWEVTLIERHDRIA-SDASGNPA
MNMC_BURVG      -----PPRALP-VAVREAIVIGAGLAGCALVERLAARGWHVTLIERHAQIA-SEASGNPA
MNMC_BURM1      -----PPRAWPNAAARRALVIGAGVAGCAVVERLAARGWNVTLIERHERIA-SEASGNPA
MNMC_BURMA      -----PPRAFS-TDRRDAIVIGAGLAGCAVVERLAARGWHVTLIERRERIA-SEASGNPA
MNMC_BURM9      -----PPRAFS-TDRRDAIVIGAGLAGCAVVERLAARGWHVTLIERRERIA-SEASGNPA
MNMC_BURM7      -----PPRAFS-TDRRDAIVIGAGLAGCAVVERLAARGWHVTLIERRERIA-SEASGNPA
MNMC_BURP0      -----PPRAFS-TDRRDAIVIGAGLAGCAVVERLAARGWHVTLIERRERIA-SEASGNPA
MNMC_BURP1      -----PPRAFS-TDRRDAIVIGAGLAGCAVVERLAARGWHVTLIERRERIA-SEASGNPA
MNMC_BURPS      -----PPRAFS-TDRRDAIVIGAGLAGCAVVERLAARGWHVTLIERRERIA-SEASGNPA
MNMC_BURMS      -----PPRAFS-TDRRDAIVIGAGLAGCAVVERLAARGWHVTLIERRERIA-SEASGNPA
MNMC_BURP6      -----PPRAFS-TDIRDAIVIGAGLAGCAVVERLAARGWHVTLIERRERIA-SEASGNPA
MNMC_BURTA      -----PPRALD-VGTRDAIVIGAGLAGCAAVERLAARGWHVTLIERRERIA-SEASGNPA
MNMC_PARPJ      -----PPAPLA-VDERHAVVIGAGLAGCAVIERLAARGWRVTSLERHASVA-QEASGNPA
MNMC_PARXL      -----PPAPLV-VDERHAVVIGTGLAGCAVIERLAARGWRVTSLERHAAVA-QEASGNPA
MNMC_PARP8      -----PPLPLA-VGERHAIVIGTGLAGCAAIERLTARGWRVTSLERHADVA-RDASGNPA
MNMC_LEPCP      -----RGWRWPHAAAREALVIGGGLAGCAVAQALALQGWRSTVIDRQAGPA-QETSGNAG
MNMC_METPP      -----GGWHAHDAASREALVIGAGLAGCAAAWALSQQGWQCQLLDRAAEPA-DVTSGNPA
MNMC_BORBR      --------APDDDG-APVLVVGAGLAGAAVAHALALRGRAVTVLDAARLAGLASHAGHAA
MNMC_BORPA      --------APDDDG-APVLVVGAGLAGAAVAHALALRGRAVTVLDAARLAGLASHAGHAA
MNMC_BORPD      ---WALARAADGEGQDEVVVVGGGLAGAGIAQALALRGRPVCVIDAAGPA--SAHAGHVA
MNMC_BORA1      --------RRTDAPDAPVLVVGAGLAGAGMAQALALRGLSVRVIAESAQP----HGGHLA
MNMC_AZOSB      -----------AAE-RRALVIGAGVAGTSIAERLAARGWQVELLDAASGPA-QGASGNHA
MNMC_AROAE      -----------AAAARHALVIGAGLAGSSTAERLAARGWHVDVIDAADGPG-EGASGNLT
MNMC_DECAR      -----------PTD-RRAIVIGAGIAGSSTAHALAAAGWQVTVLEQATAPA-TGASSNLA
MNMC_THIDA      -----------SAAPRHVAVIGGGVAGAAAARALVDRGVSVTLLERATAPA-EGASGNPV
MNMC_ACIAC      ---PELPDVRVAGGPSSVLVIGGGLSGAAVAASLARRGWQVRVLDQGAEPA-AGASGLPA
MNMC_ACISJ      ---PVLPDATVAA-PARCLVVGAGLAGAAVAASLAHRGWQVQVLDRADHPA-AGASGLPA
MNMC_DELAS      ---AQPQE---AITPRRCMVLGAGIAGAAAAASLSRRGWQVTVLDTADAPA-AGASALPA
MNMC_POLNA      ---ITPER----KAPARCIVIGAGLAGSAVAASLARRGWQVTVLDAASTPA-AGASGLPA
MNMC_POLSJ      ---LPGIR----RQAGSCVVIGAGLAGAAVAASLARRGWRVVVLDAADAPA-RGASGLPA
MNMC_MAGMM      ---PWYAPPQRSEPVSSVAIIGAGIAGAACAYACRRAGLQVTLFERHAQPG-AEASGNPS
MNMC_LEPBJ      ---WCKRS-DPESQIKTATIIGAGIAGSTLAYSLSKRGIQVFLIDP--SGIANETSGIPR
MNMC_LEPBL      ---WCKRS-DPESQIKTATIIGAGIAGSTLAYSLSKRGIQVFLIDP--SGIANETSGIPR
MNMC_LEPIN      ---WCKRA-YPELQIKTVAIVGAGIAGTTLAYSLSRRGIQVFLIDP--SGIAKETSGIPM
MNMC_LEPIC      ---WCKRA-YPELQIKTVAIVGAGIAGTTLAYSLSRRGIQVFLIDP--SGIAKETSGIPM
MNMC_MARMS      ---WFNLRQDKTSEITKVLVVGAGLAGANTAYALAKQGIKVEVWEQG-NCIAGGASGNPQ
MNMC_HYDCU      ---WFERAKGGHPSPKKAIVIGAGLAGATVAYQLASQGLSVTVLEQE-KAVAQQASGNLA
MNMC_CAMJJ      ---SR--TFSSLKN-KKVAIIGAGISSAVLAYELSLRGFKIDVFEKHLELG-KGASGNES
MNMC_CAMJ8      ---SR--TFSSLKN-KKVAIIGAGISSAVLAYELSLRGFEIDVFEKHLELG-KGASGNES
MNMC_CAMJR      ---SR--TFSSLKN-KKVAIIGAGISSAVLAYELSLRGFEIDVFEKYLELG-KGASGNES
MNMC_CAMJE      ---SR--TFSSLKN-KKVAIIGAGISSAVLAYELSLRGFEIDIFEKHLELG-KGASGNES
MNMC_CAMJD      ---SR--TFSSLKN-KKVAIIGAGISSAVLAYELSLRGFKIDVFEKHLELG-KGASGNES
MNMC_CAMC1      ---ARCEPVGSVNG-KTALVIGTGVAGLATAGELAKNGFKVVIAEAKSEVA-TNGSGNHC
MNMC_CAMHC      ---ER---PSFKSG-KNVLIIGAGIAGIVTAIKFQNLGYKTVIAEKACSVA-ANASGNFC
MNMC_CAMFF      ---AL---PNISKF-SDVLIIGAGVAGLAAAFKFKKAGFNVCIAEKMSEAA-TNGSSNLA
MNMC_LEGPA      ---PWHINYPVTKDERTALIVGGGLAGCFIANSLAKRGWEVTILEEKEKVG-CGGSANQQ
MNMC_LEGPH      ---PWHINYPVTKDERTALIVGGGLAGCFIANSLAKRGWEVTILEEKEKVG-CGGSANQQ
MNMC_LEGPL      ---PWHINYPVTKEERTALIVGGGLAGCFIANSLAKRGWEVTILEEKEKVG-CGGSANQQ
MNMC_LEGPC      ---PWHINYPVTKDERTALIVGGGLAGCFIANSLAKRGWEVTILEEKEKVG-CGGSANQQ
MNMC_ACIBT      ---------TLHFTQQHIAVIGAGIAGLSTAWAFAQRGHQVTLFERTAPLS--GASGNPL
MNMC_ACIBY      ---------TFHFTQQRIAIIGAGIAGLSTAWAFAQRGHQVTLFERTAPLS--GASGNPL
MNMC_ACIBC      ---------TFQFTQQRIAVIGAGIAGLSTAWAFAQRGHQVTLFERTVPLS--GASGNPL
MNMC_ACIAD      ---------NQPSTQQHFAVIGAGIAGLHCAWSLAQRGHRVTLVDQSQPLS--GASGNPL
MNMC_PSYA2      NKAPLSNYPNNTV------VIGAGVAGLLTAWTLANRGISVTVLDKDAPLA--GASGNPR
MNMC_PSYCK      NKVTLSNYPNNAV------VIGAGVAGLLTAWSLANRGISVTVLDKDAPLA--GASGNPR
MNMC_PSYWF      SKEQVTLDTHAVTPNEQIAVIGAGVCGLMAAWSLAQRGNAVSLIDKEAPLA--GASGNPR
MNMC_PSEAE      -----YARPAPHAGRRAALVVGGGLAGCASAASLAARGWQVTLIERHPGLA-REASGNPQ
MNMC_PSEAB      -----YARPAPHAGRRAALVVGGGLAGCASAASLAARGWQVTLIERHPGLA-REASGNPQ
MNMC_PSEA7      -----YARPAPHAGRRAALVVGGGLAGCASAASLAARGWQVTLIERHPGLA-REASGNPQ
MNMC_PSEMY      -----FARPTLAAGARQAVVIGAGLAGCATAASLAARGWRVTLLERHDDVA-REASGNPQ
MNMC_PSEP1      -----YARPAVTQGPREALVIGAGLAGSSSAASLARRGWQVTVLERHEAPA-QEASGNPQ
MNMC_PSEPK      -----YARPAVTQGPREALVIGAGLAGSSSAASLARRGWQVTVLERHEAPA-QEASGNPQ
MNMC_PSEPG      -----YARPAVAQGPREALVIGAGLAGSTTAASLARRGWQVTVLERHEAPA-QEASGNPQ
MNMC_PSEPW      -----YARPTAPEGPREALVIGAGLAGSASAASLAARGWQVTVLERHDAAA-REASGNPQ
MNMC_PSEE4      -----YARPTDLPGPREALVIGAGLAGSATARSLAERGWQVSVLERHAGPA-QEASGNPQ
MNMC_PSEF5      -----FARPA--LGEKTALVIGGGLAGCASAASLAARGWQVQLLERHAELA-REASGNPQ
MNMC_PSEPF      -----FARPTRLTGDRRALVIGAGLAGCATAASLAARGWQVSLLERHDAVA-QEASGNPQ
MNMC_PSE14      -----FARPAPIGGERKALVIGAGLAGCATAQSLAQRGWQVSLLERHAAPA-QEASGNPQ
MNMC_PSEU2      -----LARPAPIGGERKALVIGAGLAGCATAQSLAQRGWQVSLLERHAAPA-QEASGNPQ
MNMC_PSESM      -----FARPTPLAGERKALAIGAGLAGCATAQSLAQRGWQVSLLERHAAPA-QEASGNPQ
MNMC_PSEU5      -----FARPGRTVRERRAVVIGAGLAGCATAAALAARGWRVSVLERHADAA-QEGSGNPQ
MNMC_CHRVO      -----YARPEPRWRERSAIVVGGGLAGAASARSLALRGWQVTLIERMPQLA-SAASGNPQ
MNMC_METFK      -------NERPAMRAGRAVVIGGGIAGTASSHMLAERGWQVNLVEQEPALA-QHASGNPV
MNMC_NITMU      -------PPPVRLAPTTAIVIGGGIAGCAAASALASRGLIVELLESH-TLG-AGASGNPI
MNMC_CHRSD      -----WFTPPRARPARHVVVIGAGLAGTSVAAALARRGVAVTLLERDAPGA-G-ASGNRQ
MNMC_HAHCH      -----EPNQPAALPHKEAVVIGSGLSGANVAYALATRGWKVTVLEAADRIA-PEASGNPQ
MNMC_MARN8      -----EDVSAPTVGTDPIVIIGAGIAGAALARNLAERGVPVVLADQASGPG-AGASGNDQ
MNMC_IDILO      ------EVCQKYYDRRDVTIIGGGISAACSALALKHRGVNVRVISAG--SA-DGASGNPQ
MNMC_PSEA6      TRCAENHAQTALASKPKVAIIGAGIAGASMAYAMAKKGYDCDIYFNDATPA-QGASGNPQ
MNMC_PSET1      ---APSYFNHDVSPLSNVAVIGGGIASSCILYSLAKRGISSQLFCQDAAPA-MGASHNVQ
MNMC_COLP3      ----GYYLRPLITKPQHVSIIGGGIASACAAYALTKQGVKVTLYCKDTSLA-QGGSSNAI
MNMC_SHEB5      -AAILSSA-----TPSSIAIIGGGLASAHLALSLAERGQGAQVFCKDAELG-QGASGNRQ
MNMC_SHEB9      -AAILSSP-----TQSSIAIIGGGLASAHLTLSLAERGQGAQVFCKDAELG-QGASGNRQ
MNMC_SHEB8      -AAILSSA-----TQSSIAIIGGGLASAHLALSLAERGQGAQVFCKDAELG-QGASGNRQ
MNMC_SHEPC      -AAILSSD-----APSSIAIIGGGLASAHLALSLAERGQSTQIFCKDAKLG-QGASGNRQ
MNMC_SHESW      -AAILSSD-----APSSIAIIGGGLASAHLALSLAERGQSTQIFCKDAKLG-QGASGNRQ
MNMC_SHESM      -PTALAT------KDHPIAIVGGGLASANLMLSLAERGQSSTLFCKDNELG-QGASGNRQ
MNMC_SHESR      -PAALVA------KDHPVAIVGGGLASANLMLSLAERGQSSTLFCKDNELG-QGASGNRQ
MNMC_SHESA      -PATLAA------IDHPVAIVGGGLASANLMLSLAERGQSSTLFCKDNELG-QGASGNRQ
MNMC_SHEON      -PSQVAS------TKQPIAIIGGGLASAHLMLSLAEREQSSILFCKDNDLG-QGASGNRQ
MNMC_SHEDO      -PNSLGERRQAVNNSDSIAIIGGGIAGACLALSLAERGKAVTLYCKDDKLG-DGATGNRQ
MNMC_SHEFN      -PPLHS------NNNSPIAIIGGGIASASLALSLAERGKDVIIYCKDDTLG-QGASGNKQ
MNMC_SHESH      -SAANEGDE---DCDGEIAIIGGGVASTHLALSLAQRNKKVRIFCSDANFA-QQASGNKQ
MNMC_SHEWM      -GQASSETD---SESDTFAIIGGGVASAHLALSLAQRNKTVRLFCNDSSLA-QQASGNKQ
MNMC_SHELP      -TQGRE---------GETAIIGGGVASANLALSLAERGKKVSFFCMDKAPG-EQASGNKQ
MNMC_SHEAM      -KPPFKPR--------DISIVGAGVAGASLALSLLRRGHKVTLYCADAAPG-IGASGNRQ
MNMC_SACD2      HSWHLQTANSEHQPPKTAIVIGGGLAGAHAAHALALRGVNVTLLERAPNLA-NGASSNLQ
MNMC_DICNV      ---SWTDYPAPKFDTRPIAVIGAGIAGATTAYELAQRGKVVHVYHDPENPC---ASAVPV
                                    :* *:                                   

MNMC_ECOLI      GALYPLLSKHDEALNRFFSNAFTFARRFYDQLP-------------VKFDHDWCGVTQLG
MNMC_ECODH      GALYPLLSKHDEALNRFFSNAFTFARRFYDQLP-------------VKFDHDWCGVTQLG
MNMC_SHIB3      GALYPLLSKHDEALNRFFSNAFTFARRFYDQLP-------------VKFDHDWCGVTQLG
MNMC_SHIBS      GALYPLLSKHDEALNRFFSNAFTFARRFYDQLP-------------VKFDHDWCGVTQLG
MNMC_ECOLC      GALYPLLSKHDEALNRFFSNAFTFARRFYDQLP-------------VKFDHDWCGVTQLG
MNMC_ECOHS      GALYPLLSKHDEALNRFFSNAFTFARRFYDQLP-------------VKFDHDWCGVTQLG
MNMC_SHIFL      GALYPLLSKHDEALNRFFSNAFTFARRFYDQLP-------------VKFDHDWCGVTQLG
MNMC_SHIF8      GALYPLLSKHDEALNRLFSNAFTFARRFYDQLP-------------VKFDHDWCGVTQLG
MNMC_SHISS      GALYPLLSKHDEALNRFFSNAFTFARRFYDQLP-------------VKFDHDWCGVTQLG
MNMC_ECO57      GALYPLLSKHDEALNRFFSNGFTFARRLYDSLP-------------VKFDHDWCGVTQLG
MNMC_SHIDS      GALYPLLSKHDEALNRFFSNAFTFARRFYDQLP-------------VKFDHDWCGVTQLG
MNMC_ECOK1      GALYPLLSKHDEALNRFFSNAFTFARRFYDLLP-------------VKFDHDWCGVTQLG
MNMC_ECOUT      GALYPLLSKHDEALNRFFSNAFTFARRFYDLLP-------------VKFDHDWCGVTQLG
MNMC_ECOL6      GALYPLLSKHDEALNRFFSNAFTFARRFYDLLP-------------VKFDHDWCGVTQLG
MNMC_ECOL5      GALYPLLSKHDEALNRFFSNAFTFARRFYDLLP-------------VKFDHDWCGVTQLG
MNMC_ECOSM      GALYPLLSKHDEALNRFFSNAFTFARRFYDQLP-------------VKFDHDWCGVTQLG
MNMC_ECO24      GALYPLLSKHDEALNRFFSNAFTFARRFYDSLP-------------VKFDHDWCSVTQLG
MNMC_CITK8      GALYPLLSKHDAAINLFFPSAFTFARRLYDALP-------------VTFDHDWCGVTQLG
MNMC_SALPA      GALYPLLSKHDAAINRFFPTAFTFARRLYDALP-------------VSFDHDWCGVTQLG
MNMC_SALTY      GALYPLLSKHDAAINRFFPTAFTFARRLYDALP-------------VSFDHDWCGVTQLG
MNMC_SALPB      GALYPLLSKHDAAINRFFPTAFTFARRLYDALP-------------VSFDHDWCGVTQLG
MNMC_SALCH      GALYPLLSKHDAAINRFFPTAFTFARRLYDALP-------------VSFDHDWCGVTQLG
MNMC_SALTI      GALYPLLSKHDAAINRFFPTAFTFARRLYDALP-------------VSFDHAWCGVTQLG
MNMC_SALAR      GALYPLLSKHDAAINRFFPTAFTFARRLYDALP-------------VSFDHDWCGVTQLG
MNMC_ENT38      GALYPLLSAHDPAISQFFPAAFTFARRLYDALP-------------VTYAHDWCGVTQLG
MNMC_KLEP7      GALYPLLSQHDPALARFFPAAFTFARRMYDALP-------------VMFDHQWCGVTQLG
MNMC_CROS8      GALYPLLSHHDAALAAFFPAAFTFARRLYDALP-------------VSFDKDWCGVTQLG
MNMC_YERPG      GALYPLLNGKNDALETFFTSAFTFARRQYDQLLEQG----------IAFDHQWCGVSQLA
MNMC_YERPY      GALYPLLNGKNDALETFFTSAFTFARRQYDQLLEQG----------IAFDHQWCGVSQLA
MNMC_YERPE      GALYPLLNGKNDALETFFTSAFTFARRQYDQLLEQG----------IAFDHQWCGVSQLA
MNMC_YERPA      GALYPLLNGKNDALETFFTSAFTFARRQYDQLLEQG----------IAFDHQWCGVSQLA
MNMC_YERPN      GALYPLLNGKNDALETFFTSAFTFARRQYDQLLEQG----------IAFDHQWCGVSQLA
MNMC_YERPP      GALYPLLNGKNDALETFFTSAFTFARRQYDQLLEQG----------IAFDHQWCGVSQLA
MNMC_YERPS      GALYPLLNGKNDALETFFTSAFTFARRQYDQLLEQG----------IAFDHQWCGVSQLA
MNMC_YERPB      GALYPLLNGKNDALETFFTSAFTFARRQYDQLLEQG----------IAFDHQWCGVSQLA
MNMC_YERP3      GALYPLLNGKNDALETFFTSAFTFARRQYDQLLEQG----------IAFDHQWCGVSQLA
MNMC_YERE8      GALYPLLNGKNDALEIFFTSAFTFARRQYSQLLEQG----------IRFDHQWCGVSQLA
MNMC_SERP5      GALYPLLNGRGDALENFFSAAFLFARRQYDALLKQG----------VTFDHQWCGVSQLA
MNMC_PECAS      GALYPLLNNRHDAVSRFFSLAFDFAHRSYSALAQQG----------LEFEHQWCGVSQLA
MNMC_PHOLL      GALYPLLNGSNNGLEKFFTSAFTFARRQYEQFSAQG----------IDFDHQWCGVSQLA
MNMC_VIBCH      GAVYPLLSGDHNAVSRVFAPAFLFARQWIEQAA-EQ----------INFDHDWCGVTQLM
MNMC_VIBC3      GAVYPLLSGDHNAVSRVFAPAFLFARQWIEQAA-EQ----------INFDHDWCGVTQLM
MNMC_VIBCB      GAVYPLLNGPHKGVSRVFAPGFLFARQFVDQAA-QD----------IQFDHDWCGITQLM
MNMC_VIBPA      GAVYPLLNGPHTGVSRVFAPAFLFARQFVEQAA-QE----------IDFDHDWCGVTQLM
MNMC_VIBVU      GAVYPLLNGNHDGVSRVFAPAFLFARQFVEQAA-QA----------LTFDHDWCGVTQLM
MNMC_VIBVY      GAVYPLLNGSHDGVSRVFAPAFLFTRQFVEQAA-QA----------LTFDHDWCGVTQLM
MNMC_ALIF1      GAVYPLLNEKFNSLSRFFAPGFIFARQFIDQAA-KH----------VEFDHDWCGVTQLK
MNMC_PHOPR      GAVYPLLNGSNDCLTRFFGPAFFYARQFVEQAA-MN----------STFSHDWCGVTQLA
MNMC_AERHH      GALYPLLNGEHDVLSRFYSLAFGFARSRLLALA-KR----------HPVAFSLCGVTQLG
MNMC_AERS4      GALYPLLNGEHDALSRFYSLAFGYARQRLLSLA-KH----------HPIAFDLCGVVQLG
MNMC_PSYIN      AALYPLLNEQHDALSQFFANAFLYSRNYIKQIN-QT----------QPVDYSFSGVLQLY
MNMC_ACTPJ      GAIYPQLSDDDERNIRFYVHCFDYALQRLS-QIEPL----------VEFEHALTGVALYA
MNMC_ACTP2      GAIYPQLSDDDERNIRFYVHCFDYALQRLA-QIEPL----------VNFEHALTGVALYA
MNMC_HAEDU      GAIYPQLSDDDPRNVRFYVHCFDYALQRLK-QFEKL----------VPFEHALTGVVLSA
MNMC_HAEIN      GAFYPQLSDDNALTVDFYLHAFSYGRQLLDWAIEQN----------IVFEHEFCGVALCA
MNMC_HAEIG      GAFYPQLSDDNVLTVDFYLHAFSYGRQLLDWAIEQN----------IAFEHEFCGVALCA
MNMC_HAEI8      GAFYPQLSDDNALTVDFYLHAFSYGRQLLDWAIEQN----------IEFEHEFCGVALCA
MNMC_HAEIE      GAFYPQLSDDNALTVDFYLHAFSYGRQLLDWAIAQN----------IAFEHEFCGVALCA
MNMC_HAES1      GAFYPQLSDDDDRNIRFYVHAFFYALQQLQWAIKQG----------IEFEHEFCGVALCA
MNMC_HISS2      GAFYPQLSDDDDRNIRFYVHAFFYALQQLQWAIKQG----------IEFEHEFCGVALCA
MNMC_PASMU      GAFYPQLSDDDLRYIRFYIHAFAYGKQRFNWAIEQG----------ITFEHDFCGVALCA
MNMC_MANSM      GAFYPQLSDDDIHNIRFYIHAFAYGQQQLRWAIQQG----------IEFEHEFCGVALCA
MNMC_ACTSZ      GAFYPQLSDDDERNIRFYIHAFAYGLQRLQWAVAHN----------VPFEHRFCGVALCG
MNMC_CAUVC      ALVTPALDAGGGPRAALYAQALSRAVTLYEAQPD---------------AVLAREVLQLA
MNMC_CAUSK      ALVTPALDAGGGPRAALPAQAFARAAALYEALPE---------------AVIARGALKLS
MNMC_MARMM      GLLTPRLEKADRPHVRATLAAFDFARRLYDGRP----------------GFHAEPVRRLP
MNMC_HYPNA      ALMMPRLDAGDTAEARLLIDAYLAARDFYLGRP----------------GAELTDVRQMP
MNMC_CUPNH      AAMHAHLSADDSLLSRLSRTGNQYALRAWAELAEAG----------HAVGWHGCGVLQIG
MNMC_CUPPJ      AAMHAHISSDDSLLSRLSRAGNQYALRAWAALAGAG----------QPVGWHGCGVLQIG
MNMC_CUPMC      AAMHAHVSADDSFLSRLSRAGNLHALRAWGALEAAG----------YPVGWHGTGVLQIG
MNMC_RALSO      AAMHPHVSIDDSVLSRLSRAGNLLARRHWEALDRAG----------FATGFHPTGVLQLA
MNMC_BURCM      GVFHPLMTRDDNVASRLTRSGFLHALARWRALEDAG----------HAFARSTRGMIHLA
MNMC_BURA4      GVFHPLMTRDDNVASRLTRSGFLHALARWRALEEAG----------HAFARSTRGMIHLA
MNMC_BURCA      GVFHPLMTRDDNVASRLTRGGFLHALARWRALERAG----------HAFSRSTHGMLHLA
MNMC_BURCH      GVFHPLMTRDDNVASRLTRGGFLHALARWRALERAG----------HAFSRSTHGMLHLA
MNMC_BURCC      GVFHPLMTRDDNVASRLTRGGFLHALARWRALERAG----------HAFSRSTHGMLHLA
MNMC_BURL3      GVFHPLMTRDDNVASRLTRGGFLHAIARWRALENAG----------HAFARSTNGMIHLA
MNMC_BURVG      GVFHPLMTRDDNVASRLTRSGFLHALARWRALEHAG----------HTFARSTRGMIHLA
MNMC_BURM1      GVFHPLMTRDDNVASRLTRAGFLYALARWRALEAGG----------HAFARSTHGMVHLA
MNMC_BURMA      GVFHPMIARDDNLAARLSRAGFLHALHRWRALERAG----------HAFSRSTHGLVQLA
MNMC_BURM9      GVFHPMIARDDNLAARLSRAGFLHALHRWRALERAG----------HAFSRSTHGLVQLA
MNMC_BURM7      GVFHPMIARDDNLAARLSRAGFLHALHRWRALERAG----------HAFSRSTHGLVQLA
MNMC_BURP0      GVFHPMIARDDNLAARLSRAGFLHALHRWRALERAG----------HAFSRSTHGLVQLA
MNMC_BURP1      GVFHPMIARDDNLAARLSRAGFLHALHRWRALERAG----------HAFSRSTHGLVQLA
MNMC_BURPS      GVFHPMIARDDNLAARLSRAGFLHALHRWRALERAG----------HAFSRSTHGLVQLA
MNMC_BURMS      GVFHPMIARDDNLAARLSRAGFLHALHRWRALERAG----------HAFSRSTHGLVQLA
MNMC_BURP6      GVFHPMIARDDNLAARLSRAGFLHALNRWRALERAG----------HAFSRSTHGLVQLA
MNMC_BURTA      GVFHPMIARDDNLAARLSRAGFLHALNRWRALEHAG----------HTFARSAHGLVQLA
MNMC_PARPJ      GVFHPMISRDDSIASRVTRAGFLYTLRRWAALERLG----------HAPLRGGQGLLQIA
MNMC_PARXL      GVFHPMISRDDSVASRVTRTGFLYSLRHWAALERLG----------YGPSRGSKGLLQIA
MNMC_PARP8      GVFHPMMSRDDSVGSRITRAGFLYALRQWSALEHRG----------HRPLRGPEGLLQIA
MNMC_LEPCP      GLMHGIFNAPDSPHARWFRAAAMHTARNAAAGLAAG----------ELAG-TLAGFLRLD
MNMC_METPP      GLFHGSFHRDDGPHARTLRAAALATERLAGAWIAQG----------RVSG-QLAGCLRLE
MNMC_BORBR      AALTPVIARDDNPRARLSRAGSQRAWLRWRDLPA-------------PAAPRRCGTVQLE
MNMC_BORPA      AALTPVIARDDNPRARLSRAGSQRAWLRWRDLPA-------------PAAPRRCGTVQLE
MNMC_BORPD      AALTPVIARDDNPRARLSRAGSQRALARWAGLRP-------------GAAPRRCGTLQLE
MNMC_BORA1      AALTPLVARDDNARARLARAGSQRAWHRWQGL----------------DAVRKVGALQLE
MNMC_AZOSB      GVLRPLPSLDDNRMGRLTRAGTLYGWRHIQRLQAAG----------LPLRAEACGVLHLA
MNMC_AROAE      GVLRPLPSLDDNRLARITRAGALYGLHHLRQLTEAG----------LPVRWDACGVLHLA
MNMC_DECAR      GMLRPLPSADDNRLSRITRAGFLATRALLAALPEA--------------RWSPCGVLHLA
MNMC_THIDA      AVFRPLISRDDNRATRLTRAAFLHDLRAWAALGEC-------------VQWARCGVLHLA
MNMC_ACIAC      GVFAPHVSPDDSLLSRLSRCGVRATLQAL-EASGL----------SEGEDWSACGVLEHE
MNMC_ACISJ      GVFAPNVSQDDNLISRLSRAGVRITLNTLAQLPAE----------TRGTDWSACGTLEHR
MNMC_DELAS      GLFCPHVSPDDSLLSRLSRDGARLTLAQLQMLSGQGLL-------QPGTDWCDTGVLEHG
MNMC_POLNA      GVLAPHVSPDDSLLSRLSRSGIRAMLQQADALLQT------------NIDWSPTGVLEHC
MNMC_POLSJ      GVLAPHVSPDDSLLSRLSRSGVRATLQQAHALLDA------------GTDWNPTGVLEHC
MNMC_MAGMM      GLFSPRLTAGVSLDGRFHAAAYFHALDLYAQLAQHT----------PEIYHPGRGLLQMA
MNMC_LEPBJ      AISHPHLTKIPGPISLFTLRAFRYALSFLSSFADKD-------------QFGKVGSFHGV
MNMC_LEPBL      AISHPHLTKIPGPISLFTLRAFRYALSFLSSFADKD-------------QFGKVGSFHGV
MNMC_LEPIN      AISHPHLTKIPGPISLFTLRAFRYALSFLSSFADQN-------------FFEKTGLFHSV
MNMC_LEPIC      AISHPHLTKIPGPISLFTLRAFRYALSFLSSFADQN-------------FFEKTGLFHSV
MNMC_MARMS      GMLYPKLASQDTPVNRFYLSAYLHATR-LYSSLDRHK-----------QFWDACGLIQIP
MNMC_HYDCU      GAIHPLVTADWNVRSQFYLKGFECSLRWLRPWFDSHS-----------IVGQQNGLMQLA
MNMC_CAMJJ      GILSSLILKPKVNLGEFSELSFIEASRFYRQILD----------------LKFKGVVEFA
MNMC_CAMJ8      GILSSLILKPKVNLGEFSELSFIEASRFYRQILD----------------LEFKGVVEFA
MNMC_CAMJR      GILSSLILKPKVNLGEFSELSFIEASRFYRQILD----------------LEFKGVVEFA
MNMC_CAMJE      GILSSLILKPKVNLGEFSELSFIEASRFYRQILD----------------LEFKGVVEFA
MNMC_CAMJD      GILSSLILKSKVKLGEFSELSFIEASRFYRQILD----------------LNFKGVVEFA
MNMC_CAMC1      GALMPLVTKPGVNLGRMHINAFLQAVRFYKANLPK-------------SLIKFNGCIDYA
MNMC_CAMHC      GVLEPLITKKGVKLGEMHKYAFKMAVKFYKKNVPK-------------NLAKFCGAKEFA
MNMC_CAMFF      GILMPLITKPKVALGNMHMSAFLFARHFYANS----------------PFADFCGVYDYG
MNMC_LEGPA      AVLFPKLSTYKSPFTQFMLYSFLYANDVYKELLKHY------------DLGELKGSLLLA
MNMC_LEGPH      AVLFPKLSTYKSPFTQFMLYSFLYANDVYKELLKYY------------DLGELKGSLLLA
MNMC_LEGPL      AVLFPKLSIYKSPFTQFMLYSFLYANDVYKELLKHY------------NLGELKGSLLLA
MNMC_LEGPC      AVLFPKLSTYKSPFTQFMLYSFLYANDVYKELLKHY------------DLGELKGSLLLA
MNMC_ACIBT      ALLNPKLCPIEQSHEHLMTLSWQHALNFYKNF-------------------QAFHPIQIQ
MNMC_ACIBY      ALLNPKLCPIEQSHEHLMTLSWQHALNFYKNF-------------------QAFRPIQIQ
MNMC_ACIBC      ALLNPKLCPIEQSHEHLMTLSWQHALNFYKNF-------------------QAFRPIQIQ
MNMC_ACIAD      ALLNPKLCPITQCHDHLMVLCWQYARRFYQNF-------------------EAFRLIQVN
MNMC_PSYA2      ALLAPNMTPIHHVYEHLHSIGYLYSGRLYRYFNQQAAIQ------KSPLILEQTGTLDLL
MNMC_PSYCK      ALLAPNMTPIHHVYEHLHSIGYLYSGRLYRYFNQQAAIQ------KSPLILEQTGTLDLL
MNMC_PSYWF      ALLAPKMTPLAHVAEHLHSISYLYSQRFYRQIDQGEHK-----------IFTPTTTLDLL
MNMC_PSEAE      GVLYLKLSAHGTPLSRLVLSGFGHTRRLL-ERLR------------RGHDWDACGVLQLA
MNMC_PSEAB      GVLYLKLSAHGTPLSRLVLSGFGHTRRLL-ERLR------------RGHDWDACGVLQLA
MNMC_PSEA7      GVLYLKLSAHGTPLSRLVLSGFGHTRRLL-ERLR------------RGHDWDACGVLQLA
MNMC_PSEMY      GVLYLKLSAHGTVLSRLIVAGFGHTRRLL-ERLQ------------RGSDWDACGVLQLA
MNMC_PSEP1      GVLYLKLSAHGTALSQMILSGFGYTRRQL-QRLQ------------RGRDWDACGVLQLA
MNMC_PSEPK      GVLYLKLSAHGTALSQMILSGFGYTRRQL-QRLQ------------RGRDWDACGVLQLA
MNMC_PSEPG      GVLYLKLSAHGTALSQMILSGFGYTRRQL-QRLQ------------RGQDWDACGVLQLA
MNMC_PSEPW      GVLYLKLSAHGTALSQMILSGFGYTRRQL-ELLQ------------RGQDWDACGVLQLA
MNMC_PSEE4      GVLYLKLSAHGTTLSQMILSGFGYTRRWL-EHLQ------------RGQDWDACGVLQLA
MNMC_PSEF5      GVLYLKLSAHGTALSQMILSGFGYTRRQL-EHLQ------------RGQDWDGCGVLQLA
MNMC_PSEPF      GVLYLKLSAHGTALSQLIVSGFGYTRRVL-ETLQ------------RGTDWDDCGVLQLA
MNMC_PSE14      GVLYLKLSAHGTALSQLILSGFGHTRRLL-ERLQ------------RGVDWDACGVLQLT
MNMC_PSEU2      GVLYLKLSAHGTALSQLILSGFGHTRRLL-ERLQ------------RGVDWDACGVLQLT
MNMC_PSESM      GVLYLKLSAHGTALSQLILSGFGHTRRQL-ERLQ------------RGVEWDACGVLQLT
MNMC_PSEU5      GVLYLKLSAHGTALSKLVVGGFSYTRRLL-GHLQ------------QGQDWQACGVLQLI
MNMC_CHRVO      GVLYTKLSPHLTPLTRLVLSGYAYSLRAL-RCLLP-----------EDGDWQACGVLQLA
MNMC_METFK      GVLYPKLARKDVPLGRLSLAGYLHSLRLL-QQLGL-----------DATAHARCGMLQLA
MNMC_NITMU      GILHARLSAGMNALHRFVLASYGHALALLDEKIPV-----------DGVMRSECGELQLS
MNMC_CHRSD      GALYVKLAAETNPQSRVYLAGLLYTRRWL-TALDP-----------EQRLWQDCGVLQLA
MNMC_HAHCH      GALYIKPGVEWSINTRIHANAFLYAERFYSEIANL-----------PTPIWNPCGVLQLA
MNMC_MARN8      GALYVKLGVEYNDQTELAATALSFSQRFYQRWQG--------------EFWHPSGLLQLA
MNMC_IDILO      GAVYPLLHAEYTPLSRFYWQAFSTATSFYRNFCD--------------DHWFPVGVMQPA
MNMC_PSEA6      AGFYPQLNVDASHASQINAHSFVYAANQYRQLQSQG----------FHFAHQWCGVLQLG
MNMC_PSET1      GAVYPHLQAKNSPHSELFAHSFLYAKRLYKQLLNDG----------FSFDHSWCGVLQHA
MNMC_COLP3      GALYPLLHQQEDDISSFYQQAFWRAKALYTEIAEQG----------FSFAHQWCGLLEVS
MNMC_SHEB5      GAIYPLLTPENDELSRFFQQAFLFSRRRVQALTSAP------AVNQTSISHDFCGVLQTA
MNMC_SHEB9      GAIYPLLTTENDELSRFFQQAFLFSRRRVQALTSAP------ADNQTPISHNFCGVLQTA
MNMC_SHEB8      GAIYPLLTPENDELSRFFQQAFLFSRRRVQALTSAP------ADNQTPISHVFCGVLQTA
MNMC_SHEPC      GAIYPLLTPENDELSRFFQQAFLFSRRRVQALTSAP------APNQTPISHNFCGVLQTA
MNMC_SHESW      GAIYPLLTPENDELSRFFQQAFLFSRRRVQALTSAP------APNQTPISHNFCGVLQTA
MNMC_SHESM      GAIYPLLTPENDELSRFFQQAFLFSRRRIEALSHASMMETEAAPTITAISHDFCGVLQTG
MNMC_SHESR      GAIYPLLTPENDELSRFFQQAFLFSRRRIEALSHASMMETETAKNVTAISHDFCGVLQTG
MNMC_SHESA      GAIYPLLTPENDELSRFFQQAFLFSRRRIEALSQASMMDTNAAPHVTVISHDFCGVLQTG
MNMC_SHEON      GAIYPLLTPENDELSRFFQQAFLFSRRRIAALSLASMKGSDVASGVMPISHDFCGVLQTG
MNMC_SHEDO      GAIYPLLTPENSHLSQFFQQAFLFSRRRLLALLHEV----------YPIGHQLCGVLQTG
MNMC_SHEFN      GAIYPLLTPENGSLSQFFQQVFLYSRRRIQALVDDG----------YDIGHEWCGVLHTG
MNMC_SHESH      GAVYPLLTPDNGHLSHYFQQGYLFTRRRLQALVDDK----------FAVSYDFCGVLQTG
MNMC_SHEWM      GAVYPLLTPDNGHLSHYYQQGYLFSRRRLQSLIKDG----------FKVGYDFCGVLQTG
MNMC_SHELP      GAIYPLLTPEHGSLSHYFLLGYLFSRQRIKQLLESG----------HEIPHDFCGVLQTG
MNMC_SHEAM      GAIYPLLTPEDDHLTRLFVPAFLYAKRFVESLAHHP------------LPFDFCGVLQTG
MNMC_SACD2      GLVYTRLSLSGNPLSRFNMAAQLYADRFYHSHNFYT------------TCGEASGVLHLA
MNMC_DICNV      AVPFFLPGKTDTPMRQFHLAAWHDLCRELKCCPQGI--------------VDRMPIALAV
                .                                                           

MNMC_ECOLI      WDEKSQHKIAQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_ECODH      WDEKSQHKIAQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_SHIB3      WDEKSQHKITQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_SHIBS      WDEKSQHKIAQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_ECOLC      WDEKSQHKIAQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_ECOHS      WDEKSQHKIAQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_SHIFL      WDEKSQHKIAQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_SHIF8      WDEKSQHKIAQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_SHISS      WDEKSQHKIAQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_ECO57      WDEKSQHKIAQMLSM----DLPEELAVAVEANAVEQITGVTTNCSGITYPQGGWLCPAEL
MNMC_SHIDS      WDEKSQHKIAQMLSM----DLPEELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_ECOK1      WDEKSQHKIAQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_ECOUT      WDEKSQHKIAQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_ECOL6      WDEKSQHKIAQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_ECOL5      WDEKSQHKIAQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPQGGWLCPAEL
MNMC_ECOSM      WDEKSQHKIAQMLSM----DLPAELAVAVEANAVEQITGVATNCSGITYPEGGWLCPAEL
MNMC_ECO24      WDEKSQHKIAQMLSM----DLPADLAVAVGANEVEGVTGVVTNCGGITYPQGGWLCPAEL
MNMC_CITK8      WDEKSQHKIDQMLSL----ALPDALAVAVDPDQAQQETGVATHCRGITYPAGGWLCPAQL
MNMC_SALPA      WDEKSQQKITQMLSL----ALPAGLASALNAEEAEQAVGVTTRCGGITYPAGSWLCPEQL
MNMC_SALTY      WDEKSQQKIAQMLSL----ALPAGLASALNAEEAEQAVGVTTRCGGITYPAGGWLCPEQL
MNMC_SALPB      WDEKSQQKIAQMLSL----ALPAELASALNAEEAEQAVGVTTRCGGITYPAGGWLCPEQL
MNMC_SALCH      WDEKSQQKIAQMLSL----ALPAELASALNAEEAEQAVGVTTRCGGITYPAGGWLCPEQL
MNMC_SALTI      WDEKSQQKIAQMLSL----ALPAGLASALNAEEAEQAVGVTTRCGGITYPAGGWLCPEQL
MNMC_SALAR      WDEKSQQKIARMLSL----ALPAGLASALNAEETTQAVGVTTRCGGITYPAGGWLCPEQL
MNMC_ENT38      WDEKSQQKIDQMLSL----GLPEQIAAAVDAQQILDNTGLPTDCGGIRYPEGGWLCPAEL
MNMC_KLEP7      WDEKSTHKIAQMLAL----NLPPDIACAVTAEQVAGLTGVDTGCGGITYPAGGWLCPQQL
MNMC_CROS8      WDEKSQTKINQMLDL----ALPDTLAHGVDAREVRERCGVKTGCGGIEYPQGGWLCPAQL
MNMC_YERPG      FDDKSRGKIEKMLHT----QWPVEFAEAMSREQLSELAGLDCAHDGIHYPAGGWLCPSDL
MNMC_YERPY      FDDKSRGKIEKMLHT----QWPVEFAEAMSREQLSELAGLDCAHDGIHYPAGGWLCPSDL
MNMC_YERPE      FDDKSRGKIEKMLHT----QWPVEFAEAMSREQLSELAGLDCAHDGIHYPAGGWLCPSDL
MNMC_YERPA      FDDKSRGKIEKMLHT----QWPVEFAEAMSREQLSELAGLDCAHDGIHYPAGGWLCPSDL
MNMC_YERPN      FDDKSRGKIEKMLHT----QWPVEFAEAMSREQLSELAGLDCAHDGIHYPAGGWLCPSDL
MNMC_YERPP      FDDKSRGKIEKMLHT----QWPVEFAEAMSREQLSELAGLDCAHDGIHYPAGGWLCPSDL
MNMC_YERPS      FDDKSRGKIEKMLHT----QWPVEFAEAMSREQLSELAGLDCAHDGIHYPAGGWLCPSDL
MNMC_YERPB      FDDKSRGKIEKMLHT----QWPVEFAEAMSREQLSELAGLDCAHDGIHYPAGGWLCPSDL
MNMC_YERP3      FDDKSRGKIEKMLHT----QWPVEFAEAMSREQLSELAGLDCAHDGIHYPAGGWLCPSDL
MNMC_YERE8      FDEKSRGKINKMLQT----DWPPQLAAAMSREQLSALAGLDCAHDGIHYPAGGWLCPSDL
MNMC_SERP5      YDEKSAGKIANMLAV----EWPQQLAVAADRTTLSALCGIDSGFGGINYPQGGWLCPAEL
MNMC_PECAS      WDEKSARKIEQILQG----EWPEELVVSVDAQQLEKQSGLNPGVNGITYPDGGWLCPAEL
MNMC_PHOLL      YDEKSSKKIEKMLAT----EWPNELAIGMNCHQLSEKCGLDIHHHGIHYPQGGWLCPAEL
MNMC_VIBCH      WDEKATDKLKSMLEG----NFPTQLVHGLSAEQTNQQVGVPVDKASVHYPLGGWLSPAEL
MNMC_VIBC3      WDEKATDKLKSMLEG----DFPTQLVRGLSAEQTNQQVGVPVDKASVHYPLGGWLCPAEL
MNMC_VIBCB      WDDKSADKLEKMLAG----NFTPELIHKLSSEETAEKIGLPIDMASVHYPLGGWLCPAEL
MNMC_VIBPA      WDDKSTDKLEKMLEG----NFSPELIRKLSAEETAETIGLSIDMASVHYPMGGWLCPAEL
MNMC_VIBVU      WDEKSTNKLDKMLSG----NFAPELIQKLSVGETAAKIGLPIDMASVHYPLGGWLCPAEL
MNMC_VIBVY      WDEKSTNKLDKMLSG----NFAPELIQKLSAEETAAKIGLPIDMASVHYPLGGWLCPAEL
MNMC_ALIF1      WDEKSANKLNKMLEG----NFPNELVSSFDIDKTNQMVGLPINMESVHYSLGGWLCPKQL
MNMC_PHOPR      WDEKSTSKINKMLSG----NFPQELVHALDIEQTKQKTAITSNFSSVYYPLGGWLCPQEL
MNMC_AERHH      YDDKSAAKLAKMAQG----PFPPELMQVLSEPEAEQVVGLPCGHGGVSYPQGGWLCPADL
MNMC_AERS4      YDDKSTAKLAKMQQG----PFPHALMRPLTPVEAEHECGLPSGHAGVSYPLGGWLCPADL
MNMC_PSYIN      YDPSASKKLDKILQA----GLPQELVEQLTEIETDNIAGISIAQKSLHYPLGGWLSPKQL
MNMC_ACTPJ      YNDKTAKKLEKIARQ----TNDDSLFKLCSAAELSEKIGLKVPNGGAFMPQSGWLSPIQF
MNMC_ACTP2      YNDKTAKKLEKIARQ----TNDDSLFKLCSAAELSEKIGLKVPNGGAFMPQSGWLSPIQF
MNMC_HAEDU      YNEKTAQKLQKIARQ----TQNQDLFKWCQAEELTEYLGVAIANEGAFIPQAGWLSPVQF
MNMC_HAEIN      YNEKSAVKLTKISQL----GLPNEIFQMLSAEQLSEKVGLPLNCEGGWIEQGAWLAPRQF
MNMC_HAEIG      YNEKSAVKLTKISQL----GLPNEIFQMLSAEQLSEKVGLPLNCEGGWIEQGAWLAPRQF
MNMC_HAEI8      YNEKSAVKLTKISQL----GLPNEIFQMLSAEQLSEKVGLPLNCEGGWIEQGAWLAPRQF
MNMC_HAEIE      YNKKSAVKLAKISQL----GLPNEIFQMLNAEQLSEKVGLPLNCKGGWIEQGAWLAPRQF
MNMC_HAES1      YDHKSAVKLAKISSY----QWSKSLYQNLNKEQLSEKIGLPLDCAGGFIPQGAWLAPRQF
MNMC_HISS2      YDHKSAVKLAKISSY----QWSKSLYQNLNKEQLSEKIGLPLDCAGGFIPQGGWLAPRQF
MNMC_PASMU      YDAKSAVKLAKISAL----QLPPSLYQPLSQQALSEQVGLPLPCDGGFIAQGAWLSPQQF
MNMC_MANSM      YDEKSAVKLAKISDY----DWDTSLYQPLNQQELSEKAGLPLPCGGGFIPQGAWLAPRQF
MNMC_ACTSZ      YDEKSAAKLDKISAY----QWDKKLYAGMNREELAQTVGLPLPCGGGFIPNGGWLAPRQF
MNMC_CAUVC      AGERDPARFATVADQ--DLFEPGDMRTLE--AEDTRARLETPT-PALAMAGARVIAPAEV
MNMC_CAUSK      VVPRDEARHAAVADQ--DLFEPGTMAVLD--AATATARLGEPVGEALSMSQALVVEPARV
MNMC_MARMM      KDEREAERFAILAD-----WMPDHL---------------DWTGEALVMPGAGRFEPARL
MNMC_HYPNA      RNETEEKRFGKLLAD--PPFPLEDL--------------EALSGGGILHKRALILRPRQM
MNMC_CUPNH      EDEAEGEAQRAALA---AMRLPEGFVRWMSAEEAAAAHHAGVPRGGLWFPQGGWVAPPDI
MNMC_CUPPJ      ENEAEAEAQRAALE---ALGLPESFVRWMSPGEAASQHGAGVPRGGLWFPQGGWVAPPDI
MNMC_CUPMC      EDDAENAAQQAALA---ELRFPESFVRWMSPQEATEQHGATVPRGGLWFPKGGWVAPPDI
MNMC_RALSO      EHADDAAEQQRIVQ---ALGFPADFIAWLDAARAADRVGAGVPQGGWWFAQAGWVAPPDI
MNMC_BURCM      ESADDFARMRDAFD---ALGAPSDYVSLLDTDAARAHLNLPVAHGGLLFPHGGAVWPAGV
MNMC_BURA4      ESADDFARMRDAFD---ALGAPSDYVSLLDTDAARAHLNLPVAHGGLLFPHGGAVWPAGV
MNMC_BURCA      ESADDFARMRDAFD---AFGPPSDYATLLDADAARAHLNLPVAQGGLLFPHGGAVWPAGL
MNMC_BURCH      ESADDFARMRDAFD---AFGPPSDYATLLDADAARAHLNLPVAQGGLLFPHGGAVWPAGL
MNMC_BURCC      ESADDFARMRDAFD---AFGAPSDYATLLDADAARAHLNLPVAQGGLLFPHGGAVWPAGL
MNMC_BURL3      ESADDFERMRDAFD---AFGPPSDYVSLLDIEAARAHLNLSVAQGGLLFPHGGAVWPAGL
MNMC_BURVG      ESADDFVRMRDAFD---ALGAPADHVTLLDADAARAHLNLPVAHGGLLFPHGGAVWPAGL
MNMC_BURM1      ESADDFARMRDAFD---ALGAPSDYARLLDTDAARAYLNLPVAHGGLLFPHGGAVWPAAL
MNMC_BURMA      TSDDEFERMRESID---ALGVPAELASALSRDDARALLRTDVAHGGWLFAQGGSISPATL
MNMC_BURM9      TSDDEFERMRESID---ALGVPAELASALSRDDARALLRTDVAHGGWLFAQGGSISPATL
MNMC_BURM7      TSDDEFERMRESID---ALGVPAELASALSRDDARALLRTDVAHGGWLFAQGGSISPATL
MNMC_BURP0      TSDDEFERMRESID---ALGVPAELASALSRDDARALLRTDVAHGGWLFAQGGSISPAAL
MNMC_BURP1      TSDDEFERMRESID---ALGVPAELASALSRDDARALLRTDVAHGGWLFAQGGSISPAAL
MNMC_BURPS      TSDDEFERMRESID---ALGVPAELASALSRDDARALLRTDVAHGGWLFAQGGSISPAAL
MNMC_BURMS      TSDDEFERMRESID---ALGVPAELASALSRDDARALLRTDVAHGGWLFAQGGSISPATL
MNMC_BURP6      TSDNEFERMRESID---ALGVPAELASALSRDDARALLRTDVAHGGWLFAQGGSISPAAL
MNMC_BURTA      TSADEFELMRESVD---TLGVPSELARTLSRDDAQALLRTDIAHGGWLFPQGGSISPAAL
MNMC_PARPJ      ADENEARSISEAIA---AFGYPGDYVTPVSAAEAQRLAGMPLARGGWFFPHGGWIDPASL
MNMC_PARXL      ADDEEALSISQAIA---AASYPSEYVTSVPADEAQRLAGMPLAHGGWFFPYGGWIDPASL
MNMC_PARP8      ADEEEALAMAHTFA---SFAWPREYVVSVTRDDAERIANMRVARGGWLFPHGGWIDPASL
MNMC_LEPCP      ERLNTTQA-EAQLS---AVGLPRAWLAWLDVAGARAAAGLELPCGAWHYGAAGWLDPAGY
MNMC_METPP      SRWSDDAA-RAAMA---AQQIAPGYIDWMDRAVASTLSGLALPSGAWFYPGGGWLAPRDY
MNMC_BORBR      RDAGRAAALAQTLQ---ILQFPADWVRMVDRDQAGALAGLPVARGGVFFADGMLVRPGAL
MNMC_BORPA      RDAGRAAALAQTLQ---ILQFPADWVRMVDRDQAGALAGLPVARGGVFFADGMLVRPGAL
MNMC_BORPD      RDAGRSAALAETLQ---QLQFPADWVRAVDRDEAAGLAGVPLARGGVFFADGLLVQPAAL
MNMC_BORA1      RDAGRSAALADTLA---ALHFPRDWVRWVESDEAEQLAGLPVARGGLYFADGLLVRPQPL
MNMC_AZOSB      RDAAQEAKMRAVVE---RLALPPAHLRFVSAAEASEIGGWPVPLGGWWFGDSGWVQPPSL
MNMC_AROAE      RDPVHEDKQRRVVE---AHRPPSDYLRFVERDEASTLAGWPLPVGGWWFPQGAWVSPPSL
MNMC_DECAR      REPEHEGQQRRAVE---QLGFPPEVLQFVESDEASRLLGQPVTIGGWWFPNGGWVQPPSV
MNMC_THIDA      RDAATAAKQQQALA---EIALPADYARWVDLGEARELAHWSVAAPGTFYSAAGWVVPGSL
MNMC_ACIAC      VDGKHRLPPAWAGD-----AAVGAEWSRPADAAALEAAGLPGATVAYWHARGGWLRPARL
MNMC_ACISJ      VDGTTGL--AWSDG-----P--GLDWSRPATPAQLQANGLSADTVACWHEHAGWVRPPQL
MNMC_DELAS      VEAAPRLPRDWQSP-----GP-GDHWSRPASADQLSAAGLPADAPACWHVQAGWVRPARL
MNMC_POLNA      VEHARQLPAAWHPGQ--ALADAAGDWTRPATSEQLKHCGLSPETPALWHVQAGWIKPARL
MNMC_POLSJ      VDHARKLPAAWQSD----WAEAAQDWTCLATSGQLAHCRLPASAPALWHVRAGWIKPASL
MNMC_MAGMM      ESEADVQRLQQALF---HSAWPPQHAQWWDAATASQQLGTPLPRGGLWHAQAGALNPSVL
MNMC_LEPBJ      TAEMNPERFRKSIEN-HKLTEEIASWKPNGSDFHKNDPFNKELEEGVLFRNGFWTRPGSI
MNMC_LEPBL      TAEMNPERFRKSIEN-HKLTEEIASWKPNGSDFHKNDPFNKELEEGVLFRNGFWTRPGSI
MNMC_LEPIN      TQEMDSERLQKGIEN-HKLSEEIVFWKPIASKFQNGD--FLENEPGVFFRNGFWTRPESI
MNMC_LEPIC      TQEMDSERLQKGIEN-HKLSEEIVFWKPIASKFQNGD--FLENEPGVFFRNGFWTRPESI
MNMC_MARMS      KNDKEAVRFQKLLDE-KLYPEAI-------------LQASKDREGCLFLPLSGWVVLTQL
MNMC_HYDCU      MTETMLQRLQEALTR-VGLPKSFAYW--CDADQASDLIGQKTDHEGLFFPEAGWVQPTSV
MNMC_CAMJJ      HNDLMQERFDTQREN-----------------VLFKISKN-----QAFLEEGGVIFPKNL
MNMC_CAMJ8      HNDLMQERFDTQREN-----------------VLFKISKN-----QAFLEEGGVIFPKNL
MNMC_CAMJR      HNDLMQERFDTQREN-----------------VLFKISKN-----QAFLEEGGVIFPKNL
MNMC_CAMJE      HNDLMQERFDTQREN-----------------VLFKISKN-----QAFLEEGGVIFPKKL
MNMC_CAMJD      HNDLMQERFDTQREN-----------------VLFKISKN-----QAFLEEGGVIFPKNL
MNMC_CAMC1      FDDELVKRYSSWQDQS---A-----------EDLFKFNESLKPYPGIFIKEAAYARPREI
MNMC_CAMHC      YNDDILKRFETHDKS-----------------EIFDFNRKDLPYASIFIKNAALLRPRKI
MNMC_CAMFF      VNDLEKTRLSLWDSE------------------IFKFENDFEPYPRAFIKSAAQIRPKEL
MNMC_LEGPA      HNEREKANQQSLIHWL---ELYPELGQLVDEKQSSELSGISLPCGGLFIPSSGWINSPEL
MNMC_LEGPH      HNEKEKANQQSLIHWL---ELYPELGQLVDEKQSSELSGISLPCGGLFIPSSGWINSPEL
MNMC_LEGPL      HNEREKANQQSLIHWL---ELYPELGQLVDEKQSSELSGISLPCGGLFIPSSGWINSPEL
MNMC_LEGPC      HNEREKANQQSLIHWL---ELYPELGQLVDEKQSSELSGISLPCGGLFIPSSGWINSPEL
MNMC_ACIBT      QMALKNAQDLLDLAD------QYPADIV---TQQTSSLESD--YPHILLTEAGAVSPHQL
MNMC_ACIBY      QMALKNAQDLLDLTN------QYPADIV---TQQTSSLESD--YPHIILTEAGAVSPHQL
MNMC_ACIBC      QMALKNAQDLLDLAD------QYPADIV---TQQTSSLESD--YPHILLTEAGAVSPHQL
MNMC_ACIAD      QLALKASDSLLNLAE------QYPKDVLDAHSAQQSPLETQ--YDYLTLHYAGVISPQLF
MNMC_PSYA2      VKTNIGTEQIADYPD------TMATTISTEKAHDISGLKDKDLAHNLYLPQSGLVNPQAL
MNMC_PSYCK      VKTNIGTEQILDYPD------TMATTISPEKAQDISGLKDKDLAHNLYMPQAGLVNPQAL
MNMC_PSYWF      QKSNVDVHQIAEYPE------QMATTLSLDSARDISGLQQQDLTANLYLPQSGLINPKAL
MNMC_PSEAE      FDAKEAQRQA-QLAA----AFPADLLHGLEREQAERLAGVALPAGGLFYPEAGWVHPPAL
MNMC_PSEAB      FDAKEAQRQA-QLAA----AFPADLLHGLDREQAERLAGVALPAGGLFYPEAGWVHPPAL
MNMC_PSEA7      FDAKEAQRQA-QLAA----AFPADLLHGLDREQAERLAGVALPAGGLFYPEAGWVHPPAL
MNMC_PSEMY      FDAKEAERQN-KLAA----AFPDDLLHALPQTEAEARAGIGLPAGGLFYPDAGWVHPPAL
MNMC_PSEP1      FDSKEAERQG-KLAA----AFDPGLLHCLARAEAEAIAGVALPGGGLFYPEGGWVHPPAL
MNMC_PSEPK      FDSKEAERQG-KLAA----AFDPGLLHCLARAEAEAIAGVALPGGGLFYPEGGWVHPPAL
MNMC_PSEPG      FDAKEAERQG-KLAA----AFDHDLLHALERAEAEAIAGVALPAGGLFYPEGGWVHPPAL
MNMC_PSEPW      FDSKEAERQG-RLAD----AFEGSLLRAVQRNEAEAIAGVGLPAGGLFYTEGGWVHPPAL
MNMC_PSEE4      FDDQEAARQA-KLAA----AFDESLLQRLEHDQAEAVAGIALASGGLFYPEGGWVHPPAL
MNMC_PSEF5      FNAKEAERQA-QLAA----AFPADLLHLLDQPQAQARAGIGLEHGGLFYPEGGWVHPPAL
MNMC_PSEPF      FNEKERERQA-QLAS----AFPEDLLQWLDQPEAQARAGVGLAHGGLYYPEGGWVHPPAL
MNMC_PSE14      FDDKEAQRQK-QLAD----AFPESLLHLLDQPAAEAQSGVALNSGGLFYPEGGWVHPPAL
MNMC_PSEU2      FDDKEALRQK-QLAD----AFPESLLHLLDKPAAEAQSGVALNSGGLFYPEGGWVHPPAL
MNMC_PSESM      FDDKEAQRQK-QLAE----AFPESLLHLLDRRAAEVQSGIALNSGGLFYPEGGWVHPPAL
MNMC_PSEU5      YDDKERQRQA-ELAE----AFPPSLVHPLERDAAEALAGVALTEGGLFYPDAGWAHPPAL
MNMC_CHRVO      HDGKEAEKQQ-ALAEL---NLPESVMRPLDRDAASELAGTDLPCGGLFFPQGGWVHPPAL
MNMC_METFK      FDQRELERCQ-TIAAQ---GFPPELLHWVDQEQAGNIAGIALQYGALYFPEAGWVRPRAY
MNMC_NITMU      FSAEEARRIG-KLATL---DWPAHVFRPVDAAEASALAGIELSYGGLWFPGSGWLAPPQL
MNMC_CHRSD      PGDKEATRQQRFLAHH---ALPERVLHGVDAATASQAAGTPLDAPGLDYPQAGWVRPDRL
MNMC_HAHCH      HNDKEAVRQQKFFQHN---RYPDEVIRPFTHQEASELAGVSLPASAMYLPGGGWLIPPQL
MNMC_MARN8      ATDQEQDRQRRFLERN---TYPENMLAAVTAAEASRIAGMPVQCEGLWFPSSGWIQPARA
MNMC_IDILO      FNDDRARRYQ-RIADE---LYAPDTVRYLSQPEAEQEAGVSLAVPALLYPKAGWLRPAAV
MNMC_PSEA6      FKPALAERYAKLTESQ---LWPGELVRYVKPSEAAQLANCEMPYSGLFMPLGGWIDPAQL
MNMC_PSET1      VKQPLVDRHENLAQQQ---LWPQTLMRNVTAEQGDTIAGVTTGYSGVYFEQGGWVNPPQL
MNMC_COLP3      YKEALIKRQQAFESLN---TWPNELIHGVNAKQASELANIDLPYGGLFMPNAGWMSPRDL
MNMC_SHEB5      HDERSQLRLDKIIQGQ---PWPSEIAYAVDAEQANAIAKINLDKPGFFYPLGGWVCPFEY
MNMC_SHEB9      HDERSQLRLDKIIQGQ---PWPSEIAYAVDAEQANAIAKINLDKPGFFYPLGGWVCPFEY
MNMC_SHEB8      HDERSQLRLDKIIQGQ---PWPSEIAYAVDAEQANAIAKINLDKPGFFYPLGGWVCPFEY
MNMC_SHEPC      HDERSQLRLDKIIQSQ---NWPSEIAYRVDAQQANCLANINIDKSGFFYPLAGWVCPYEY
MNMC_SHESW      HDERSQLRLDKIIQSQ---NWPSEIAYRVDAQQANCLANINIDKSGFFYPLAGWVCPYEY
MNMC_SHESM      HDERSQQRLDKIIQSQ---DWPAEIAYAVDANEANEIAQIGIDKAGFFYPLGGWVCPFEY
MNMC_SHESR      HDERSQQRLDKIIQSQ---DWPAEIAYAVDANEANEIAQIGIDKAGFFYPLGGWVCPFEY
MNMC_SHESA      HDERSQQRLDKIIQSQ---DWPAEIAYAVDANEANEIAQIGIDKAGFFYPLGGWVCPFEY
MNMC_SHEON      HDERSQQRLDKIIQSQ---DWPAEIAYAVDASEANKIAKIGIDKAGFYYPLGGWVCPFEY
MNMC_SHEDO      FDERSEARLEKIIQGQ---HWPEEIAYAVSPEQASALAGVSIDKPGFYYPNGGWICPFEF
MNMC_SHEFN      FDQRSQTRLDKIIDGQ---AWPSEIAFAVSPHQATQLANVDIDKPGFYYPLGGWACPFEF
MNMC_SHESH      FDDRSSARLDKIINGQ---SWNEKMAYPIDAASATQIAGIDIDKAGIYYPLGGWICPHEF
MNMC_SHEWM      FDQRSSARLEKIITAQ---PWNKQIAHGVDRHESSNLAGIDIDKAGIFYPLGGWICPHEF
MNMC_SHELP      HDERSHKRLTKIINAQ---PWAESIARPVDALQATALAGVTIEHQGIYYPLAGWVSPQAF
MNMC_SHEAM      HDERATERIEKLL-SK---TWPKQVAVRVDADEANHIAGVAIDKGGIYYPQGGWVSPAKL
MNMC_SACD2      TSNAIEKQLRNIGEQH-ASTDPNPIFNWVEQQDTEQAVGVSTSTGGLFIRNSGWLNPVQL
MNMC_DICNV      AEESLARRKESLAD-------------------LFEPEQADIEAKKLYFYQAGALDTPRL
                                                                   .        

MNMC_ECOLI      TRNVLELAQQQG-LQIYYQYQLQNLS------------RKDDCWLLNFAGD---------
MNMC_ECODH      TRNVLELAQQQG-LQIYYQYQLQNLS------------RKDDCWLLNFAGD---------
MNMC_SHIB3      TRNVLELAQQQG-LQIYYQYQLQNLS------------RKDDCWLLNFAGD---------
MNMC_SHIBS      TRNVLELAQQQG-LQIYYQYQLQNLS------------RKDDCWLLNFAGD---------
MNMC_ECOLC      TRNVLELAQQQG-LQIYYQYQLQNLS------------RKDDCWLLNFAGD---------
MNMC_ECOHS      TRNVLELAQQQG-LQIYYQYQLQNLS------------RKDDCWLLNFAGD---------
MNMC_SHIFL      TRNVLELAQQQG-LQIYYQYQLQNLS------------RKDDCWLLNFAGD---------
MNMC_SHIF8      TRNVLELAQQQG-LQIYYQYQLQNLS------------RKDDCWLLNFAGD---------
MNMC_SHISS      TRNVLELAQQQG-LQIYYQYQLQNLS------------RKDDCWLLNFAGD---------
MNMC_ECO57      TRNVLELAQQQG-LQIYYQYQLQDLS------------RKDDCWLLTFAGD---------
MNMC_SHIDS      TRNVLELAQQQG-LQIYYQYQLQDLS------------RKDDCWLLNFAED---------
MNMC_ECOK1      TRNVLKLAQQQG-LQIHYQYQLQDLS------------RKDDGWLLNFAGD---------
MNMC_ECOUT      TRNVLKLAQQQG-LQIHYQYQLQDLS------------RKDDGWLLNFAGD---------
MNMC_ECOL6      TRNVLELAQQQG-LQIHYQHQLQDLS------------RKDDGWLLNFAGD---------
MNMC_ECOL5      TRNVLELAQQQG-LQIHYQYQLQDLS------------RKDDGWLLNFAGD---------
MNMC_ECOSM      TRNVLELAQQQG-LQIRYQHQLQDLS------------RKDDGWLLNFAGD---------
MNMC_ECO24      TRSVLELAQQQG-LQIRYQHQLQDLS------------RKDDGWLLNFAGD---------
MNMC_CITK8      TAALLALAATQG-LRRHYTHTLTALS------------RQATGWQLQFAEG---------
MNMC_SALPA      TRAVIALATEQG-LQTRFRHTLTSLV------------AQESRWQLRFTSG---------
MNMC_SALTY      TRAVIALATEQG-LQTRFRHTLTSLV------------AQESRWQLRFTSG---------
MNMC_SALPB      TRAVIALATEQG-LQTRFRHTLTSLV------------AQESRWQLRFMSG---------
MNMC_SALCH      TRAVIALATEQG-LQTRFRHTLTSLV------------AQESRWQLRFMSG---------
MNMC_SALTI      TRAVIALATEQG-LQTRFRHTLTSLV------------AQESRWQLRFTSG---------
MNMC_SALAR      TRAVIALATEQG-LQTRFRHTLTSLA------------AQKSQWQLRFASG---------
MNMC_ENT38      TAAVINLAQSRG-LAVHYGYHLDSLN------------HQQGDWQLRFNNG---------
MNMC_KLEP7      TAELLALAATRG-LHVHYGYPVETLS------------AEGDGWLLN-------------
MNMC_CROS8      TAGVLELAQAHG-LRVHYGHRVSALH------------REDLDWQLDFANG---------
MNMC_YERPG      THALMMLAQQNG-MTCHYQHELQRLK------------RIDSQWQLTFGQS---------
MNMC_YERPY      THALMMLAQQNG-MTCHYQHELQRLK------------RIDSQWQLTFGQS---------
MNMC_YERPE      THALMMLAQQNG-MTCHYQHELQRLK------------RIDSQWQLTFGQS---------
MNMC_YERPA      THALMMLAQQNG-MTCHYQHELQRLK------------RIDSQWQLTFGQS---------
MNMC_YERPN      THALMMLAQQNG-MTCHYQHELQRLK------------RIDSQWQLTFGQS---------
MNMC_YERPP      THALMMLAQQNG-MTCHYQHELQRLK------------RIDSQWQLTFGQS---------
MNMC_YERPS      THALMMLAQQHG-MTCHYQHELQRLK------------RIDNQWQLTFGQS---------
MNMC_YERPB      THALMMLAQQHG-MTCHYQHELQRLK------------RIDNQWQLTFGQS---------
MNMC_YERP3      THALMMLAQQHG-MTCHYQHELQRLK------------RIDNQWQLTFGQS---------
MNMC_YERE8      TTALMALAQQLG-MTCHYGHELCQLE------------RVDGLWQLIFTSP---------
MNMC_SERP5      TRNAIALAQHQG-LSCHYESDVKALT------------ATDSGWQLSFNQ----------
MNMC_PECAS      TAAALKLAQQNG-LSVQMSTAVSALE------------KTDSGWALTLSAG---------
MNMC_PHOLL      TKAATELAQQQG-MLCCFNHQVTALS------------HNQHGWQLHLMHQGQ-------
MNMC_VIBCH      TQGLIHLLEQQGKLTAHYQTPIDALTWQ----------PETQLWQLR-SGD---------
MNMC_VIBC3      TQGLIHLLAQQGKLTAHYQTPIDELTWQ----------PETQLWQLR-SGD---------
MNMC_VIBCB      TRGLIAKLENTELFEAKFEHQVKSLDWD----------EARKLWTLK-ANG---------
MNMC_VIBPA      TRGLITQLEKTELFEAKFEHQVESLTWD----------EARELWTLN-ANG---------
MNMC_VIBVU      TQALFTQLGTLDNFTAKFEQSVEQLIWD----------ERSQQWQVH-TQG---------
MNMC_VIBVY      TQALFAQLDTLDNFTAKFEQSVEQLIWD----------ERSQQWQVH-TQG---------
MNMC_ALIF1      TRGLFEHLSNNPLFTLHCDSEIIALTQN----------EE-QQWLLS-TDS---------
MNMC_PHOPR      TRALIKQAQDTGRLTLKSDVDICSLE------------STNEQWQLTDSTG---------
MNMC_AERHH      TRAAIKEAQASGLLEVVFNTEVVAMA------------EQADGWQVESRDG---------
MNMC_AERS4      TRAAIKEAQASGLLQVEYDCPVTAIH------------EQVDGWLVASREG---------
MNMC_PSYIN      VEAIVRQAKNEGDLSVHLNQELLTFEQSPSDNPALNPAQPINSWDLHFAKH---------
MNMC_ACTPJ      VQGTFAYLQTKG-LQIVLNHEVKDPQ------------FSEGKWHWQH-NG---------
MNMC_ACTP2      VQGTFAYLQTKG-LRIVLNHEVKDPQ------------FSEGKWHWQH-NG---------
MNMC_HAEDU      VQQAFAYLQTKG-LKIVLNHTVTDPQ------------FVEGKWQWQY-QG---------
MNMC_HAEIN      VQNAFSFLEKQG-VVIKTAQKITALS------------QLEKGWELKNMQG---------
MNMC_HAEIG      VQNAFSFLEKQG-VIIKTAQKITALS------------QEEKGWELKNMQG---------
MNMC_HAEI8      VQNAFSFLEKQG-VIIKTSQKITALS------------QQEKGWELENTQG---------
MNMC_HAEIE      VQNAFSFLEKQG-VIIKTSQKITALS------------QLEKGWELKNMQG---------
MNMC_HAES1      VQNAFSYLQQLG-LEIKTSQKITALD------------YRNLQWVLTNEQN---------
MNMC_HISS2      VQNTFSYLQQLG-LEIKTSQKITALD------------YRNLQWVLTNEQN---------
MNMC_PASMU      VQNTFDFLATRG-VIIKTQQKITALE------------RQTTHWLLTTEQG---------
MNMC_MANSM      VQNGFAFAQKCG-LKLKTFEKITALS------------QSEKGWILHNDKN---------
MNMC_ACTSZ      VQNAFRLLESSG-LSVKTAQKITALS------------STKNGWTLQNAQG---------
MNMC_CAUVC      TAAWAGPVV--RRRVAKAERDGEG-------------------WRLLDAAGEIIARADRL
MNMC_CAUSK      LDAWRGEVI--DAQVARLAHEDGV-------------------WRLLGSDDQLLAEVDAV
MNMC_MARMM      VADLVADAQCHRARIGRVEPLGSG-------------------IGLYDDAGECRFEVAHL
MNMC_HYPNA      VLSLLDGVE---VRAGAMPDVDLG-------------------ARSVNGE-----VFDAI
MNMC_CUPNH      CSAQLAQAGAAVTARFGCRVAAIA-------------RVDG-QWQALGQDGEVLASAPVL
MNMC_CUPPJ      CSAQLRRAGDAVQSRFGTRVERIR-------------RRDD-EWEAIDEDGAVLASAPIL
MNMC_CUPMC      CRAQLAKAGAAVDALFNCRVAAIR-------------RIGD-AWQALADDGGVLAAAPVL
MNMC_RALSO      CRAALAAAGEAVELRWRTRIESLL-------------RHDA-GWRACDAQGNVIAHAPVV
MNMC_BURCM      CAAQIAAAGERVTLLAGTEVARLE-------------RDRD-IWRAVDAAGATLAEAPVV
MNMC_BURA4      CAAQIAAAGERVKLLAGTEVARLE-------------RDRD-MWRAVDAASATLAEAPVV
MNMC_BURCA      CVAQYAAAGERVRLLASTCVARLE-------------RRDD-TWHALDDTGATLADAPVV
MNMC_BURCH      CVAQYAAAGERVRLLASTCVARLE-------------RRDD-TWHALDDTGATLADAPVV
MNMC_BURCC      CAAQYAAAGERVRLLASTCVARLE-------------RRDD-TWHALDDTGATLADAPVV
MNMC_BURL3      CAAQYAAAGERVRLLASTRVAKLE-------------RRGD-AWHALDDAGGTLAEAPVV
MNMC_BURVG      CAAQVAAAGERVTLRTGTEVARLE-------------RDGD-TWRAIGADGATIAEAPVV
MNMC_BURM1      ADAQCAAAGDRVQRLTRTEVARLE-------------RNGD-EWHALDAHGRTLAQAPVV
MNMC_BURMA      AAAQCAAAGDRLSRIVGVEIARLE-------------RGGDGRWRALDASGATIAQASVV
MNMC_BURM9      AAAQCAAAGDRLSRIVGVEIARLE-------------RGGDGRWRALDASGATIAQASVV
MNMC_BURM7      AAAQCAAAGDRLSRIVGVEIARLE-------------RGGDGRWRALDASGATIAQASVV
MNMC_BURP0      AAAQCAAAGDRLSRIVGVEIARLE-------------RGGDGRWRALDASGATIAQASVV
MNMC_BURP1      AAAQCAAAGDRLSRIVGVEIARLE-------------RGGDGRWRALDASGATIAQASVV
MNMC_BURPS      AAAQCAAAGDRLSRIVGVEIARLE-------------RGGDGRWRALDASGATIAQASVV
MNMC_BURMS      AAAQCAAAGDRLSRIVGVEIARLE-------------RGGDGRWRALDASGATIAQASVV
MNMC_BURP6      AAAQCAAAGDRLSRIVGVEIARLE-------------RGGDGRWRALDASGATIAQASVV
MNMC_BURTA      AAAQCAAAGDRLSRIAGVEVARLE-------------RGGDGRWLALDASGATIAQASVV
MNMC_PARPJ      CAAQCAAAGPLLERRFGVDVARIE-------------RSGG-QWTVFDTSGEAIARAPVV
MNMC_PARXL      CAAQCAAAGPLLERRFGVDVARIE-------------RAGG-QWIVFDTAGQVVARAPVV
MNMC_PARP8      CAAQCEAAGGLLERRFNVAAARVE-------------RLEN-QWIVFDENGAAVVSAPVV
MNMC_LEPCP      SRWMLQSAGDSARWIGGTGVAALRGPRDGA-------ADHHGGWQAIDRHGRVIASAPVL
MNMC_METPP      ARELLARSG--SLFRGGIDVATI--------------ERHSGLWRVLDEQRQVIAEAPVL
MNMC_BORBR      IDALLAGEGISTIAAQAARLRRHGA-----------------QWQVLDAQGRQVAQAPVV
MNMC_BORPA      IDALLAGEGISTIAAQAARLRRHGA-----------------QWQVLDAQGRQVAQAPVV
MNMC_BORPD      IPALLGMPGVRRVAGCAAVLRRVAH-----------------GWQVLDDAGQLLGQGATV
MNMC_BORA1      IDALLAWPGIERVRGRVSRLVQCSAG----------------QWQALDALGQVLGEARQV
MNMC_AZOSB      CAANLSAGGEGIRAHWN-ARVTLAR--------------ADTRWQARDAQGALLAEAPVA
MNMC_AROAE      CAANLMTHPDLIRCHFGRAMQRLEA--------------SADGWTAFDADGKAIASAPVA
MNMC_DECAR      CRAALAAFPERITTHFNAAVARIVR--------------QNDQWQALDANGNLLAEAPVL
MNMC_THIDA      CRAWLDH--PGIGLQTNRAVGRLQA--------------VSNGWQILDREGHALAEADAV
MNMC_ACIAC      VRALLAHPGIHWQGRSAVARLEPVAA-----------PGGATHWQAYGSDGTVLAEAPHV
MNMC_ACISJ      IAHLLNDPAIRWRGSAAVAELRRTTV-----------DG-QPLWQALDAEGHVLAEAELA
MNMC_DELAS      VQAQLALPGVRWQGRACVARLARTDT-----------AGGAPVWQALDAQGNLLAEAELV
MNMC_POLNA      VQAWLSSPGVSWHGNAAVSQLVRQ----------------AGAWQALDATGNELASAELV
MNMC_POLSJ      VQAWLTTPGVEFHDHASVGQLIRQ----------------PDSWQVLDANGHVLACAELV
MNMC_MAGMM      CAALLADVTAHYQTEIVRLAPQPEG-------------------WTLHTAQRHYGTFDAV
MNMC_LEPBJ      ARKCVDQPGIELIQA----TANSFER-----------IGSSWKLDLKESDQKVLAD----
MNMC_LEPBL      ARKCVDQPGIELIQA----TANSFER-----------IGSSWKLDLKESDQKVLAD----
MNMC_LEPIN      AKKCAEQPGVEFIKG----TASRIEQ-----------DGTSWKLLIQESGHEIVAN----
MNMC_LEPIC      AKKCAEQPGVEFIKG----TASRIEQ-----------DGTSWKLLIQESGHEIVAN----
MNMC_MARMS      CETLLSHENIHVCLNTKLESLSPIEL-----------DDKTFGWQARSKYQQAPLNDRQA
MNMC_HYDCU      VTQCLAHEAIALKQEEAVVSIQPVP------------DQNSQDWQIMTPNSTYQAD----
MNMC_CAMJJ      VKNLFEKSKACIYFNHEFQAYKFEN----------------ECFTLKFKNDIVKSDYAVL
MNMC_CAMJ8      VKNLFEKSKACIYFNHEFQAYKFEN----------------ECFTLKFKNDIVKSDYAVL
MNMC_CAMJR      VKNLFEKSKACIYFNHEFQAYKFKN----------------ECFTLKFKNDIVKSDYAVL
MNMC_CAMJE      VKNLFEKSKACIYFNHEFQAYKFEN----------------GCFSLKFKNDVVKSDYAVL
MNMC_CAMJD      VKNLFEKSKACIYFNHEFQAYKFEN----------------ECFTLKFKNDIVKSDYAVL
MNMC_CAMC1      CKFLS--SNFEILFNHEYESRAHLQ----------------NGKISVKFKNKKSLETDIL
MNMC_CAMHC      CEFFS--KKLNIKFGYEFSDFVES-----------------NGGYIVNFVGKKPLKCDIL
MNMC_CAMFF      CMSLA--SEFDIKYGYEFESIEKS-----------------TGGYVVKFKNSKNIFSSLV
MNMC_LEGPA      CDILIDNKRISLITGNRVQSINYN----------------------QKNWVVKDIEASVL
MNMC_LEGPH      CDILIDNKRISLITGNRVQSINYN----------------------QKNWVVNGIEASVL
MNMC_LEGPL      CDILIDNKRISLITGNRVQSINYN----------------------QKNWVVNDIDASVL
MNMC_LEGPC      CDILIDNKRISLITGNRVQSINYN----------------------QKNWVVNDIEASVL
MNMC_ACIBT      RAEILQHPSIELKIANITTFVSFENK---------------VQLKSGN------------
MNMC_ACIBY      RDEILQHPGIELKIANITTLVSFENK---------------VQLKSGN------------
MNMC_ACIBC      RDEILQHPGIELKIANITTLISFENK---------------VQLKSGN------------
MNMC_ACIAD      CNQVLQHPLIEFKQFKINQIIEIDGT---------------VQLLSSE------------
MNMC_PSYA2      KTLILLHPNITYQQLNITNIEETQDN---------------VILTGFESNENNESASRNS
MNMC_PSYCK      QTVILAHPNITYQQLNIINIKETENS---------------IILTGSKEDEN---ASQAS
MNMC_PSYWF      ADKVLTHPNISFKQANIKRITPLQAE---------------AFDDVTEVSEVIEVTADIT
MNMC_PSEAE      CQALAATPGITLLS-GRAVRLR----------------REGDDWCAYAGDEC----LARA
MNMC_PSEAB      CQALAATPGITLLS-GRAVRLR----------------REGDDWCAYAGDEC----LARA
MNMC_PSEA7      CQALATTPGITLLS-GRAVRLR----------------REGDDWCAYAGDEC----LARA
MNMC_PSEMY      CRQLAQHPLIELRPYQEALSLS----------------RQQERWCVEGQNGV----LAEA
MNMC_PSEP1      CQQQLQHPGIRVVTHQDVLELR----------------KVDEHWQAWAGDQL----LARA
MNMC_PSEPK      CQQQLQHPGIHLVTHQEVLELR----------------KVDEQWQAWAGDQL----LARA
MNMC_PSEPG      CQQQLQHPGIRLLTHQDVIELR----------------NIGQHWQAWAGDRL----LASA
MNMC_PSEPW      CKAQLQHPNIRLLAHHDVLALR----------------KADGLWQAWAGDRL----LASA
MNMC_PSEE4      CQAQLGHPNVRLLNHHEVIELR----------------KVDGQWQAWDGERL----LASA
MNMC_PSEF5      CQWQASHPRIQVLAHREVLELR----------------RVDEQWQAWDGDRM----LASA
MNMC_PSEPF      CQAQSAQPGVTLLPHQEAVELR----------------KVGDQWQAFDGERL----IATA
MNMC_PSE14      CHAQAAHANIRLIAHQQALELR----------------RVDDQWQVWSDEQL----IDSA
MNMC_PSEU2      CHAQAAHANIRLIAHQQALELR----------------RVDDQWQVWSEEQL----VDSA
MNMC_PSESM      CHAQIQHANIRLIAHHQALELR----------------RVDDQWQVWSDAQL----IDSA
MNMC_PSEU5      CRWLLQRPGIELLRHREALDLR----------------RHGEAWQVLGGEGV----LAEA
MNMC_CHRVO      VRQLADHPNIVIKTGRTALTLDYD--------------PAQRSWTAGDEQGP----LAVA
MNMC_METFK      CEALAGHANITRTLATRVTGLS----------------QHGNAWQVWTGEQL----LDEA
MNMC_NITMU      CVALLGSQAITLYTGRTVKSLT----------------PTSHGWRVQAEDQRKQAWSLEA
MNMC_CHRSD      CQQLAASPGITQRR-GEAHDLDFD--------------ADADAWRIALTDGS----TLTA
MNMC_HAHCH      CAHMLQHPNIEVRLNSPVTALER---------------TDEGGWLIHIGSGESAQELECA
MNMC_MARN8      CQTLIDHPHIRTVFDFNVDTLRY---------------VDNH-WVIKASDGRSLRATKVV
MNMC_IDILO      VKSLLETAQIELIEGEAKALEK----------------TESGSWQISLKDGS----LLAA
MNMC_PSEA6      VDALFDAAAKLSQVRLYSHHALNGIEQKNVSIT----AQENTRWQLHFEASEATSGMNKN
MNMC_PSET1      VNAMLSAAHCLSPYKSTFNCHIEQLKKT------------SNGWLLFSNGKQ--------
MNMC_COLP3      VKQIFNAAKSTTRLKIMTDTHITKIQQVANPSS----NENGTSWSLTSNQGE--------
MNMC_SHEB5      ADAAIQKAMQLADVSVSLNTDILAIE------------RQADGWVLLTEK----------
MNMC_SHEB9      ADAAIQKAMQLADVSVSLNTDILAIE------------RQADGWVLLTEK----------
MNMC_SHEB8      ADAAIQKAMQLADVSVSLNTDILAIE------------RQSDGWVLLTEK----------
MNMC_SHEPC      AEAALQKAQQLTAVKLHLETEILEIE------------HQSEGWYLITAK----------
MNMC_SHESW      AEAALQKAQQLTEVKLHLETEILEIE------------HQSEGWYLITAK----------
MNMC_SHESM      AKAAVDKASQLANVQCHFNTEITEIE------------CDAKAWYLHSQG----------
MNMC_SHESR      AKAAVDKASQLANVQCHFNTEITEIE------------CDANAWYLHSQG----------
MNMC_SHESA      AKAAVDKASQLANVQCHFNTEITEIE------------CDAQAWYLHSQG----------
MNMC_SHEON      AKAAVDKASQLANVQCHFNTEITEIE------------RDAKGWYLLSQD----------
MNMC_SHEDO      ARACLEKAKSLANVEVKLNSTISCIK------------PLAANVDSKDASGCTSQASGTL
MNMC_SHEFN      AQASIAKAQTLTKVRIVYNSDISSLE------------SHSSGWQLFSAEDNTP------
MNMC_SHESH      TRAAFDKAARLSDVSVEFNADITRIE------------QREGLWYLYKSVNVQHSCTDSH
MNMC_SHEWM      TQAAFDKASQLSDVSAHFNTDIKRIE------------QREGKWYLHKT-----------
MNMC_SHELP      TRAAISQAERLGKQTSHYQCQITAIR------------FENQQWYLSAI-----------
MNMC_SHEAM      CEAAIEEAKTMG-LECHFDVNITSIT------------RADEGWRLNTQT----------
MNMC_SACD2      CHALTNHPRITKLFNSDAAQLQQDAH---------------GQWFALTNDGHKLASADIT
MNMC_DICNV      LTYLLADKNITQYAQKIAQLTPQAEG-----------------WRIGEQIYAR-------
                                                                            

MNMC_ECOLI      ----------------QQATHSVVVLANGHQISRFSQTS----------------TLPVY
MNMC_ECODH      ----------------QQATHSVVVLANGHQISRFSQTS----------------TLPVY
MNMC_SHIB3      ----------------QQATHSVVVLANGHQISRFSQTS----------------TLPVY
MNMC_SHIBS      ----------------QQATHSVVVLANGHQISRFSQTS----------------TLPVY
MNMC_ECOLC      ----------------QQATHSVVVLANGHQISRFSQTS----------------TLPVY
MNMC_ECOHS      ----------------QQATHSVVVLANGHQISRFSQTS----------------TLPVY
MNMC_SHIFL      ----------------QQATHSVVVLANGHQISRFSQTS----------------TLPVY
MNMC_SHIF8      ----------------QQATHSVVVLANGHQISRFSQTS----------------TLPVY
MNMC_SHISS      ----------------QQATHSVVVLANGHQISRFSQTS----------------TLPVY
MNMC_ECO57      ----------------QQATHSVVVLANGHQISRFSQTS----------------SLPVY
MNMC_SHIDS      ----------------QQATHSVVVLANGHQISRFSQTS----------------SLPVY
MNMC_ECOK1      ----------------QQATHSVVVLANGHQISRFSQTS----------------SLPVY
MNMC_ECOUT      ----------------QQATHSVVVLANGHQISRFSQTS----------------SLPVY
MNMC_ECOL6      ----------------QHATHSVVVLANGHQISGFSQTS----------------SLPVY
MNMC_ECOL5      ----------------QQATHSLVVLANGHQISRFSQTS----------------SLPVY
MNMC_ECOSM      ----------------QQATHSVVVLANGHQISRFSQTS----------------SLPVY
MNMC_ECO24      ----------------QQATHSVVVLANGHQISRFSQTS----------------SLPVY
MNMC_CITK8      ----------------KAVEHEVVVLANGHQINHVDQTR----------------PLPVY
MNMC_SALPA      ----------------ETASHETVVLANGHQINRFDQTQ----------------PLPVY
MNMC_SALTY      ----------------ETASHETVVLANGHQINRFDQTQ----------------PLPVY
MNMC_SALPB      ----------------ETASHETVVLANGHQINRFDQTR----------------PLPVY
MNMC_SALCH      ----------------ETASHETVVLANGHQINRFDQTR----------------PLPVY
MNMC_SALTI      ----------------ETASHETVVLANGHQINRFDQTR----------------PLPVY
MNMC_SALAR      ----------------EAASHDTVVLANGHQINRFDQTQ----------------PLPVY
MNMC_ENT38      ----------------ADAQHSSVVLANGHRISDFSQTE----------------KLPVY
MNMC_KLEP7      ----------------QQRYHQAVVLANGHRITGFAQTA----------------QLPVY
MNMC_CROS8      ----------------AQARHAAVVLANGHQLSGFPQTE----------------KLPVY
MNMC_YERPG      ---------------QAAKHHATVILATGHRLPEWEQTH----------------HLPLS
MNMC_YERPY      ---------------QAAKHHATVILATGHRLPEWEQTH----------------HLPLS
MNMC_YERPE      ---------------QAAKHHATVILATGHRLPEWEQTH----------------HLPLS
MNMC_YERPA      ---------------QAAKHHATVILATGHRLPEWEQTH----------------HLPLS
MNMC_YERPN      ---------------QAAKHHATVILATGHRLPEWEQTH----------------HLPLS
MNMC_YERPP      ---------------QAAKHHATVILATGHRLPEWEQTH----------------HLPLS
MNMC_YERPS      ---------------QAAKHHATVILATGHRLPEWEQTH----------------HLPLS
MNMC_YERPB      ---------------QAAKHHATVILATGHRLPEWEQTH----------------HLPLS
MNMC_YERP3      ---------------QAAKHHATVILATGHRLPEWEQTH----------------HLPLS
MNMC_YERE8      ---------------QVNRQHTTVVLATGHRLPEWQQTQ----------------HLPLS
MNMC_SERP5      ---------------EETRQHATVILANGHRLGELAPSE----------------ALPVY
MNMC_PECAS      ---------------QQVN-HAVVVLANGHHITDWPQTR----------------HLPGY
MNMC_PHOLL      ---------------SLNAQHKTVVIANGHHLPQFEQTE----------------KLPVT
MNMC_VIBCH      ----------------TLMSHQCVVIASGHQFDSLSQTA----------------ELPLG
MNMC_VIBC3      ----------------TLMSHQCVVIASGHQFDSLSQTA----------------ELPLG
MNMC_VIBCB      ----------------QSFEHSTVVVANGSEFQTLSQTA----------------DLPMG
MNMC_VIBPA      ----------------QNFEHSTVVVANGNEFQTLSQTE----------------ALPMG
MNMC_VIBVU      ----------------QHDTYSAVVIANGHEFQTFSQTA----------------DIPLG
MNMC_VIBVY      ----------------QHDTYSAVVIANGHEFQTFSQTA----------------DIPLG
MNMC_ALIF1      ----------------NAYQHQAVVVANGHRFTDFEQTK----------------DIPAT
MNMC_PHOPR      ----------------NQFTHNTVIIANGHRFSEFEQAK----------------QIPAY
MNMC_AERHH      ----------------RRWQAPNLVVAAGHQLPALIPFA----------------ELPLY
MNMC_AERS4      ----------------RQWQAPNLVVAAGHQLPALSPFA----------------ELPLY
MNMC_PSYIN      -----------------SIQHSLLVLATANNTLNFKQCE----------------AVPLS
MNMC_ACTPJ      ----------------KTFSHQILVLANGHTLTQFQQAQ----------------GIPLY
MNMC_ACTP2      ----------------KTFSHQILVLANGHTLTQFQQAQ----------------GIPLY
MNMC_HAEDU      ----------------VQFAHHILVLANGHSFTQFSQAE----------------GIPLY
MNMC_HAEIN      ----------------QKYCHEVVILANGHKITDFVQTE----------------KLPLY
MNMC_HAEIG      ----------------QKYCHEVVILANGHKITDFVQTE----------------KLPLY
MNMC_HAEI8      ----------------QKYCHEVVILANGYKITDFVQTE----------------KLPLY
MNMC_HAEIE      ----------------QKYCHEVVILANGYKITDFVQTE----------------KLPLY
MNMC_HAES1      ----------------ETFNHQVVVLANGYQITDFVQTA----------------KLPLY
MNMC_HISS2      ----------------ETFNHQVVVLANGYQITDFVQTA----------------KLPLY
MNMC_PASMU      ----------------DSFKHQVVVLANGHKLTQFRQTE----------------HLPVY
MNMC_MANSM      ----------------EQFHHETVIIANGHKLKQFTQTA----------------RIPVY
MNMC_ACTSZ      ----------------ETFRHNIVVLANGHRLHRFEQTA----------------RLPLY
MNMC_CAUVC      ------------------------ALAGGAAGADLLAEA------------------PLR
MNMC_CAUSK      ------------------------VLAGGAGQARLWPDA------------------PLR
MNMC_MARMM      ------------------------VIAAGAGARRFYPD--------------------LQ
MNMC_HYPNA      ------------------------VLASGMGMGQLLPAL------------------ELA
MNMC_CUPNH      ------------------------VLANAHEAQQLLPQ--------QHW--------TMR
MNMC_CUPPJ      ------------------------VLANAHEAPRLAPM--------RHQ--------VMR
MNMC_CUPMC      ------------------------VLANAYEADRLTSG--------QFL--------ALR
MNMC_RALSO      ------------------------VLANSLDAVRLAPL--------ASA--------ALK
MNMC_BURCM      ------------------------VLANAGDAVRLAGL--------RHV--------ALQ
MNMC_BURA4      ------------------------VLANAGDAVRLAGL--------RHV--------ALQ
MNMC_BURCA      ------------------------VLANAGDAARLAGL--------RHV--------TLQ
MNMC_BURCH      ------------------------VLANAGDAARLAGL--------RHV--------TLQ
MNMC_BURCC      ------------------------VLANAGDAARLAGL--------RHV--------ALQ
MNMC_BURL3      ------------------------VLANAGDAARLAGL--------QHV--------ALQ
MNMC_BURVG      ------------------------VLANAGDAVRLAGL--------RHV--------ALQ
MNMC_BURM1      ------------------------VLANAGDAVRLAGL--------RHV--------ALQ
MNMC_BURMA      ------------------------VVANAADAARIAGL--------RHA--------PTQ
MNMC_BURM9      ------------------------VVANAADAARIAGL--------RHA--------PTQ
MNMC_BURM7      ------------------------VVANAADAARIAGL--------RHA--------PTQ
MNMC_BURP0      ------------------------VVANAADAARIAGL--------RHA--------PTQ
MNMC_BURP1      ------------------------VVANAADAARIAGL--------RHA--------PTQ
MNMC_BURPS      ------------------------VVANAADAARIAGL--------RHA--------PTQ
MNMC_BURMS      ------------------------VVANAADAARIAGL--------RHA--------PTQ
MNMC_BURP6      ------------------------VVANAADAARIAGL--------RHA--------PTQ
MNMC_BURTA      ------------------------IVANAADAARVAGL--------RHA--------PTQ
MNMC_PARPJ      ------------------------IVASAHDAARIAGL--------QHA--------PTR
MNMC_PARXL      ------------------------IVASAHDAARIAGL--------QYA--------PTR
MNMC_PARP8      ------------------------IFANAHEAARVAGL--------HYA--------STR
MNMC_LEPCP      ------------------------VLANALDAARLLPA--------HCP------PPGLS
MNMC_METPP      ------------------------VLANGLGANGLLAS--------GRGE----VPWPLT
MNMC_BORBR      ------------------------VLANAADAPRLLADSGLL----EPLP----RLARMH
MNMC_BORPA      ------------------------VLANAADAPRLLADSGLL----EPLP----RLARMH
MNMC_BORPD      ------------------------VLANAFGAQALLRDSGLL----DPLP----RVAQMH
MNMC_BORA1      ------------------------VLANAAGTPLVLEASGLL----GPLP----RVAQMH
MNMC_AZOSB      ------------------------ILAAGTGITGFPLA--------APL--------PVV
MNMC_AROAE      ------------------------VLANGVGIRAVPQA--------AAL--------PVR
MNMC_DECAR      ------------------------VMASGAAAPRFEQF--------AWL--------PQR
MNMC_THIDA      ------------------------VLANARDASRLALG--------QAW--------PLH
MNMC_ACIAC      ------------------------VVAAGYGSRPWL-------------P----ARYPIH
MNMC_ACISJ      ------------------------VVCAGHHTGPLT-------------H----AHWPMN
MNMC_DELAS      ------------------------VLALGPATNALLEHSL-------GAQ----AAWPLQ
MNMC_POLNA      ------------------------VLAAGHGSRALSEIASP------QAG----RPLALQ
MNMC_POLSJ      ------------------------VLAAGYASRALAEAAVP------PTS----PPLALQ
MNMC_MAGMM      ------------------------VIAAGATAPLLYPEAEI----------------PNT
MNMC_LEPBJ      ----------------------SIIFCNSYLIGKLASSLFEG----EEI-------FPIN
MNMC_LEPBL      ----------------------SIIFCNSYLIGKLASSLFEG----EEI-------FPIN
MNMC_LEPIN      ----------------------SIIFCNSHSIGKLIASLFEG----EEP-------FPIR
MNMC_LEPIC      ----------------------SIIFCNSHSIGKLIASLFEG----EEP-------FPIR
MNMC_MARMS      C-------------------FSHVVLCTANDTKALGVTPKTP----DYPIRGQVSFMDIE
MNMC_HYDCU      ----------------------VVVVATGALNGDLNEQLNLP----IRPVKGQVSHFKAA
MNMC_CAMJJ      ------------------------IYAMGADTKDFVFY----------------DEMKLS
MNMC_CAMJ8      ------------------------IYAMGADTKDFVFY----------------DEMKLS
MNMC_CAMJR      ------------------------IYAMGADTKDFVFY----------------DEMKLS
MNMC_CAMJE      ------------------------IYAMGADAKDFVFY----------------DEMKLS
MNMC_CAMJD      ------------------------IYAMGADTKDFVFY----------------DEMKLS
MNMC_CAMC1      ------------------------VFCTGSKSSEIFK----------------DYDMQIS
MNMC_CAMHC      ------------------------IFAMGSESEELFGGGKNVRANF-------DDAMQIS
MNMC_CAMFF      ------------------------IFAMGDVSTNLFQN-----VFA-------DEFMQLS
MNMC_LEGPA      ------------------------ILANGQQVNYFHET----------------NHLPVK
MNMC_LEGPH      ------------------------ILANGQQVNYFHET----------------NHLPVK
MNMC_LEGPL      ------------------------ILANGQQVNYFHET----------------NHLPVK
MNMC_LEGPC      ------------------------ILANGQQVNYFHET----------------NHLPVK
MNMC_ACIBT      ---------------ETTLEADHVVVCCARESAALFENY-----------------PLLK
MNMC_ACIBY      ---------------ETTLEADHVVVCCARESAALFENY-----------------PLLK
MNMC_ACIBC      ---------------ETTLEADHVVVCCARESAALFENY-----------------PLLK
MNMC_ACIAD      ---------------QAILESNAAIVCCARESGKLFEQY-----------------PTLK
MNMC_PSYA2      V----------------AITTDHVVICAAYESHQLDQRI-----------------VKCR
MNMC_PSYCK      L----------------TITADHVVICAAYESHQLDKRI-----------------VKCR
MNMC_PSYWF      VQPAKRTKVMLHCESGEVLSVNRVVIAAAFESQSLDARI-----------------FEFR
MNMC_PSEAE      P-----------------------LAILATAADIRDF--------------PPAAELPLK
MNMC_PSEAB      P-----------------------LAILATAADIRDF--------------PPAAELPLK
MNMC_PSEA7      P-----------------------LAILATAADIRDF--------------PPAAELPLK
MNMC_PSEMY      P-----------------------VLILACAAEIGRL--------------LPEANLPLK
MNMC_PSEP1      P-----------------------VVVLAGAADVLRF--------------EPCAQLPLK
MNMC_PSEPK      P-----------------------VVVLAGAADVLRF--------------EPCAQLPLK
MNMC_PSEPG      P-----------------------VVVLAGAADVRRF--------------EPCAQLPLK
MNMC_PSEPW      P-----------------------MVVLAGAADVKRF--------------EPCAQLPLK
MNMC_PSEE4      P-----------------------LVVLAGAADVRRF--------------PACAELPLK
MNMC_PSEF5      A-----------------------VVILAGAAEIKRF--------------PASADLPLK
MNMC_PSEPF      P-----------------------VVVLAGAAEIKRF--------------AQSGELPLK
MNMC_PSE14      P-----------------------VVVLAGAADIQKF--------------SQSADLPLK
MNMC_PSEU2      P-----------------------VVVLAGAADIQQF--------------SQSADLPLK
MNMC_PSESM      P-----------------------VVVLAGAADIKQF--------------SQSAELPLK
MNMC_PSEU5      P-----------------------VVVLAGAADAARF--------------EQSAWLPLK
MNMC_CHRVO      S-----------------------VVVLAGAAETAQF--------------DSTRHLPLK
MNMC_METFK      D-----------------------IVVIANAAQAASF--------------VQSRHLPLE
MNMC_NITMU      E-----------------------IVVVCTGYQVKSL--------------PALANLPLT
MNMC_CHRSD      D-----------------------HVVVATAHEAPRF--------------TPLAGLPLK
MNMC_HAHCH      I-----------------------LILATANNQAMQP--------------AAASALPLK
MNMC_MARN8      V-----------------------AAGHESGSLAPVP--------------DGQS-LRLK
MNMC_IDILO      E-----------------------RVLIATGHHINGLLP------------ESVNPLPIQ
MNMC_PSEA6      TS---------------LAQADIVIYATGAQSHDIAALA----------------DFPLR
MNMC_PSET1      -----------------FGPFSDVIICAGEHSDAFAQTK----------------ALPIV
MNMC_COLP3      ------------------FNASVLVICGGADAIEIEQLK----------------SLPLT
MNMC_SHEB5      ---------------ERFGPFAQLVLANGAELTQFDASN----------------KLQIS
MNMC_SHEB9      ---------------ERFGPFAQLVLANGAELTQFDASN----------------KLQIS
MNMC_SHEB8      ---------------ERLGPFAQLVLANGAELTQFDASN----------------KLQIS
MNMC_SHEPC      ---------------HRFGPFAQVVLANGAALTQFDASN----------------KLQIS
MNMC_SHESW      ---------------HRFGPFAQVVLANGAALTQFDASN----------------KLQIS
MNMC_SHESM      ---------------QRFGPFRQLVLANGAQLTQFSASE----------------RLQIS
MNMC_SHESR      ---------------QRFGPFRQLVLANGAQLTQFSACE----------------RLQIS
MNMC_SHESA      ---------------QRFGPFRQLVLANGAQLTQFSASE----------------RLQIS
MNMC_SHEON      ---------------QRFGPFRQLVLANGAQLTQFSASE----------------RLQIS
MNMC_SHEDO      WG--------LYHQGEIVGSHQQVVLASGASITAFEQTQ----------------ALQMS
MNMC_SHEFN      -----------------IATHEQVVIASGAQLTQYKQTK----------------NLQIT
MNMC_SHESH      TP--------DDSEELEIGPFANLVLANGQGLTQFKQSE----------------KLPAT
MNMC_SHEWM      TV--------NTGGEQTFGPFNTLILANGQGLNQFNQSK----------------QLAAT
MNMC_SHELP      ----------QDGQKVEFGPYANLVLANGRHLTDFAQTD----------------HLPIS
MNMC_SHEAM      ----------------GEIDAHELVLATGHRITELAQTK----------------SLQLA
MNMC_SACD2      ------------------------VICTARDAKHLAQTA----------------YLPMR
MNMC_DICNV      -----------------------VVLATSWQEQLLPNAL----------------QKRMR
                                                                            

MNMC_ECOLI      SVAGQVSHIPTTPEL---AELKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_ECODH      SVAGQVSHIPTTPEL---AELKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_SHIB3      SVAGQVSHIPTTPEL---AELKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_SHIBS      SVAGQVSHIPTTPEL---AELKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_ECOLC      SVAGQVSHIPTTPEL---AELKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_ECOHS      SVAGQVSHIPTTPEL---AELKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_SHIFL      SVAGQVSHIPTTPEL---AELKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_SHIF8      SVAGQVSHIPTTPEL---AELKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_SHISS      SVAGQVSHIPTTPEL---AELKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_ECO57      SVAGQVSHIPTTPEL---AKLKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_SHIDS      SVAGQVSHIPTTPEL---AKLKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_ECOK1      SVAGQVSHIPTTPEL---AELKQVLCYDGYLTPQNTA------------NQHHCIGASYH
MNMC_ECOUT      SVAGQVSHIPTTPEL---AELKQVLCYDGYLTPQNTA------------NQHHCIGASYH
MNMC_ECOL6      SVAGQVSHIPTTPEL---AKLKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_ECOL5      SVAGQVSHIPTTPEL---AKLKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_ECOSM      SVAGQVSHIPTTPEL---AKLKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_ECO24      SVAGQVSHIPTTPEL---AKLKQVLCYDGYLTPQNPA------------NQHHCIGASYH
MNMC_CITK8      SVAGQVSHIPTTPAL---SALRQVLCYDGYLTPQNPA------------THQHCIGASYH
MNMC_SALPA      AVGGQVSHIPTTPAL---SALRQVLCYDGYLTPQNPH------------NQQHCIGASYH
MNMC_SALTY      AVGGQVSHIPTTPAL---SALRQVLCYDGYLTPQNPH------------NQQHCIGASYH
MNMC_SALPB      AVGGQVSHIPTTPAL---SALRQVLCYDGYLTPQNPH------------NQQHCIGASYH
MNMC_SALCH      AVGGQVSHIPTTPAL---SALRQVLCYDGYLTPQNPH------------NQQHCIGASYH
MNMC_SALTI      AVGGQVSHIPTTPAL---SALRQVLCYDGYLTPQNPH------------NQQHCIGASYH
MNMC_SALAR      AVGGQVSHIPTTPAL---SALRQVLCYDGYLTPQNPN------------NRQHCIGASYH
MNMC_ENT38      PVGGQVSHIPTTPQL---EKLRQVLCYDGYLTPQNPE------------NGHHCIGASYH
MNMC_KLEP7      PVGGQVSHIPTTPRL---AALRQVLCYDGYLTPQNPQ------------NQQHCIGASYH
MNMC_CROS8      PVGGQVSHIPTTPGL---GALRQVLCYDGYLTPQNPA------------NAMHCIGASYH
MNMC_YERPG      AVRGQVSHIPTTPVL---SQLQQVLCYDGYLTPVNPA------------NQHHCIGASYQ
MNMC_YERPY      AVRGQVSHIPTTPVL---SQLQQVLCYDGYLTPVNPA------------NQHHCIGASYQ
MNMC_YERPE      AVRGQVSHIPTTPVL---SQLQQVLCYDGYLTPVNPA------------NQHHCIGASYQ
MNMC_YERPA      AVRGQVSHIPTTPVL---SQLQQVLCYDGYLTPVNPA------------NQHHCIGASYQ
MNMC_YERPN      AVRGQVSHIPTTPVL---SQLQQVLCYDGYLTPVNPA------------NQHHCIGASYQ
MNMC_YERPP      AVRGQVSHIPTTPVL---SQLQQVLCYDGYLTPVNPA------------NQHHCIGASYQ
MNMC_YERPS      AVRGQVSHIPTTPVL---SQLQQVLCYDGYLTPVNPA------------NQHHCIGASYQ
MNMC_YERPB      AVRGQVSHIPTTPVL---SQLQQVLCYDGYLTPVNPA------------NQHHCIGASYQ
MNMC_YERP3      AVRGQVSHIPTTPVL---SQLQQVLCYDGYLTPVNPA------------NQHHCIGASYQ
MNMC_YERE8      AVRGQVSHIPTTPVL---SQLRQVLCYDGYLTPVNPA------------NQHHCIGASYQ
MNMC_SERP5      AVRGQVSHIPTTPAL---SELKQVLCYDGYLTPVNAN------------NQQHCIGASYQ
MNMC_PECAS      AVRGQVSHIPTNPVL---GQLKHVLCYDGYLTPVSPQ------------HQTHCIGASYL
MNMC_PHOLL      AVRGQVSHIPTTTDL---SQLQNVLCYDGYMTPANPA------------NQHHCIGASYQ
MNMC_VIBCH      KVKGQVSHIPTTETL---SKINSVLCYDGYMTPVSQQ------------NGYHCIGASYD
MNMC_VIBC3      KVKGQVSHIPTTETL---SKINSVLCYDGYMTPVSQQ------------NGYHCIGASYD
MNMC_VIBCB      QVKGQVSHAPATETL---SKLKTVLCYDGYMTPVNPN------------NQHLCIGASYD
MNMC_VIBPA      QVKGQVSHAPATKTL---SKLKSVLCYDGYMTPVNPN------------NQHLCIGASYD
MNMC_VIBVU      QVKGQVSHVPATETL---SKLKSVLCYDGYMTPVNPN------------NQHLCIGASYD
MNMC_VIBVY      QVKGQVSHAPATETL---SKLKSVLCYDGYMTPVNPN------------NQHLCIGASYD
MNMC_ALIF1      PVRGQVSHIPTTESL---KNLKTVLCYDGYLTPENSK------------HQTHCIGASYD
MNMC_PHOPR      SVRGQVSHIPTDDTL---STLKTVLCYDGYLTPQNTT------------TKTHCIGASYR
MNMC_AERHH      PVRGQVSHVPTSVSL---SKLNTVLCYDGYLTPAH--------------HDHHCIGASYG
MNMC_AERS4      PVRGQVSHVPTTATL---SQLKTVLCYDGYLTPAH--------------NAEHCIGASYG
MNMC_PSYIN      AARGQVTHIPTNHKI---NPLQITLCHEGYLTPAN--------------NQQHCMGATFK
MNMC_ACTPJ      PVRGQVSQIPTTPAL---QQLKCVVCYDGYLTPVSKA------------N-THCIGASHV
MNMC_ACTP2      PVRGQVSQIPTTSAL---QQLKCVVCYDGYLTPVSKA------------N-THCIGASHV
MNMC_HAEDU      PVRGQVSQIPTTPAL---QKLKCVICYDGYLTPMATN------------G-YHCIGASHV
MNMC_HAEIN      PIRGQVSQIPTSENL---LKLKSVLCYDGYLTPANQL------------KTSHCIGASMF
MNMC_HAEIG      PIRGQVSQIPTSENL---LKLKSVLCYDGYLTPANQL------------KTSHCIGASHV
MNMC_HAEI8      PIRGQVSQIPTSENL---LKLKSVLCYDGYLTPANQL------------KTSHCIGASHV
MNMC_HAEIE      PIRGQVSQIPTSENL---LKLKSVLCYDGYLTPANQL------------KTSHCIGASHV
MNMC_HAES1      PVRGQVSQIPTSANL---LKLKSVLCYDGYLTPADKM------------KQSHCLGASHI
MNMC_HISS2      PVRGQVSQIPTSANL---LKLKSVLCYDGYLTPADKM------------KQSHCLGASHI
MNMC_PASMU      PVRGQVSEIATSTEL---SKLKAVICYDGYLTP-KAA------------SQTHCLGASHL
MNMC_MANSM      SVRGQVSQIPTSSQL---LKLKSVLCYDGYLTPADQA------------KQFHCIGASHV
MNMC_ACTSZ      PVRGQVSQIATGENL---LKLNSVICYDGYMTPADEA------------KTSHCIGASHV
MNMC_CAUVC      PVRGQASWTRGH------GAPAT--AFGGYAIPTR---------------EGLLFGATHD
MNMC_CAUSK      PIRGQTSWTDRP------LAFPTPAAFGGYVAPTR---------------DGMLFGATHD
MNMC_MARMM      PSAGQLAVFDG-------APPDMPTAWGNYACAAP---------------GGVLVGATHD
MNMC_HYPNA      GRQGQVEHLSGAV-----QAPPSALASGTYAIALG---------------NERLWGATFE
MNMC_CUPNH      RVRGQLTTLASAQVDALGGWPDCVVTGAGYLLPRT-A------------DGAGRVGSSYD
MNMC_CUPPJ      RVRGQLTTLAPGQVTALGSWPDCVVTGAGYLLPVS-E------------DGSARVGSSYE
MNMC_CUPMC      RVRGQLTDLAPAQAEALGGWPDCVVTGGGYLLPRD-A------------AGGARMGSSYE
MNMC_RALSO      PVRGQLTDVPVAALEDGVPWPRAVVCGDGYLLPRERG------------APTVRVGSSFQ
MNMC_BURCM      PVRGQLTLLPPGS----TAPLPCPTIGDGYAVPLD--------------DGTLLIGATFE
MNMC_BURA4      PVRGQLTLLPPGS----TAPLPCPTIGDGYAVPLD--------------DGTLLIGATFE
MNMC_BURCA      PVRGQLTLLPPGT----TAPLPCPAIGDGYAVPLD--------------DGTLLIGATFE
MNMC_BURCH      PVRGQLTLLPPGT----TAPLPCPAIGDGYAVPLD--------------DGTLLIGATFE
MNMC_BURCC      PVRGQLTLLPPGT----TAPLPCPAIGDGYAVPLD--------------DGTLLIGATFE
MNMC_BURL3      PVRGQLTLLPPGS----TAPLPCPTIGDGYAVPLD--------------DGTLLIGATFE
MNMC_BURVG      PVRGQLTLLPPGT----TAPLPCPAIGDGYAVPLD--------------DGTLLIGATFE
MNMC_BURM1      PVRGQLTLLPAAS----ASPPPCPAIGDGYAVPLD--------------DGTLLIGATFE
MNMC_BURMA      RVRGQLTLLPPGS----APAVPLPVIGDGYVVPLA--------------NGVTLTGATYE
MNMC_BURM9      RVRGQLTLLPPGS----APAVPLPVIGDGYVVPLA--------------NGVTLTGATYE
MNMC_BURM7      RVRGQLTLLPPGS----APAVPLPVIGDGYVVPLA--------------NGVTLTGATYE
MNMC_BURP0      RVRGQLTLLPPGS----APAVPLPVIGDGYVVPLA--------------NGVTLTGATYE
MNMC_BURP1      RVRGQLTLLPPGS----APAVPLPVIGDGYVVPLA--------------NGVTLTGATYE
MNMC_BURPS      RVRGQLTLLPPGS----APAVPLPVIGDGYVVPLA--------------NGVTLTGATYE
MNMC_BURMS      RVRGQLTLLPPGS----APAVPLPVIGDGYVVPLA--------------NGVTLTGATYE
MNMC_BURP6      RVRGQLTLLPPGS----APAVPLPVIGDGYVVPLA--------------NGVTLTGATYE
MNMC_BURTA      RVRGQLTLLPPGS----APAVPLPAIGDGYVVPLA--------------NGVTLTGATYE
MNMC_PARPJ      SIRGQLTLLPPGAV---LPPLQMPVIGEGYAVPLA--------------DGVTLTGATYE
MNMC_PARXL      SIRGQLTLLPAGTV---RPPLELPVIGEGYAVPLA--------------NGATLTGATYE
MNMC_PARP8      SVRGQLTLLPADAT---NAP-RLPVIGEGYALPLL--------------DGVTLTGATYD
MNMC_LEPCP      AVRGQVTRIPA-GTPGLRP-PRLTVAGQGYALRLD--------------NGDVLVGATTQ
MNMC_METPP      AVRGQISSLATDGHPATLPCPRLPVAGGGYVLPQT--------------GGRLLFGATSQ
MNMC_BORBR      ALAGEVTLLPAEA---LSGGPRCVVGGEGYLLPAV--------------DGWCVAGSTYV
MNMC_BORPA      ALAGEVTLLPAEA---LSGGPRCVVGGEGYLLPAV--------------DGWCVAGSTYV
MNMC_BORPD      ALAGEITLLPGQG---LGGGPRCIVGGEGYLLPPV--------------DGWCVAGSTYE
MNMC_BORA1      ALAGEVSHVPAAA---LGGGPHCMIGGEGYVLPAV--------------DGWCVVGSTYA
MNMC_AZOSB      SARGQVSLLPAPAG----SAPRVVMCRMGYVSPAV--------------DGLRCAGATFD
MNMC_AROAE      SARGQVTHFPAAAG----SPPNVVVCRLGYVAPAL--------------DGVRSAGATFS
MNMC_DECAR      SGRGQVSHLPASVG----KPLNTVLFQIGYTIPAI--------------DDTQLIGASLS
MNMC_THIDA      TVRGQVTQLPAGSL----PEIARVIAREGYVAPGA--------------AG-PLVGATYE
MNMC_ACIAC      PLRGQVSWGTRADSPAAA-WPPFPVNGHGNLVPHAGTAG----------GGIWVMGSTFE
MNMC_ACISJ      PLRGQLAWGLHAQAPAGAPWPPQPLNGNGNLVPRVPLQD----------GAGWVLGSTFE
MNMC_DELAS      PIRGQVSWDVHTPASAQA-MPPFPVNGHGNLVPAMPLPGD-------AAGPGWVMGSTFE
MNMC_POLNA      AIRGQASWGLHAPGTEQA-MPAFPVNGHGSLVPRVPL----------EQGLAWVTGSSFE
MNMC_POLSJ      AIRGQVSWALHPPGAADA-LPAFPVNGHGSLIPALPLSGN-------ANELAWVTGSTFE
MNMC_MAGMM      AVQGQLSILPAAN-----PLNQHALVFGGYLTPPYQDEQ---------GQLCQVLGSTYR
MNMC_LEPBJ      KVRGQLISLKETEN---SSRVPNILCAEHYLTPSV--------------QGEHVLGSTFD
MNMC_LEPBL      KVRGQLISLKETEN---SSRVPNILCAEHYLTPSV--------------QGEHVLGSTFD
MNMC_LEPIN      KVRGQLISLKETEK---SSRISNILCAEHYLTPSI--------------LGEHILGSTFD
MNMC_LEPIC      KVRGQLISLKETEK---SSRISNILCAEHYLTPSI--------------LGEHILGSTFD
MNMC_MARMS      KAKAACQTIGESAD---KIDFDKILCEFGYVSPSI--------------NGLLHFGSTYD
MNMC_HYDCU      DLKGALKTTVTHRG---YSVCGDFGAQSPYAAIS---------------------GATFE
MNMC_CAMJJ      KVRGQVTHLKPFLNT------PFPLSSKAYICPVKD--------------DLQVIGASYD
MNMC_CAMJ8      KVRGQVTHLKPFLNT------PFPLSSKAYICPVKD--------------DLQVIGASYD
MNMC_CAMJR      KVRGQVTHLKPFLDT------PFPLSSKAYICPVKD--------------DLQVIGASYD
MNMC_CAMJE      KVRGQVTHLKPFLDT------PFPLSSKAYICPVKD--------------DLQVIGASYD
MNMC_CAMJD      KVRGQVTHLKPFLDT------QFPLSSKAYICPIKD--------------DLQVIGASYD
MNMC_CAMC1      SVRGQVTHLKPVLKN------ELPLSAKGYICPAVK--------------GVQVIGATYA
MNMC_CAMHC      SVRGQITLLRPFLKT------PIPLGARGYICPKIG--------------KRQLIGATYD
MNMC_CAMFF      SVRGQVTHLNKVLNL------NSAFSARGYMCKDVR--------------GIQVVGATYD
MNMC_LEGPA      AIRGQMTTIQSTQEST---QLKIPLCAEGHVLPALN--------------NSHRVGASYD
MNMC_LEGPH      AIRGQMTTIQSTQEST---KLKIPLCAEGHVLPALN--------------NSHKVGASYD
MNMC_LEGPL      AIRGQMTTIQSTQEST---KLKIPLCAEGHVLPALN--------------NSHRVGASYD
MNMC_LEGPC      AIRGQITTIQSTQEST---KLKIPLCAEGHVLPALN--------------NSHRVGASYD
MNMC_ACIBT      PIRGQVSWVDNSFATLP---LNEAYSYGGYCMQLNTS--------------ELILGASFY
MNMC_ACIBY      PIRGQVSWVDNSFATLP---LHEAYSYGGYCMQLNTS--------------ELILGASFY
MNMC_ACIBC      PIRGQVSWVDNSFATLP---LNEAYSYGGYCMQLNTS--------------ELILGASFY
MNMC_ACIAD      PIRGQVSWFEQHTFPFA---PDQAFSYGGYCMQLHPQ--------------QLILGASFH
MNMC_PSYA2      TIRGQLSWFTPTAEQMSR-LPKLPLKYSGYCAPFIGQSSDAQLNHISENQPQFLLGASFV
MNMC_PSYCK      TIRGQLSWFTPTAQQLTQ-LPKLPLKYSGYCAPFIGQSGDAELNHISENQPQFLLGASFI
MNMC_PSYWF      KIRGQLSWFEPTTEQLQA-LPTLPLKYSGYCAPFIPQPGDEAVNSVTPSVPTFLLGASFI
MNMC_PSEAE      RIRGQVTRLPATPQSRA---LRTVVCAEGYVAPPRG--------------DEHTLGASFD
MNMC_PSEAB      RIRGQVTRLPATPQSRA---LRTVVCAEGYVAPPRG--------------DEHTLGASFD
MNMC_PSEA7      RIRGQVTRLPATAQSRA---LRTVVCAEGYVAPPRG--------------DEHTLGASFD
MNMC_PSEMY      RIRGQISRLPANESSSA---LRTVVCAEGYVAPARD--------------DEHTLGASFD
MNMC_PSEP1      RIRGQITRLPATASSQA---LRTVVCAEGYVAPPRE--------------GEHTLGASFD
MNMC_PSEPK      RIRGQITRLPATVSSQA---LRTVVCAEGYVAPPRE--------------GEHTLGASFD
MNMC_PSEPG      RIRGQITRLPATASSRA---LRTVVCAEGYVAPPRG--------------DEHTLGASFD
MNMC_PSEPW      RIRGQITRLPVTDASRA---LATVVCAEGYVAPPRG--------------EEHTLGASFD
MNMC_PSEE4      RIRGQITRLPATEASRA---LRTVVCADGYVAPPRG--------------DEHTLGASFD
MNMC_PSEF5      RIRGQITRLPQTAQSQS---LATVVCAEGYVAPARL--------------GEHTLGASFD
MNMC_PSEPF      RIRGQITRLAQTAQSQA---LATVVCAEGYVAPARW--------------GEHTLGASFD
MNMC_PSE14      RIRGQITRLPQTQASAA---LRSVVCAEGYVAPARL--------------GEHTLGASFD
MNMC_PSEU2      RIRGQITRLPQTQASTA---LRSVVCAEGYVAPARL--------------GEHTLGASFD
MNMC_PSESM      RIRGQITSLPQTGASAA---LRTVVCAEGYVAPARL--------------GEHTLGASFD
MNMC_PSEU5      RIRGQISALPATARSGQ---LRTVLCAKGYVAPPRD--------------GTHTLGASFN
MNMC_CHRVO      KIRGQITSIPASEESSR---LRTVLCGEGYISPARG--------------GRHCLGATFK
MNMC_METFK      QVRGQISRLHHVDGAPV---LHALLCTDGYISPLID--------------GAYCLGATFV
MNMC_NITMU      PVRGQLTLIPATTASQN---LRTIVCGSGYFSPAVA--------------GRHMVGATHR
MNMC_CHRSD      PIRGQLTHVPVPADAPS---LARVVCAGGYVAPAME--------------GVLSLGATFA
MNMC_HAHCH      PIRGQVTTLQVESAALPQ--LNTVLCGEGYLMPPIA--------------DRLVTGATFK
MNMC_MARN8      PIRGQVTRLPADDCQLP----DVVVCGTKYLNPAYD--------------GSAITGATFD
MNMC_IDILO      PVRGQVSLVQTTPLLSS---LKTVLCFKGYLVPEDG--------------NHHCVGASFN
MNMC_PSEA6      MVRGQVEAVPTQTAL---SKLNTVLCHKGYLTPEYN--------------GQHALGSTYV
MNMC_PSET1      GVRGQVSHVQASEQS---TKLKTVLCHKGYFTPAYL--------------DHHCMGATFE
MNMC_COLP3      ATRGQVTSMKSNKKI---NKLSTVICHKGYLTPENN--------------GIHCIGATFQ
MNMC_SHEB5      PFRGQVSHVPAQFQL---SQLATVLCANGYLTPSHQ--------------GLHCLGASYV
MNMC_SHEB9      PFRGQVSHVPAQFQL---SQLATVLCANGYLTPSHQ--------------GLHCLGASYV
MNMC_SHEB8      PFRGQVSHVPAQFQL---SQLATVLCANGYLTPSHQ--------------GLHCLGASYV
MNMC_SHEPC      PFRGQVSHVPAQFQL---SQLATVLCANGYLTPSHE--------------GLHCLGASYV
MNMC_SHESW      PFRGQVSHVPAQFQL---SQLATVLCANGYLTPSHE--------------GLHCLGASYV
MNMC_SHESM      PFRGQVSHVPAQFKL---SQLATVLCANGYLTPSHQ--------------GLHCLGASYV
MNMC_SHESR      PFRGQVSHVPAQFKL---SQLATVLCANGYLTPSHQ--------------GLHCLGASYV
MNMC_SHESA      PFRGQVSHVPAQFKL---SQLATVLCANGYLTPSHQ--------------GLHCLGASYV
MNMC_SHEON      PFRGQVSHIPSQFQL---SQLATVLCANGYLTPSHQ--------------GLHCLGASYV
MNMC_SHEDO      GFRGQVSHVPSKGEL---AKLNTVICANGYLTPAFN--------------STHCVGASYV
MNMC_SHEFN      GFRGQVSHVPPQGEL---AQLNTVICANGYLTPQHN--------------QLHCVGASYV
MNMC_SHESH      GFRGQVSHIPSRNAL---TKLSTVLCSHGYLTPGNN--------------NFHCTGASYV
MNMC_SHEWM      GFRGQVSHIPARNEL---LKLNTVLCSHGYLTPQND--------------GVHCTGASYI
MNMC_SHELP      GFRGQVSHIPERAPL---KDLKTVLCAHGYLTPAHD--------------KLHCTGASYV
MNMC_SHEAM      PFRGQVSHVPTRGKL---EQLKTVLCAHGYFTPRDAS------------SGSHCMGASYV
MNMC_SACD2      NIRGQVSHLSSHGLS---QRLHASVCGAGYIAPAQS--------------GIHCAGASFN
MNMC_DICNV      TVRGQATFFALNAPV-----AGEIFCAERSFIPLPDR-------------VHMHVGSSYS
                   .                                                   *::  

MNMC_ECOLI      R------GSEDTAYSEDDQQQNRQRLIDCFPQ----------------------------
MNMC_ECODH      R------GSEDTAYSEDDQQQNRQRLIDCFPQ----------------------------
MNMC_SHIB3      R------GSEDTAYSEDDQQQNRQRLIDCFPQ----------------------------
MNMC_SHIBS      R------GSEDTAYSEDDQQQNRQRLIDCFPQ----------------------------
MNMC_ECOLC      R------GSEDTAYSEDDQQQNRQRLIDCFPQ----------------------------
MNMC_ECOHS      R------GSEDTAYSEDDQQQNRQRLIDCFPQ----------------------------
MNMC_SHIFL      R------GSEDTAYSEDDQQQNRQRLIDCFPQ----------------------------
MNMC_SHIF8      R------GSEDTAYSEDDQQQNRQRLIDCFPQ----------------------------
MNMC_SHISS      R------GSEDTAYSEDDQQQNRQRLIDCFPQ----------------------------
MNMC_ECO57      R------GSEETAYSEDNQQQNRQRLIDCFPH----------------------------
MNMC_SHIDS      R------GSEDTAYSDEDQQQNRQRLIDCFPQ----------------------------
MNMC_ECOK1      R------GSEETAYSDEDQQQNRQRLIDCFPH----------------------------
MNMC_ECOUT      R------GSEETAYSDEDQQQNRQRLIDCFPH----------------------------
MNMC_ECOL6      R------GSEETAYSDEDQQQNRQRLIDCFPQ----------------------------
MNMC_ECOL5      R------GSEETAYSDEDQQQNRQRLIDCFPQ----------------------------
MNMC_ECOSM      R------GSEDTAYSEDDQQQNRQRLIDCFPQ----------------------------
MNMC_ECO24      R------GSEDTAYSEDDQQQNRQRLIDCFPQ----------------------------
MNMC_CITK8      R------GSEETAYREDDQQQNRQRLIDCFPD----------------------------
MNMC_SALPA      R------GDESTVWREEDQRQNRQRLLDCFPD----------------------------
MNMC_SALTY      R------GDESTVWREEDQRQNRQRLLDCFPD----------------------------
MNMC_SALPB      R------GDESTVWREEDQRQNRQRLLDCFPD----------------------------
MNMC_SALCH      R------GDESTVWREEDQRQNRQRLLDCFPD----------------------------
MNMC_SALTI      R------GDESTVWREEDQRQNRQRLLDCFPD----------------------------
MNMC_SALAR      R------GNESTVWREEDQRQNRQRLLDCFPD----------------------------
MNMC_ENT38      R------GQTEMHYSEADQQQNRQRLVDCFPK----------------------------
MNMC_KLEP7      R------GNTDTTFSEEDQQHNRQRLIDCFPG----------------------------
MNMC_CROS8      R------GVSEMRYQEEDQQRNRQRLIDCLPA----------------------------
MNMC_YERPG      R------GDIATDFRLTEQQENRERLLRCLPQ----------------------------
MNMC_YERPY      R------GDIATDFRLTEQQENRERLLRCLPQ----------------------------
MNMC_YERPE      R------GDIATDFRLTEQQENRERLLRCLPQ----------------------------
MNMC_YERPA      R------GDIATDFRLTEQQENRERLLRCLPQ----------------------------
MNMC_YERPN      R------GDIATDFRLTEQQENRERLLRCLPQ----------------------------
MNMC_YERPP      R------GDIATDFRLTEQQENRERLLRCLPQ----------------------------
MNMC_YERPS      R------GDIATDFRLTEQQENRERLLRCLPQ----------------------------
MNMC_YERPB      R------GDIATDFRLTEQQENRERLLRCLPQ----------------------------
MNMC_YERP3      R------GDIATDFRLTEQQENRERLLRCLPQ----------------------------
MNMC_YERE8      R------GDVTTDFRADEQQENRDRLLRCLPD----------------------------
MNMC_SERP5      R------GETATEYREEEQQDNRARLLRCLPE----------------------------
MNMC_PECAS      R------GQAHGDYREEEQQENRQRLLNCLPN----------------------------
MNMC_PHOLL      R------HRLDNEYSETEQQENRDRLLKCLSD----------------------------
MNMC_VIBCH      R------QHLDATFDPQAQHENAQKLIHCLPE----------------------------
MNMC_VIBC3      R------QHLDATFDPQAQRENAQKLIHCLPE----------------------------
MNMC_VIBCB      R------SHLDYEFDEDAQKDNAEKLVKCLPN----------------------------
MNMC_VIBPA      R------SHLDYEFDENAQRDNVEKLVKCIPN----------------------------
MNMC_VIBVU      R------RHLDTEFDVNAQQENAERLTQCVPN----------------------------
MNMC_VIBVY      R------RHLDTEFDVNAQQENAEKLTQCVPN----------------------------
MNMC_ALIF1      R------RDLDLAFKESDQIENGERLRKCVPN----------------------------
MNMC_PHOPR      R------NSADLAFCEAEHQDNKQRLVHCIPD----------------------------
MNMC_AERHH      R------NQTDLEFRADEQAQNQARLQACLPQ----------------------------
MNMC_AERS4      R------NQSTQAFSAEEQAQNQARLQACLPD----------------------------
MNMC_PSYIN      R------HDLNQAFSQQEQVDNKDKLEKCIPG----------------------------
MNMC_ACTPJ      R------DKAETYFSLEEHHENVAKLQQNLTA----------------------------
MNMC_ACTP2      R------DNAETHFSLEEHHENVAKLQQNLTA----------------------------
MNMC_HAEDU      R------DNTDMAFSAIEHQQNLAKLQQNIGA----------------------------
MNMC_HAEIN      R------DNVDRDFSEQEQQENQQKLQQNIAQ----------------------------
MNMC_HAEIG      R------DNVDRHFSEQEQQENQQKLQQNIAQ----------------------------
MNMC_HAEI8      R------DNVDRHFSEQEQQENQQKLQQNIAQ----------------------------
MNMC_HAEIE      R------DNVDRHFSEQEQQENQQKLQQNIAQ----------------------------
MNMC_HAES1      R------NNKDRHFSHQEQRENQQKIQQNLASTDTDKN----------------------
MNMC_HISS2      R------NNKDRHFSHQEQRENQQKIQQNLASTDTDKN----------------------
MNMC_PASMU      R------DNAERAFSLQEQQENQQKIQTNLAS----------------------------
MNMC_MANSM      R------DCEDRDFSLQEQQENQAKIQLNIAE----------------------------
MNMC_ACTSZ      R------DCENREFSTTEQQENQAKIQKNLAM----------------------------
MNMC_CAUVC      R-----DDTQTNVRSED-HARNLATLAKGLPALAARLAG---------------------
MNMC_CAUSK      R-----DDVGTDARAED-DRRNLRALAEGLPKLAASLAD---------------------
MNMC_MARMM      RG----DQVGPEDVAEA-GFR--ASVAERMPGLALGPVQ---------------------
MNMC_HYPNA      PA----GEGVSAAVSEAARAENLEGVEALSPWWVREAQG---------------------
MNMC_CUPNH      -----ADEGP-LVEQPAVHAANLARLSGMLPRQADAVAA---------------------
MNMC_CUPPJ      -----ADDGP-LVARTEVHAANLDRLAGLLPQAAAAAGN---------------------
MNMC_CUPMC      -----ADEGP-LVERPEVHAANLDRLASMLPDRASQIAQ---------------------
MNMC_RALSO      -----PGETD-PDARTADHAANLRRLAGLQPAHAAALAR---------------------
MNMC_BURCM      -----PDDVD-RTMRTVGHIENLARVRHLLPGLIGELP----------------------
MNMC_BURA4      -----PDDVD-RTMRTAGHIENLERVRHLLPGLIGELP----------------------
MNMC_BURCA      -----PDDTD-PAMRAAGHAENLDRVRHLLPGLIGALP----------------------
MNMC_BURCH      -----PDDTD-PAMRAAGHAENLDRVRHLLPGLIGALP----------------------
MNMC_BURCC      -----PDDTD-PAMRAAGHAENLDRVRHLLPGLIGALP----------------------
MNMC_BURL3      -----PDDVD-PAMRAAGHLENLERVRHLLPGLIGDLP----------------------
MNMC_BURVG      -----PDDVD-PEIRDAGHLENLARIRHLLPGLVGDVP----------------------
MNMC_BURM1      -----PDDVD-PAIRVAGHAENLERVRRLLPGLIGDVP----------------------
MNMC_BURMA      -----PDDTD-ATPREAGHRENLERLERLLPAFSANAL----------------------
MNMC_BURM9      -----PDDTD-ATPREAGHRENLERLERLLPAFSANAL----------------------
MNMC_BURM7      -----PDDTD-ATPREAGHRENLERLERLLPAFSANAL----------------------
MNMC_BURP0      -----PDDTD-ATPREAGHRENLERLERLLPAFSANAL----------------------
MNMC_BURP1      -----PDDTD-ATPREAGHRENLERLERLLPAFSANAL----------------------
MNMC_BURPS      -----PDDTD-ATPREAGHRENLERLERLLPAFSANAL----------------------
MNMC_BURMS      -----PDDTD-ATPREAGHRENLERLERLLPAFSANAL----------------------
MNMC_BURP6      -----PDDTD-ATPREAGHRENLERLERLLPAFSANAL----------------------
MNMC_BURTA      -----PDDAD-TTLREAGHRENLERLERLLPAFSAHAL----------------------
MNMC_PARPJ      -----LDDPD-TSLRADGHLENLERVAQMLPAFANVADP---------------------
MNMC_PARXL      -----LDDPD-TSLRTDGHLENLARVAQMLPAFAGIVDR---------------------
MNMC_PARP8      -----IDDPD-TRLRDGAHIENIERVAQMLPDMRDAFNV---------------------
MNMC_LEPCP      DE---PVGIDGAALRLADQQRNLQRAAGLGVLDATAAE----------------------
MNMC_METPP      -----PDDID-PALRDADHRFNLQQLAGLSGCDVEA------------------------
MNMC_BORBR      ------HGAAQALTGAEGQRVNLDKAAGLLGQAPAAFAS---------------------
MNMC_BORPA      ------HGAAQALTGAEGQRVNLDKAAGLLGQAPAAFAS---------------------
MNMC_BORPD      ------HGAATARVGPAGQQTNLGKAAGLLGGLPAAWAA---------------------
MNMC_BORA1      ------PGVAQSEVSLAGQQRNLEKAAGLLGAPLDAVA----------------------
MNMC_AZOSB      VG------DDDATLRARDHHENLSKLEAMLPGYTAALA----------------------
MNMC_AROAE      VD------DDEPALRDADQRENLAKLEFILPGYAAAVD----------------------
MNMC_DECAR      YE------DDESAEREADHRDNLARLRLTLPDFASDLD----------------------
MNMC_THIDA      HPEGYKENDDDTAPRAASDVANLARLEAILPGATQRFV----------------------
MNMC_ACIAC      RGQ--TELPPAPQEQAQAHAANAAKLEQLLPALAQGLAP---------------------
MNMC_ACISJ      RLK--TALPPSPDDHAKGLATNQAKLHALLPPLGAAMDA---------------------
MNMC_DELAS      RDQ--TALPPSPEDQAAAHAANGAKLAQLLPRAYQGLQG---------------------
MNMC_POLNA      RDN--TSPQLRPED----EQHNFGKLKTLLPAAAQALTA---------------------
MNMC_POLSJ      RDN--ALNDLKPED----DSHNLDRLRTLLPDVAPGLTG---------------------
MNMC_MAGMM      PWDD-LSDCSWSECQPEAHQLVWQQLNETLPQLGQQWLG---------------------
MNMC_LEPBJ      ------EFDLNPKPRKK-DTDLLLQYVQTKYPTLRFDSN---------------------
MNMC_LEPBL      ------EFDLNPKPRKK-DTDLLLQYVQTKYPTLRFDSN---------------------
MNMC_LEPIN      ------EFDLNPLPQKK-DTDRLLEFVQNKYPSLNFDSS---------------------
MNMC_LEPIC      ------EFDLNPLPQKK-DTDRLLEFVQNKYPSLNFDSS---------------------
MNMC_MARMS      ------LKDLDDRVREEGHKRNLAILESLLLLPKETFNS---------------------
MNMC_HYDCU      ------APDLSPILSDASHIENQR--LATEALPNWLADS---------------------
MNMC_CAMJJ      ------RLDTSLESKEEDDKQNIENIAEFIDKN---------------------------
MNMC_CAMJ8      ------RLDASLESKEEDDKQNIENIAEFIDKN---------------------------
MNMC_CAMJR      ------RLNASLESKEEDDKQNIENIAEFIDKN---------------------------
MNMC_CAMJE      ------RLNASLESKEEDDKQNIENIADFMDKN---------------------------
MNMC_CAMJD      ------RLDASLESKEEDDKQNIENIAEFIDKN---------------------------
MNMC_CAMC1      ------RNEICDTPKDEDNAKNLSDVSEFFDTT---------------------------
MNMC_CAMHC      ------RKDYENQARTFDDERNLQNVAELLNKNFVKNTDTRNLNDKKFKFEILDKNVDFN
MNMC_CAMFF      ------RNDNRSAARATDDEKNIDSLSEFITNL---------------------------
MNMC_LEGPA      ------IGTSEPELNALDDQLNLDRLKRIAPDI---------------------------
MNMC_LEGPH      ------IGTSEPELNALDDQLNLARLKRIAPDI---------------------------
MNMC_LEGPL      ------IGTSEPELNALDDQLNLDRLKRIAPDI---------------------------
MNMC_LEGPC      ------IGTSEPELNALDDQLNLDRLKRIAPDI---------------------------
MNMC_ACIBT      P------NRDDQEVLLDDHVHNFELIHSVFPHYAKQLP----------------------
MNMC_ACIBY      P------NRDDQEVLLDDHVHNFELIHSVFPHYAKQLP----------------------
MNMC_ACIBC      P------NRDDQEVLLDDHVHNFELIHSVFPHYAKQLP----------------------
MNMC_ACIAD      P------QRDDDEVLLEDHVHNFNLIHSVFPAYAQTLP----------------------
MNMC_PSYA2      D------GDANIDIRSEENQQNYDKLIEDMPELSSVLP----------------------
MNMC_PSYCK      D------GDTNIDVRDEENQQNYDKLIEDMPELSSVLP----------------------
MNMC_PSYWF      R------NDLDDEIRLSEHAINHQKLLTALPELSAVLPLPDTEA----------------
MNMC_PSEAE      F------KSEDLAPTLAEHQGNLELLREISP---DLLQRLGADD----------------
MNMC_PSEAB      F------KSEDLAPTLAEHQGNLELLREISP---DLLQRLGADD----------------
MNMC_PSEA7      F------KSEDLAPTLAEHQGNLELLREISP---DLLQRLGADD----------------
MNMC_PSEMY      F------HSDDLTPSVAEHAGNLELLREISQ---DLAERLDTQT----------------
MNMC_PSEP1      F------HSEDLAPTVAEHQGNLALLDEISV---DLAQRLAVAE----------------
MNMC_PSEPK      F------HSEDLAPTVAEHQGNLALLDEISV---DLAQRLAVAE----------------
MNMC_PSEPG      F------HSEDLAPTVAEHQGNLALLDEISV---DLAQRLGVAE----------------
MNMC_PSEPW      F------HSDDLTPTVAEHQGNLAMLDEIST---DLARRLGTAA----------------
MNMC_PSEE4      F------HNDDLTPTTAEHQGNLGLLEDIST---DLATRLGCAE----------------
MNMC_PSEF5      F------KSQDLTPTSAEHAGNLEMLREISS---DLLQRLGAEQ----------------
MNMC_PSEPF      F------SSDDLTPTTAEHLGNLAMLEEIST---DLVARLHVSE----------------
MNMC_PSE14      F------NSTDLTPNLADHLGNLGLLREISE---DLTSRLDTAD----------------
MNMC_PSEU2      F------NSTDLTPNLADHLDNLGLLREISE---DLTSRLDTAD----------------
MNMC_PSESM      F------NSVDLTPNVADHLGNLTLLQEISA---DLASRLEAAD----------------
MNMC_PSEU5      F------QQTDDAPSVAEHQANLEMLEQIST---DLYQRLQADP----------------
MNMC_CHRVO      F------DTDDLGVNDGEHAENLAMLAELAP---SLRASLDRDA----------------
MNMC_METFK      P------GDTTTSVRDEEHAQNLDMLKHMAP---SLYDTL--------------------
MNMC_NITMU      F------NDTSINLNVSEHAENLSRLREISPVLRRLSDEVSQDI----------------
MNMC_CHRSD      P------GDTDTAVRTTDHARNLDEFTATLPAF-AEALRAAGVT----------------
MNMC_HAHCH      P------NCADAQVTEADNNANLEQLLQLTP------ALRDELS----------------
MNMC_MARN8      L------RDDNPEPTPEGHQENLDQLRELLP------SVNISKH----------------
MNMC_IDILO      R------DREDLEPTPEDDEENLKQLAENAK---------QPWA----------------
MNMC_PSEA6      K------NDLSTDYRLSEQDKNLATHYQSLSDCQWAQEVV--------------------
MNMC_PSET1      K------NTKSRQVTEQDNLSNREQLLNFYGHCNFATSLG--------------------
MNMC_COLP3      K------NDTNITTNKADDDYNLTMLTKCLPELSSTIDWQE-------------------
MNMC_SHEB5      K------EPEHLDFCPQEQQENLMKMHESYPDHSWL------------------------
MNMC_SHEB9      K------EPEHLDFCSQEQQENLMKMHESYPNQSWL------------------------
MNMC_SHEB8      K------EPKHLDFCPQEQQENLAKMHESYPKQSWL------------------------
MNMC_SHEPC      K------EPKHLDFCPQEQQENLAKMHESYPNQPWL------------------------
MNMC_SHESW      K------EPKHLDFCPQEQQENLAKMHESYPDQGWL------------------------
MNMC_SHESM      K------AAEHLDFCPQEQWENLGKMQESYPNQAWV------------------------
MNMC_SHESR      K------AAEHFDFCPQEQRENLGKMQESYPNQAWV------------------------
MNMC_SHESA      K------AAEHFDFCPQEQRENLGKMQESYPNQAWV------------------------
MNMC_SHEON      K------AAEHLDFCPLEQLENLGKMQQSYPNQDWV------------------------
MNMC_SHEDO      K------DPEHLDFCSDEQAENGQKMQQSFPNLEWP------------------------
MNMC_SHEFN      K------DPQHLDFCPIEQHENSLKMKQSFPNSNWP------------------------
MNMC_SHESH      K------NPTNLDYCATEQVENLHKIRHSYVDKPWT------------------------
MNMC_SHEWM      K------NPEHLDYSPSEQAENLEKVKQSYLGKAWT------------------------
MNMC_SHELP      K------DASNLDYSAVEQVENLDKIRTSY-GGEWT------------------------
MNMC_SHEAM      R------GDTSVEYREQEQQENLHKMQESYPGKDWV------------------------
MNMC_SACD2      L------HENTLDLREEDHQFNIDNLASMSKSLTFN------------------------
MNMC_DICNV      V------NDCDRMRRTQDDAEHAEACRARFPQ----------------------------
                                                                            

MNMC_ECOLI      -------------------AQWAKEVDVSDKE----ARCGVRCATRDHLPMVGNVPDYEA
MNMC_ECODH      -------------------AQWAKEVDVSDKE----ARCGVRCATRDHLPMVGNVPDYEA
MNMC_SHIB3      -------------------AQWAKEVDVSDKE----ARCGVRCATRDHLPMVGNVPDYEA
MNMC_SHIBS      -------------------AQWAKEVDVSDKE----ARCGVRCATRDHLPMVGNVPDYEA
MNMC_ECOLC      -------------------AQWAKEVDVSDKE----ARCGVRCATRDHLPMVGNVPDYEA
MNMC_ECOHS      -------------------AQWAKEVDVSDKE----ARCGVRCATRDHLPMVGNVPDYEA
MNMC_SHIFL      -------------------AQWAKEVDVSDKE----ARCGVRCATRDHLPMVGNVPDYEA
MNMC_SHIF8      -------------------AQWAKEVDVSDKE----ARCGVRCATRDHLPMVGNVPDYEA
MNMC_SHISS      -------------------AQWAKEVDVSDKE----ARCGVRCATRDHLPMVGNVPDYEA
MNMC_ECO57      -------------------AQWAKTVDVSKKE----ARCGVRCATRDHLPMVGNVPDYEA
MNMC_SHIDS      -------------------AQWAKEVDISEKE----ARCGVRCATRDHLPMVGNVPDYEA
MNMC_ECOK1      -------------------AQWAKEVDVSGKE----ARCGVRCATRDHLPMVGNVPDYDA
MNMC_ECOUT      -------------------AQWAKEVDVSGKE----ARCGVRCATRDHLPMVGNVPDYDA
MNMC_ECOL6      -------------------VQWAKEVDVSGKE----ARCGVRCATRDHLPMVGNVPDYDA
MNMC_ECOL5      -------------------VQWAKEVDVSGKE----ARCGVRCATRDHLPMVGNVPDYDA
MNMC_ECOSM      -------------------AQWAKAVDVSDKE----ARCGVRCATRDHLPMVGNVPDYDA
MNMC_ECO24      -------------------AQWAKEVDVSEKE----ARCGVRCATRDHLPMVGNVPDYEA
MNMC_CITK8      -------------------AAWAKEVDISEKA----ARCGVRCATRDHLPMVGNVPDYDA
MNMC_SALPA      -------------------AKWATEVDVSGNS----ARCGVRCATRDHLPMVGNVPDYHA
MNMC_SALTY      -------------------AKWATEVDVSGNS----ARCGVRCATRDHLPMVGNVPDYHA
MNMC_SALPB      -------------------AKWATEVDVSGNS----ARCGVRCATRDHLPMVGNVPDYHA
MNMC_SALCH      -------------------AKWATEVDVSGNS----ARCGVRCATRDHLPMVGNVPDYHA
MNMC_SALTI      -------------------ANWATEVDVSGNS----ARCGVRCATRDHLPMVGNVPDYHA
MNMC_SALAR      -------------------ADWAKEVDVSDNS----ARCGVRCATRDHLPMVGNVPDYHA
MNMC_ENT38      -------------------AEWAKEVDVSDSD----ARCGVRCATRDHLPMVGNVPDYES
MNMC_KLEP7      -------------------AEWPQDVDISAND----ARCGVRCATRDHLPMVGNVPDYAA
MNMC_CROS8      -------------------ASWAQEVDVSAGD----ARCGVRCATRDHLPMVGNAPDYAA
MNMC_YERPG      -------------------VSWPQQVDVSDNQ----ARCGVRCAIRDHLPMVGAVPDYAA
MNMC_YERPY      -------------------VSWPQQVDVSDNQ----ARCGVRCAIRDHLPMVGAVPDYAA
MNMC_YERPE      -------------------VSWPQQVDVSDNQ----ARCGVRCAIRDHLPMVGAVPDYAA
MNMC_YERPA      -------------------VSWPQQVDVSDNQ----ARCGVRCAIRDHLPMVGAVPDYAA
MNMC_YERPN      -------------------VSWPQQVDVSDNQ----ARCGVRCAIRDHLPMVGAVPDYAA
MNMC_YERPP      -------------------VSWPQQVDVSDNQ----ARCGVRCAIRDHLPMVGAVPDYAA
MNMC_YERPS      -------------------VSWPQQVDVSDNQ----ARCGVRCAIRDHLPMVGAVPDYAA
MNMC_YERPB      -------------------VSWPQQVDVSDNQ----ARCGVRCAIRDHLPMVGAVPDYAA
MNMC_YERP3      -------------------VSWPQQVDVSDNQ----ARCGVRCAIRDHLPMVGAVPDYAA
MNMC_YERE8      -------------------VSWPQQVDISDNQ----ARCGVRCAIRDHLPMVGAVPDYSA
MNMC_SERP5      -------------------QSWPAQVDVSGQH----ARCGVRSATRDHLPMIGAVPDYQA
MNMC_PECAS      -------------------ADWAKTVDISDAQ----ARQGVRCALRDHLPLIGAVPNYEQ
MNMC_PHOLL      -------------------AEWVNQVDVSAKQ----SRQGIRCVIRDHMPMVGNVPDLNK
MNMC_VIBCH      -------------------QTWPLEVDVSGNQ----SRQGVRCVSRDHLPFVGNVGEFSK
MNMC_VIBC3      -------------------QTWPLEVDVGGNQ----SRQGVRCVSRDHLPFVGNVGEFSK
MNMC_VIBCB      -------------------QTWTKEVDTSGNL----SRQGIRCVSRDHLPFVGNVGDFET
MNMC_VIBPA      -------------------QEWTKEVDTSGNL----SRQGIRCVSRDHLPFVGNVGDFET
MNMC_VIBVU      -------------------QAWAKEVDTSGNL----SRQGIRCVSRDHLPFVGNVGDFSA
MNMC_VIBVY      -------------------QAWAKEVDTSGNL----SRQGIRCVSRDHLPFVGNVGDFSA
MNMC_ALIF1      -------------------EVWPNDVDTSDNQ----ARVGIRCASRDHLPFIGNVVRFEE
MNMC_PHOPR      -------------------VEWPKNVDISANQ----SRAGVRCASRDHLPFVGNICRYEA
MNMC_AERHH      -------------------QAWPAEVDVSGNQ----ARVGVRSASRDHLPVVGPVASLAK
MNMC_AERS4      -------------------QAWPAEVDVSSNE----ARVGVRCASRDHLPVAGPIARLAG
MNMC_PSYIN      -------------------KTWTEQIDINHPN----AHVGIRCTTRDHFPYVGAIPDYQA
MNMC_ACTPJ      -------------------CDWTQGIDESQNL----AKQGVRAALRDRVPMVGQMPNFSV
MNMC_ACTP2      -------------------CDWTQGIDESQNL----AKQGVRAALRDRVPMVGQMPNFSV
MNMC_HAEDU      -------------------YHWTQGIDLSANL----AKQGIRSALRDRVPMVGPIPHFAV
MNMC_HAEIN      --------------------PWTQDVDTSDNL----ARVGIRCSVRDLAPMVGNVPHFEQ
MNMC_HAEIG      --------------------PWTQDVNTSDNL----ARVGIRCSVRDLAPMVGNVPHFEQ
MNMC_HAEI8      --------------------PWTQDVNTSDNL----ARVGIRCSVRDLAPMVGNVPHFEQ
MNMC_HAEIE      --------------------PWTQDVNTSDNL----ARVGIRCSVRDLAPMVGNVPHFEQ
MNMC_HAES1      -------------------MDWLQDIDISANI----ARIGVRCSVRDRVPIMGNVPHFEQ
MNMC_HISS2      -------------------MDWLQDIDISANI----ARIGVRCSVRDRVPIMGNVPHFEQ
MNMC_PASMU      -------------------VDWVNEVDTRNNQ----ARIGIRCSVRDRIPMLGNVPDFEQ
MNMC_MANSM      --------------------DWTKEVNTADNL----ARTGIRCAVRDRIPLVGNVPDFER
MNMC_ACTSZ      --------------------DWTHDVDTSDNR----ARVGVRCAVRDRIPMMGNVPDFDR
MNMC_CAUVC      ----------------------STFEGRAA----------IRATTPDRLPLADLR-----
MNMC_CAUSK      ----------------------APLRGRAA----------VRATTADHLPVAGAVPGA--
MNMC_MARMM      ----------------------GRWQG-------------VRAATPDRLPVAGRL-----
MNMC_HYPNA      ----------------------GAAVSRAS----------VRATTPDRLPLIGAAPDAGA
MNMC_CUPNH      ----------------------IDPATLSG-------YVGVRTVTHNRLPLVGQVPDEAA
MNMC_CUPPJ      ----------------------LDAAAMSG-------YVGVRTVSHNRLPLIGQMPDEAA
MNMC_CUPMC      ----------------------IDPATLQG-------YVGVRTVTYNRLPLVGRIADDAQ
MNMC_RALSO      ----------------------VDPARLLG-------YVGVRCVSANRLPLIGAVADEAA
MNMC_BURCM      -----------------------DVDTLRG-------RVAFRWVVADRVPVIGPLADEAQ
MNMC_BURA4      -----------------------DVDTLRG-------RVAFRWVVADRVPVIGPLADEAQ
MNMC_BURCA      -----------------------DPATLRG-------RVAFRWVVGDRLPLIGPLADETQ
MNMC_BURCH      -----------------------DPATLRG-------RVAFRWVVGDRLPLIGPLADETQ
MNMC_BURCC      -----------------------DPATLRG-------RVAFRWVVGDRLPLIGPLADETQ
MNMC_BURL3      -----------------------DPDTLRG-------RVAFRWVVGDRLPLLGPLADEAG
MNMC_BURVG      -----------------------DVDTLRG-------RVAFRWVVADRVPLIGPLADEAQ
MNMC_BURM1      -----------------------ALDTLRG-------RVAFRWVAGDRLPLIGPLADEAQ
MNMC_BURMA      -----------------------DAGALAG-------RVGFRCVASDRLPLVGELGDEAA
MNMC_BURM9      -----------------------DAGALAG-------RVGFRCVASDRLPLVGELGDEAA
MNMC_BURM7      -----------------------DAGALAG-------RVGFRCVASDRLPLVGELGDEAA
MNMC_BURP0      -----------------------DAGALAG-------RVGFRCVASDRLPLVGELGDEAA
MNMC_BURP1      -----------------------DAGALAG-------RVGFRCVASDRLPLVGELGDEAA
MNMC_BURPS      -----------------------DAGALAG-------RVGFRCVASDRLPLVGELGDEAA
MNMC_BURMS      -----------------------DAGALAG-------RVGFRCVASDRLPLVGELGDEAA
MNMC_BURP6      -----------------------DAGALAG-------RVGFRCVASDRLPLVGELGDEAA
MNMC_BURTA      -----------------------DAHALAG-------RVGFRCVASDRLPLVGELGDEAA
MNMC_PARPJ      ----------------------ARSTALTG-------RVAFRCVTSDRMPMIGQLADEAQ
MNMC_PARXL      ----------------------ADPAALAG-------RVAFRCVTSDRMPMIGQLADETV
MNMC_PARP8      ----------------------HAPSSLTG-------RVAFRCVTSDRLPMIGAFADEAA
MNMC_LEPCP      ----------------------FGTTLLPG-------RAGWRAVTADRLPLVGPPIDLAQ
MNMC_METPP      ----------------------WSSLPWQG-------RVGWRAVTSDRLPLIGAVPDLEA
MNMC_BORBR      ----------------------LQPGSLPG-------WAGWRAVLPGRLPAAGP------
MNMC_BORPA      ----------------------LQPGSLPG-------WAGWRAVLPGRLPAAGP------
MNMC_BORPD      ----------------------LAPGQLPG-------WAGWRAVLPGRLPAVGP------
MNMC_BORA1      -------------------------GPLPG-------WAGWRAVMPGRLPVLGE------
MNMC_AZOSB      ------------------------TQPAEG-------RVGFRPASPDRLPMVGAVPALTT
MNMC_AROAE      ------------------------TAALAG-------RVGFRPASPDRLPMVGEVPAVLR
MNMC_DECAR      ------------------------PATLHG-------RVGFRPMSPDRMPIVGAVPDTMT
MNMC_THIDA      ------------------------SNEVSG-------RASLRATLPDRLPLVGAVDG---
MNMC_ACIAC      ----------------------AIAGPGAAPG----HWAAVRCTAPDRLPFVGPV-----
MNMC_ACISJ      ----------------------AFSQAATAPDGPVRTWAAVRCGALDRRPIVGPV-----
MNMC_DELAS      ----------------------FFDAPPRA------TWGAVRVASPDRLPVVGPV-----
MNMC_POLNA      ----------------------QFESGQVR------GWTGVRCATPSRLPALG-------
MNMC_POLSJ      ----------------------QLEMGQVK------AWAGVRCATPSRLPALG-------
MNMC_MAGMM      ----------------------PARQGRAA----------LRAAMKDHFPLFGPLINPSA
MNMC_LEPBJ      ----------------------CVLSEKTG----------FRAQTPDRFPIIGPIFDPKI
MNMC_LEPBL      ----------------------CVLSEKTG----------FRAQTPDRFPIIGPIFDPKI
MNMC_LEPIN      ----------------------CVLIEKVG----------LRAQTPDRLPILGPVFDPRE
MNMC_LEPIC      ----------------------CVLIEKVG----------LRAQTPDRLPILGPVFDPRE
MNMC_MARMS      ----------------------EDCGGRVS----------FRCAVPDYTPIVGPVQSEDV
MNMC_HYDCU      ----------------------TDMAGKVG----------FRPTTPDHLPLIGAVPDFEW
MNMC_CAMJJ      -----------------------TKLEIIG------SKVGFRSYSSDRFMIVGNAYDEVF
MNMC_CAMJ8      -----------------------TKLEIIG------SKVGFRSYSSDRFMIVGNAYDEVF
MNMC_CAMJR      -----------------------TKLEIIG------SKVGFRSYSSDRFMIVGNAYDEVF
MNMC_CAMJE      -----------------------TKLEIIG------SKVGFRSYSSDRFMIVGNAYDEAF
MNMC_CAMJD      -----------------------TKLEIIG------SKVGFRSYSSDRFMIVGNAYDEAF
MNMC_CAMC1      ------------------------KAAIIG------SRVGYRSYSGDRFPIIGALHDEEF
MNMC_CAMHC      VSKQNLNFKMHTQNKELAFKNQILNVKILG------SRVGFRGYSGDRFPLIGALPDCEY
MNMC_CAMFF      ------------------------DVKVVG------SNVGFRGYSGDRFPIVGAVHNASE
MNMC_LEGPA      ----------------------MWSQNVLD------HWAGIRAASPDYLPIVGPLPNALE
MNMC_LEGPH      ----------------------MWSQNVLD------HWAGIRAASPDYLPIVGPLPNALE
MNMC_LEGPL      ----------------------IWSQNVLD------HWAGIRAASPDYLPIVGPLPNALE
MNMC_LEGPC      ----------------------MWSQNVLD------HWAGIRAASPDYLPIVGPLPNALE
MNMC_ACIBT      -----------------------PVEQWQG-------RASVRAQSPDYFPVVGKMQK---
MNMC_ACIBY      -----------------------PVEQWQG-------RASVRAQSPDYFPVVGKMQN---
MNMC_ACIBC      -----------------------PVEQWQG-------RASVRAQSPDYFPLVGKMQN---
MNMC_ACIAD      -----------------------PVEEWHG-------RASVRAQSPDYFPLVGQLQD---
MNMC_PSYA2      ----------------------NDISTWHS-------RAGIRTQTIDYHPLVGLLAQ---
MNMC_PSYCK      ----------------------NDISTWHA-------RAGIRTQTMDYHPLVGLLAQ---
MNMC_PSYWF      ----------------------DLYQRWQA-------RVGIRSQTPDYHPLVGAVDE---
MNMC_PSEAE      ----------------------LPLERLEG-------RAAFRCTSPDYLPLVGPLAERAA
MNMC_PSEAB      ----------------------LPLERLEG-------RAAFRCTSPDYLPLVGPLAERAA
MNMC_PSEA7      ----------------------LPLERLEG-------RAAFRCTSPDYLPLVGPLAERAA
MNMC_PSEMY      ----------------------LDPATLQG-------RAAFRCTSPDYLPLVGPLAAGQA
MNMC_PSEP1      ----------------------LDPEQLQG-------RAAFRCTSPDYLPIVGPIADAQA
MNMC_PSEPK      ----------------------LDPEQLQG-------RAAFRCTSPDYLPIVGPIADAQA
MNMC_PSEPG      ----------------------LDAEQLQG-------RAAFRCTSPDYLPIVGPLADSQA
MNMC_PSEPW      ----------------------LAPEQLQG-------RAAFRCTSPDYLPIVGPVADPAA
MNMC_PSEE4      ----------------------LDAEQLEG-------RAAFRCTSPDYLPIVGPVADVQA
MNMC_PSEF5      ----------------------LPLDSLQG-------RAAFRCTSPDYLPIVGPLADPLA
MNMC_PSEPF      ----------------------RDAESLQG-------RAAFRCTSPDYLPMVGPLADREA
MNMC_PSE14      ----------------------LSPEQLQG-------RAAFRCTSPDYLPIVGPLADREA
MNMC_PSEU2      ----------------------LSPEQLQG-------RAAFRCTSPDYLPIVGPLADREA
MNMC_PSESM      ----------------------RPPEQLRG-------RAAFRCTSPDYLPIVGPLADREA
MNMC_PSEU5      ----------------------QRTEALQG-------RVAFRCTSPDYLPLIGPLADPQR
MNMC_CHRVO      ------------------------PEHLDG-------RAAFRCTSPDYLPLVGPAVAARD
MNMC_METFK      -----------------------MPQAPTG-------RAAVRCTSVDYLPLVGPVLDAAL
MNMC_NITMU      ----------------------RQLEQLDG-------RTSIRGSVPGAMPLVGELL----
MNMC_CHRSD      ----------------------LDPAACEG-------RASLRAASPDKSPYAGPVPVREA
MNMC_HAHCH      ----------------------KHPPTLQG-------RASVRSALPDYLPAIGPLIPGQ-
MNMC_MARN8      ----------------------IQAEHLEG-------RVAFRCATHDYQPVAGPCPDNNE
MNMC_IDILO      ----------------------ESLQLTSQ-------RVSVRATSPDHQPVTGAVA----
MNMC_PSEA6      -------------------------GNAQG-------RAAVRCSSPDHLPLVGALADIEK
MNMC_PSET1      -------------------------NITAA-------KAAVRCSFIDHLPMAGEWVEQSD
MNMC_COLP3      ------------------------QDISSS-------KARLRCMSQDHLPLVGAVPDIKE
MNMC_SHEB5      -----------------------EDIDMSGNN----ARVGVRMVTRDHFPMMGCAPDVPK
MNMC_SHEB9      -----------------------EDIDMSGNN----ARIGVRMVTRDHFPMMGCAPDVAK
MNMC_SHEB8      -----------------------EDIDMSGNN----ARVGVRMVTRDHFPMMGCAPDVPK
MNMC_SHEPC      -----------------------EDIDMSGNN----ARVGVRMVTRDHFPMMGCAPDVAQ
MNMC_SHESW      -----------------------DDIDMSGNN----ARVGVRMVTRDHFPMMGCAPDVPK
MNMC_SHESM      -----------------------DDIDISDNS----ARVGVRMVTRDHFPMMGCAPDVAE
MNMC_SHESR      -----------------------DDIDISGNS----ARVGVRMVTRDHFPMMGCAPDVAE
MNMC_SHESA      -----------------------DDIDISGNS----ARVGVRMVTRDHFPMMGCAPDVAE
MNMC_SHEON      -----------------------EDIDISANS----ARVGVRMVTRDHFPMMGCAPDVNE
MNMC_SHEDO      -----------------------QDIDVSDRN----ARVGVRMVTRDHFPMMGCAPDIEE
MNMC_SHEFN      -----------------------NDIDVSNND----ARVGVRMVSRDHFPVMGCAPDVEA
MNMC_SHESH      -----------------------EDVDITGHS----ARVGVRMVTRDHAPMMGCAPDTDS
MNMC_SHEWM      -----------------------EDVDISDHS----ARVGVRMVTRDHAPMMGCAPDFDV
MNMC_SHELP      -----------------------KAVDITGHS----ARVGVRMVTRDHAPMMGCAPDFEA
MNMC_SHEAM      -----------------------EYLDISEGS----ARAGIRMVSRDHLPMAGAAPDVAA
MNMC_SACD2      ----------------------PPLTTLDG-------KVGFRATTPDYFPIVGPVPIRDE
MNMC_DICNV      -----------------------HAIQLERAF------VGIRAASRDYLPLIGAVVRAES
                                                         *    .     .       

MNMC_ECOLI      TLVEYASLAEQ--------------KDEAVSAPVFDDLFMFAALGSRGLCSAPLCAEILA
MNMC_ECODH      TLVEYASLAEQ--------------KDEAVSAPVFDDLFMFAALGSRGLCSAPLCAEILA
MNMC_SHIB3      TLVEYASLAEQ--------------KDEAVSAPVFDDLFMFAALGSRGLCSAPLCAEILA
MNMC_SHIBS      TLVEYASLAEQ--------------KDEAVSAPVFDDLFMFAALGSRGLCSAPLCAEILA
MNMC_ECOLC      TLVEYASLAEQ--------------KDEAVSAPVFDDLFMFAALGSRGLCSAPLCAEILA
MNMC_ECOHS      TLVEYASLAEQ--------------KDEAVSAPVFDDLFMFAALGSRGLCSAPLCAEILA
MNMC_SHIFL      TLVEYASLAEQ--------------KDEAVSAPVFDDLFMFAALGSRGLCSAPLCAEILA
MNMC_SHIF8      TLVEYASLAEQ--------------KDEAVSAPVFDDLFMFAALGSRGLCSAPLCAEILA
MNMC_SHISS      TLVEYASLAEQ--------------KDEAVSAPVFDDLFMFAALGSRGLCSAPLCAEILA
MNMC_ECO57      TLVEYASLAEQ--------------KDKAVSAPVFDDLFMFAALGSRGLCSAPLCAEILA
MNMC_SHIDS      TLVEYASLAEQ--------------KDKAVSAPVYDDLFMLDALGSRGLCSAPLCAEILA
MNMC_ECOK1      TLVEYASLAEK--------------KDEAVSAPVYDDLFMFAALGSRGLCSAPLCAEILA
MNMC_ECOUT      TLVEYASLAEK--------------KDEAVSAPVYDDLFMFAALGSRGLCSAPLCAEILA
MNMC_ECOL6      TLVEYASLAEK--------------KDEAVSAPVYDDLFMFAALGSRGLCSAPLCAEILA
MNMC_ECOL5      TLVEYASLAEK--------------KDEAVSAPVYDDLFMFAALGSRGLCSAPLCAEILA
MNMC_ECOSM      TLVEYASLAEK--------------KDEAVSAPVYDDLFMFAALGSRGLCSAPLCAEILA
MNMC_ECO24      TLVEYASLAEQ--------------KDKAVSAPVYDDLFMLAALGSRGLCSAPLCAEILA
MNMC_CITK8      TLAQYAALARQ--------------KDAAERAPVYPDLFMLGALGSRGLCSAPLCAEILA
MNMC_SALPA      TLTHYADLADN--------------KTSAAPAPVYPGLFVLGALGSRGLCSAPLCAEILA
MNMC_SALTY      TLTHYADLADN--------------KTSAAPAPVYPGLFMLGALGSRGLCSAPLCAEILA
MNMC_SALPB      TLTHYADLADN--------------KTSAAPAPVYPGLFMLGALGSRGLCSAPLCAEILA
MNMC_SALCH      TLTHYADLADN--------------KTSAAPAPVYPGLFVLGALGSRGLCSAPLCAEILA
MNMC_SALTI      TLTHYADLADN--------------KTSAASAPVYPGLFMLGALGSRGLCSAPLCAEILA
MNMC_SALAR      TLTHYADLADN--------------KASAVPAPVYPGLFMLGALGSRGLCSAPLCAEILA
MNMC_ENT38      TLTEYQNLAEN--------------TETAVTAPVYPGLFMLGALGSRGLCTAPLLAEILA
MNMC_KLEP7      TLTQYASLHEQ--------------PDIADSAPVCRNLFMLGALGSRGLCTAPLSAELLA
MNMC_CROS8      TLRDYATLSQDASA-----------PETVMPAPVLKNLFVLGALGSRGLCSAPLAAEILA
MNMC_YERPG      TLAQYQDLSRRIQHGG------ESEVNDIAVAPVWPELFMVGGLGSRGLCSAPLVAEILA
MNMC_YERPY      TLAQYQDLSRRIQHGG------ESEVNDIAVAPVWPELFMVGGLGSRGLCSAPLVAEILA
MNMC_YERPE      TLAQYQDLSRRIQHGG------ESEVNDIAVAPVWPELFMVGGLGSRGLCSAPLVAEILA
MNMC_YERPA      TLAQYQDLSRRIQHGG------ESEVNDIAVAPVWPELFMVGGLGSRGLCSAPLVAEILA
MNMC_YERPN      TLAQYQDLSRRIQHGG------ESEVNDIAVAPVWPELFMVGGLGSRGLCSAPLVAEILA
MNMC_YERPP      TLAQYQDLSRRIQHGG------ESEVNDIAVAPVWPELFMVGGLGSRGLCSAPLVAEILA
MNMC_YERPS      TLAQYQDLSRRIQHGG------ESEVNDIAVAPVWPELFMVGGLGSRGLCSAPLVAEILA
MNMC_YERPB      TLAQYQDLSRRIQHGG------ESEVNDIAVAPVWPELFMVGGLGSRGLCSAPLVAEILA
MNMC_YERP3      TLAQYQDLSRRIQHGG------ESEVNDIAVAPVWPELFMVGGLGSRGLCSAPLVAEILA
MNMC_YERE8      TLAQYQDLPRKIQHG-----------EDIPLAPVWPELFMVGALGSRGLCSAPLVAEILA
MNMC_SERP5      TLTQYQHLQRQHQRG-----------EAIANAPSYPNLFVIGALGSRGLCSAPLAAEILA
MNMC_PECAS      TLKEYENRLHPQHRA-----------DTVSSAPYWQDLFIIGALGSRGLCSAPLAAEILA
MNMC_PHOLL      IMTDYQDLPEKIRTG-----------SPITDAPCYSNLFVIGALGSRGLCSAPLSAEILA
MNMC_VIBCH      ITEQYRDLAQQH---------------QAEPIALYPQLYALVGLGSRGLSSAPLMAELLA
MNMC_VIBC3      ITEQYRDLAQQQ---------------EAEPIALYPQLYALVGLGSRGLSSAPLMAELLA
MNMC_VIBCB      IKTQYADLQNQQE-------------QDVEAIHQFPNLFCFLGLGSRGLSSAPLMAEVLA
MNMC_VIBPA      IKMQYADLQNQAE-------------EEVEAIHQFPNLFCFLGLGSRGLSSAPLLAEVLA
MNMC_VIBVU      IKRQYADLPHTQA-------------EEIEVISQFPNLFCLLGLGSRGLSSAPLMAELLA
MNMC_VIBVY      IKRQYADLPHTQA-------------EEIEVISQFPNLFCLLGLGSRGLSSAPLMAELLA
MNMC_ALIF1      MQEEYKNIYKKRHWL-----------REAKDIPVYEGLFCMLTLGSRGLSSAPLLAEALA
MNMC_PHOPR      LIEQYKDLRDNQA--------------TAETVPIYANLYSIVGLGSRGLSSAPLLGELLA
MNMC_AERHH      LADHYAGLQGDQ--------------QNAAPLPLHPGLYVLGALGSRGLCSAPLCGELLA
MNMC_AERS4      LADHYARLQRDQ--------------QNPAPLPLHPGLYVLGALGSRGLCSAPLCGELIA
MNMC_PSYIN      TKIHYKNAAKE---------------VNPVNAPFHPNLYLLTGLGSRGFCSAPLLAEMLA
MNMC_ACTPJ      QKVQYQNLYNQLRR-----------KQAVENAANFANLYMVNGLASRGLTTAPLLGEMLA
MNMC_ACTP2      QKVQYQNLYNQLRR-----------KQAVENAANFANLYMVNGLASRGLTTAPLLGEMLA
MNMC_HAEDU      QKQQYSNIYNLLRR-----------KKAVENAVNFPHLYMVNGLASRGLTTAPLLGEMLA
MNMC_HAEIN      QQADYYNLFNLRRR-----------KQPIQSAANFQNLFLIAALGSRGLTSAPLLGETLA
MNMC_HAEIG      QQAGYYNLFNLRRR-----------KQPIQSAVNFQNIFLIAALGSRGLTSAPLLGETLA
MNMC_HAEI8      QQADYYNLFNLRRR-----------KQPIQSAANFQNIFLIAALGSRGLTSAPLLGETLA
MNMC_HAEIE      QQADYYNLFNLRRR-----------KQPIQSAINFENLFLTAALGSRGLTSAPLLGETLA
MNMC_HAES1      QCLDYRNIFNLRRR-----------KQPIPDAAQWKNLYLIGALGSRGLTSAALLGETLA
MNMC_HISS2      QCLDYRNIFNLRRR-----------KQPIPDAAQWKNLYLIGALGSRGLTSAALLGETLA
MNMC_PASMU      QLSDYHNLYNLRRR-----------KHAIKHAALHPNLFLIGALGSRGLTSAPLLAETLA
MNMC_MANSM      QADEYRNIFNLRRR-----------KQFIPQAAVFENLYLVGALGSRGLTSAPLLGEILA
MNMC_ACTSZ      QTEEYRNLFNLRRR-----------KQPVLVAANFENLYLVGALGSRGLTSAPILGECLA
MNMC_CAUVC      ----------------------------------EDGVIVLTGLGSRGFCLAPLLAEHLV
MNMC_CAUSK      ----------------------------------APGLFVLGGLGGRGFCLAPLLAEHLA
MNMC_MARMM      ----------------------------------SERVSILAGLGSRGFAHAPLLAEDLA
MNMC_HYPNA      IAALW-------DGK-----------AERASSPVLPGVYVAGGFGSRGFTWAPWAAAIIA
MNMC_CUPNH      ALAQA-----ASLRG-----------AHLRDLPRMPGLYAALAYGSRGLTWAALGAELLA
MNMC_CUPPJ      AIAAA-----PSLRG-----------AHLRDIPRVPGLYAALAYASRGLTWAALGAELLA
MNMC_CUPMC      ALSRA-----AALRG-----------AHLRDLPRLPGLYAALAYASRGLTWAALCAELIA
MNMC_RALSO      IMAPG-----FRLRG-----------PH-AALPRVPGLYAALAYGSRGLTWSVLGAELLA
MNMC_BURCM      AVANA-----RALSG-----------AKARDLPRTAGLYGAFGYGSRGLVWAALGAELIA
MNMC_BURA4      GVANA-----RALSG-----------AKARDLPRAAGLYGAFGYGSRGLVWAALGAELIA
MNMC_BURCA      ATANA-----RALGG-----------AQARDLPRMPGLYGAFGFGSRGLVWAALGAELIA
MNMC_BURCH      ATANA-----RALGG-----------AQARDLPRMPGLYGAFGFGSRGLVWAALGAELIA
MNMC_BURCC      ATANA-----RALGG-----------AQARDLPRMPGLYGAFGFGSRGLVWAALGAELIA
MNMC_BURL3      AIANA-----RALSG-----------AQARDLPRLPGLYGAFGFGSRGLVWAALGAELIA
MNMC_BURVG      AVANA-----RALSG-----------AKARDLPRTAGLYGAFGFGSRGLVWASLGAELIA
MNMC_BURM1      AVANA-----RALSG-----------AKARDLPRMPGLYGAFGYGSRGLVWAALGAELIA
MNMC_BURMA      AAREA-----AALTG-----------ARLRDVPRATGLYGAFGYGSRGLVWAALGAELIA
MNMC_BURM9      AAREA-----AALTG-----------ARLRDVPRATGLYGAFGYGSRGLVWAALGAELIA
MNMC_BURM7      AAREA-----AALTG-----------ARLRDVPRATGLYGAFGYGSRGLVWAALGAELIA
MNMC_BURP0      AAREA-----AALTG-----------ARLRDVPRATGLYGAFGYGSRGLVWAALGAELIA
MNMC_BURP1      AAREA-----AALTG-----------ARLRDVPRATGLYGAFGYGSRGLVWATLGAELIA
MNMC_BURPS      AAREA-----AALTG-----------ARLRDVPRATGLYGAFGYGSRGLVWAALGAELIA
MNMC_BURMS      AAREA-----AALTG-----------ARLRDVPRATGLYGAFGYGSRGLVWAALGAELIA
MNMC_BURP6      AAREA-----AALTG-----------ARLRDVPRATGLYGAFGYGSRGLVWAALGAELIA
MNMC_BURTA      AARDA-----AALTG-----------ARLRDVPRAAGLYGAFGYGSRGLVWAALGAELIA
MNMC_PARPJ      AALDA-----QRLRG-----------AWPLDLPRTDGLYGAFAYGSRGLVWAALGAELIA
MNMC_PARXL      AARDA-----QRLRG-----------AWPLDLPRTDGLYGAFAYGSRGLVWAALGAELIA
MNMC_PARP8      AIRDA-----GKLCG-----------AWPLDLPRADGLYGAFAFGSRGLVWASLGAELMA
MNMC_LEPCP      LAQARGGRVRLDAHR-----------HQPRCVDDRSGLYLCTGLGSRGITSAALAGRLLA
MNMC_METPP      LDRTS----RADQPR-----------FVPRQRDARGGLYVFTGLGSRGITWAALGGQLLA
MNMC_BORBR      -------------------------------LAHAPGLWLAAGYASRGLSWAALMGDVIA
MNMC_BORPA      -------------------------------LAHAPGLWLAAGYASRGLSWAALMGDVIA
MNMC_BORPD      -------------------------------LGHAPGVWLAAGYASRGLSWSALAGDLIA
MNMC_BORA1      -------------------------------LPGVSGVWLASAYGSRGLSWSALAGDVIA
MNMC_AZOSB      LAAPC----------------------ALAEIPRHTGLYALSGFGARGLVWATLAAETLA
MNMC_AROAE      ADRAT----------------------PLAQIPRHPGLYAVAGFGARGLVWASLAAELLA
MNMC_DECAR      ATPNT----------------------RLHNIPRQPGLWCVQGFGARGIVWSALMADLLV
MNMC_THIDA      ----------------------------------QPGLYVAAGYASRGVVWAGLLGEALA
MNMC_ACIAC      ------------------------------DAARQAGLWVCAAMGARGLTLSQLCGELLA
MNMC_ACISJ      ------------------------------DSVRQPGLWLCTAMGARGLTLSLLCGELIA
MNMC_DELAS      ------------------------------SDQ-APGLWALTAMGSRGLTLSLLCGELLA
MNMC_POLNA      ------------------------------PLENAQDVWVCSGMGSRGLTFAALCAELLA
MNMC_POLSJ      ------------------------------PLA-APNLWVCSGMGSRGLTFAALCAELLA
MNMC_MAGMM      YRTNYAT-LYQGKRV-----------SLAKPAVYIDGLYLIGGLGSRGLLTAPLFGACMA
MNMC_LEPBJ      FQETYKEIDLPRNRN-----------KKFPNLKVIPGLYVFGGLGSRGILSSFLGAEILA
MNMC_LEPBL      FQETYKEIDLPRNRN-----------KKFPNLKVIPGLYVFGGLGSRGILSSFLGAEILA
MNMC_LEPIN      FRKIYKEIDLPKNRN-----------KKFPNLKTIQGLYVFGGLGSRGILSSFLGSEIMA
MNMC_LEPIC      FRKIYKEIDLPKNRN-----------KKFPNLKTIQGLYVFGGLGSRGILSSFLGSEIMA
MNMC_MARMS      YQQAYSTLTKNAKWQ-----------S-NEIAEPIKQLYINIGHGSRGLISTPLSGSYIA
MNMC_HYDCU      MKTAYFEQSHTHAVY-----------R-YAEQRYQPGLYVSNGHGARGLMSVFLAAEMIG
MNMC_CAMJJ      YKEEYKALL-WTKNK-----------EQKL-AKMSCNLYFNFAHGSRGFSTSVLAARYLC
MNMC_CAMJ8      YKEEYKALL-WTKNK-----------EQKL-AKISCNLYFNFAHGSRGFSTSVLAARYLC
MNMC_CAMJR      YKEEYKALL-WTKNK-----------EQKP-AKMSCNLYFNFAHGSRGFSTSVLAARYLC
MNMC_CAMJE      YKEEYKALL-WTKNK-----------EQKP-AKMSCNLYFNFAHGSRGFSTSVLAARYLC
MNMC_CAMJD      YKEEYKALL-WTKDK-----------EQKP-AKMSCNLYFNFAHGSRGFSTSVLAARYLC
MNMC_CAMC1      YKQNYKGLF-WSKNK-----------DNNPKASYEKNVFVNFAHGSRGLGTAILGANLIT
MNMC_CAMHC      FKEKYKILP-WQKNR-----------AKNLPPKYLKNIYINTSHGARGLCTAILGAEILA
MNMC_CAMFF      FKKIYKSLL-WTKHS-----------KNNEFAVHHENILISSAHGSRGLGTAIFGAEILL
MNMC_LEGPA      FKEIYSELK-SNSKR-----------WIAEAAPCYPNLYVCAAFGSRGLTTIPLATEWLA
MNMC_LEGPH      FKEIYSELK-SNSKR-----------WIAEAAPCYPNLYVCAAFGSRGLTTIPLATEWLA
MNMC_LEGPL      FKEIYSELK-SNSKR-----------WIAEAAPCYPNLYVCAAFGSRGLTTIPLATEWLA
MNMC_LEGPC      FKEVYSELK-SNSKR-----------WIAEAAPCYPNLYVCAAFGSRGLTTIPLATEWLA
MNMC_ACIBT      ----------------------------------ESRISTFAGLGSKGFLFAPLCSEVLV
MNMC_ACIBY      ----------------------------------ESRISTFAGLGSKGFLFAPLCSEVLV
MNMC_ACIBC      ----------------------------------ESRISTFAGLGSKGFLFAPLCSEVLV
MNMC_ACIAD      ----------------------------------HSKLFTLAGLGSKGYLFAPLNSEILV
MNMC_PSYA2      ----------------------------------SQRLWTLSAMGAKGYALAPICAEALA
MNMC_PSYCK      ----------------------------------SQRLWSMSAMGAKGYAIAPICAEALA
MNMC_PSYWF      ----------------------------------QGLIWTLSGMGSKGYAFAPLCAQVLA
MNMC_PSEAE      FDEAYAVLA-RDARQ-----------VPERACPWLPGLYLNSGHGSRGLISAPLSGELLA
MNMC_PSEAB      FDEAYAVLA-RDARQ-----------VPERACPWLPGLYLNSGHGSRGLISAPLSGELLA
MNMC_PSEA7      FDEAYAVLA-RDARQ-----------VPERACPWLPGLYLNSGHGSRGLISAPLSGELLA
MNMC_PSEMY      FNQAYAVLA-KDARQ-----------VPETPCPWLDGLYINSGHGSRGLITAPLSGELIA
MNMC_PSEP1      FAEAYAVLG-RDARQ-----------VPDVPCPWLGGLYVNSGHGSRGLITAPLSGELVA
MNMC_PSEPK      FAEAYAVLG-RDARQ-----------VPDVPCPWLGGLYVNSGHGSRGLITAPLSGELVA
MNMC_PSEPG      FAEAYAVLG-RDARQ-----------VPDVACPWLGGLYVNSGHGSRGLITAPLSGELVA
MNMC_PSEPW      FAEAYAVLA-KDARQ-----------VPEVPCPWLEGLYVNSGHGSRGLITAPLSGELIA
MNMC_PSEE4      FNTTYAMLA-KDARQ-----------VPDIACPWLDGLYVNSGHGSRGLITAPLSGELIA
MNMC_PSEF5      FAETYAALG-KDARQ-----------VPDLPCPWLDGLYINSGHGSRGLITAPLSGELLA
MNMC_PSEPF      FTRIYAALS-KDARQ-----------VPDMPCPWLDGLYVNSGHGSRGLITAPLSGELLA
MNMC_PSE14      FLQAYAALG-KDARQ-----------VPNIACPWLDGLYVNSGHGSRGLITAPLCGELIA
MNMC_PSEU2      FMQAYAALG-KDARQ-----------VPDITCPWLDGLYVNSGHGSRGLITAPLCGELIA
MNMC_PSESM      FVQAYAALG-KDARQ-----------VPDIACPWLDGLYVNSGHGSRGLITAPLCAELIA
MNMC_PSEU5      FAEAYAALA-RNARQ-----------SVQAVCPWLDGLYVNTAHGSRGMISAPLSGELLA
MNMC_CHRVO      FVHAYRELA-RDATL-----------RPATACPWAEGLYVNAAHGSRGLITAPLSGEILA
MNMC_METFK      LEARPPRYT-AD---------------PASSLPWLPGLYVNTGHGSKGLTTAPIAAEMLA
MNMC_NITMU      -----------------------------------PGLYTSLGHGTRGLITAGISAELVA
MNMC_CHRSD      WLDDYAVLG-ADARR-----------VPSTAGRHHPGLWVSAAHGSRGLASAPLCAEVIA
MNMC_HAHCH      ---------------------------------GGKGLLIVTAMGSKGLALAPLAGELVA
MNMC_MARN8      I--------------------------------SRTGVYLLTGLGSKGLVWAPLLAEYLA
MNMC_IDILO      -----------------------------------ENLYVITALGSRGFTSAPILAEVIA
MNMC_PSEA6      QKKELSDLY-KALPL-----------SYYPKGSNMNNVFVLTGLGSRGLTTAPLMAEVLA
MNMC_PSET1      YLTAFANLR-LGKRY-----------QYQALSKKQQGLHIFTGFGARALCSAPLCSEHLI
MNMC_COLP3      HVATYSHLA-KDKNW-----------KYSQAAPCIDNLYVLLGLGARGLCSAPLAADILT
MNMC_SHEB5      ILKDYEQHQLTKE---------SRHYWQTTPAPLHQGLYILGGLGSRGLSSGPLAAECLA
MNMC_SHEB9      ILEDYEQHQLTKE---------SRHYWQTTPAPVHQGLYILGGLGSRGLSSGPLAAECLA
MNMC_SHEB8      IIKDYAQHQLTKE---------SRHYWQTTPAPVHQGLYILGGLGSRGLSSGPLAAECLA
MNMC_SHEPC      IIKDYAEHQLTKE---------SRHYWQTTPAPVHEGLYILGGLGSRGLSSGPLAAECLA
MNMC_SHESW      IIKDYAQHQLTKE---------SRHYWQTTPAPVHEGLYILGGLGSRGLSSGPLAAECLA
MNMC_SHESM      ILARYEQHQLNQQQAE-----QSKHYWQTTPAPILDGLYILGGLGSRGLSSGPLAAECLA
MNMC_SHESR      ILARYELHQLNQQQAE-----QSKHYWQTTPAPILDGLYILGGLGSRGLSSGPLAAECLA
MNMC_SHESA      ILARYELHQLNQQQAE-----QSKHYWQTTPAPILDGLYILGGLGSRGLSSGPLAAECLA
MNMC_SHEON      IWARYEQHQINQQQAE-----QIRHYWQTTPAPIHDGLYILGGLGSRGLSSGPLAAECLA
MNMC_SHEDO      IISRYQTLNASPQASQNNYAKQCQQYWQQTPAPVHHNLFVLGGLGSRGLSSAPLAAECLA
MNMC_SHEFN      LFTRYAVQQQSKDKPS-----LWQHYWQTTPAPIYDGLYVLGGLGSRGLSSGPLVAECLA
MNMC_SHESH      MLAQYEQHQHTK---------ESIKFWKETPAPTHKGLFILGGLGSRGLTSGPLAAEALA
MNMC_SHEWM      ISLNYQNHQHTK---------ESIKYWRETPAPIHQGLFILGGLGSRGITSGPLAAEALA
MNMC_SHELP      ISATYISHQQTKKSTK-----ESAKCWQTTSAPVHQGLFILGGLGSRGLTSGPLAAEILA
MNMC_SHEAM      IQTQYQAIGHGPK---------GAQYWQTHAAPVHPGLYIFSGLGSRGLSSGPLIAECLA
MNMC_SACD2      FCERFAGYRKRAATP------------IPQTGPYYRGLYVSVGYGSRGLAYTPLATESLC
MNMC_DICNV      VYQRYQKWSKDRN------------IPINEEIDYYPQLYMHSGLGSKGTLTAFLGAKILA
                                                     :      . :.          : 

MNMC_ECOLI      AQMSDEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_ECODH      AQMSDEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_SHIB3      AQMSDEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_SHIBS      AQMSDEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_ECOLC      AQMSDEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_ECOHS      AQMSDEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_SHIFL      AQMSDEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_SHIF8      AQMSDEPNPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_SHISS      AQMSDEPIPMDASTLTALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_ECO57      AQMSDEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_SHIDS      AQMSEEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_ECOK1      AQMSEEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_ECOUT      AQMSEEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_ECOL6      AQMSEEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_ECOL5      AQMSEEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_ECOSM      AQMSEEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_ECO24      AQMSDEPIPMDASTLAALNPNRLWVRKLLKGKAVKAG----------------------
MNMC_CITK8      AQMSEEPIPMDADTLAALNPNRLWVRKLLKGKAVK------------------------
MNMC_SALPA      AQMSNEPIPLDASTLAALNPNRLWVRKLLKGKAVK------------------------
MNMC_SALTY      AQMSNEPIPLDAGTLAALNPNRLWVRKLLKGKAVK------------------------
MNMC_SALPB      AQMSNEPIPLDASTLAALNPNRLWVRKLLKGKAVK------------------------
MNMC_SALCH      AQMSNEPIPLDAGTLAALNPNRLWVRKLLKGKAVK------------------------
MNMC_SALTI      AQMSNEPIPLDAGTLAALNPNRLWVRKLLKGKAVK------------------------
MNMC_SALAR      AQMSNEPIPLDASTLAALNPNRLWVRKLLKGKAVK------------------------
MNMC_ENT38      SQMSEEPIPMDSTTLAGLSPNRLWVRKLLKGKAVK------------------------
MNMC_KLEP7      AQMSAEPLPLDSDTLAALNPNRLWVRKLLKGKAVK------------------------
MNMC_CROS8      SQMSGEPLPLDGATLAALNPNRLWVRKLLKGRAAS------------------------
MNMC_YERPG      AQMFGEPLPLDAKTLAALNPNRFWIRKLLKGRPVQTRSPATQESSR-------------
MNMC_YERPY      AQMFGEPLPLDAKTLAALNPNRFWIRKLLKGRPVQTRSPATQESSR-------------
MNMC_YERPE      AQMFGEPLPLDAKTLAALNPNRFWIRKLLKGRPVQTRSPATQESSR-------------
MNMC_YERPA      AQMFGEPLPLDAKTLAALNPNRFWIRKLLKGRPVQTRSPATQESSR-------------
MNMC_YERPN      AQMFGEPLPLDAKTLAALNPNRFWIRKLLKGRPVQTRSPATQESSR-------------
MNMC_YERPP      AQMFGEPLPLDAKTLAALNPNRFWIRKLLKGRPVQTRSPATQESSR-------------
MNMC_YERPS      AQMFGEPLPLDAKTLAALNPNRFWIKKLLKGRPVQTRSPATQESSR-------------
MNMC_YERPB      AQMFGEPLPLDAKTLAALNPNRFWIKKLLKGRPVQTRSPATQESSR-------------
MNMC_YERP3      AQMFGEPLPLDAKTLAALNPNRFWIRKLLKGRPVQTRSPATQESSR-------------
MNMC_YERE8      AQMFGEPQPLDTTTLAALNPNRFWIRKLLKGRPVQQRVSVLS-----------------
MNMC_SERP5      AQLFGEPLPGDADMLAALNPNRMWVRKLLKGRAV-------------------------
MNMC_PECAS      SQMYAEPLPLDRDTLAALNPNRFWIRKLLKGKPVTHD----------------------
MNMC_PHOLL      GQIFDEPLPLDNEILATLHPNRFWIKKLLKGRKLKIEKP--------------------
MNMC_VIBCH      SQMCGDPMPLGVDLLEQLHPSRMWVRKLRKGKALTQKV---------------------
MNMC_VIBC3      SQMCGDPMPLGVDLLEQLHPSRMWVRKLRKGKALTQKV---------------------
MNMC_VIBCB      SQICGDPLPLPVDVLTELHPSRMWVRKLRKGKAITEL----------------------
MNMC_VIBPA      SQICGDPLPLPVDVLTELHPSRMWVRKLRKGKAITEL----------------------
MNMC_VIBVU      SQICNDPLPLPVDVLEELHPSRMWVRKLRKGKAITEL----------------------
MNMC_VIBVY      SQICNDPLPLPVDVLEELHPSRMWVRKLRKGKAITEL----------------------
MNMC_ALIF1      SQIMGDPIPLPNSVLEGLHPGRLWVRRLLKGKPLDI-----------------------
MNMC_PHOPR      SQICGDPLPLPHTVLNALHPGRMWVRRLVRGKQLGSKS---------------------
MNMC_AERHH      SEICGDPLPLAADLLEALHPARYWVRKLLKGKPLQ------------------------
MNMC_AERS4      SEICGDPLPLATDLLEALHPARYWIRKLLKGKPLN------------------------
MNMC_PSYIN      SQINKEPLPFAKEILNAMQINRQWINYLKKGKPLHY-----------------------
MNMC_ACTPJ      SLICDEPLPISEDIWHVLSPNRTWIRKLLKGSKVE------------------------
MNMC_ACTP2      SLICDEPLPISEDIWHVLSPNRTWIRKLLKGSKVE------------------------
MNMC_HAEDU      SLIVNEPIPISQDIWHALLPNRTWLRKWLKGSKVV------------------------
MNMC_HAEIN      SIIYGEPLPISEGILHNLSANRAWVKKWLKGSKVE------------------------
MNMC_HAEIG      SILYGEPLPISEGILHNLSANRAWVKKWLKGSKVE------------------------
MNMC_HAEI8      SIIYGEPLPISEGILHNLSANRAWVKKWLKGSKVE------------------------
MNMC_HAEIE      SIIYGEPLPISEGILHNLSANRAWVKKWLKGSKVE------------------------
MNMC_HAES1      SLIYAEPLPLSEDILHNLSPNRSWIRKLLKGTEIK------------------------
MNMC_HISS2      SLIYAEPLPLSEDILHNLSPNRSWIRKLLKGTEIK------------------------
MNMC_PASMU      SLIYHEPLPLSEDILHQLNANRSWIRKLLKGSQVKQG----------------------
MNMC_MANSM      SMIYGEPIPLSEDILHCLNPNRSWMRKLLKGTPVK------------------------
MNMC_ACTSZ      SLIYGEPLPLSEDIIHALCPNRSWMRKLLKGTPVK------------------------
MNMC_CAUVC      ARLLDVPSPLPRQLSHLLKLTRFDSPVTRSRL---------------------------
MNMC_CAUSK      ARILALPSPLPRPLSALVEPGRFSSRVATGAV---------------------------
MNMC_MARMM      SELMGGVPALAQTGREAMAPGRFAERRSRRAGQGAAG----------------------
MNMC_HYPNA      AKLCNGPPPADLNSLRAVDPARQILRRLRKTGRL-------------------------
MNMC_CUPNH      SQIEGEPLPLESDLADAMDPARLLLRALRHGHTG-------------------------
MNMC_CUPPJ      SQIEGDPLPLEADLVDAIDPARLLLRALRHGQVGREEGHSSGLSG--------------
MNMC_CUPMC      SQIEGEPLPLEADLADAIDPARLLLRALRHGHAQAPESAGPGVDAAG------------
MNMC_RALSO      AQIDGGPLPLESELAAALDPGRFLMRALRHGKHAA------------------------
MNMC_BURCM      SQLEGEPLPLERELVDAVDPARFLIRALRGRQIG-------------------------
MNMC_BURA4      SQLEGEPLPLERELVDAVDPARFLIRALRGRQIG-------------------------
MNMC_BURCA      SQLEGEPWPLERELADAVDPARFLIRALRARRVGSAG----------------------
MNMC_BURCH      SQLEGEPWPLERELADAVDPARFLIRALRARRVGSAG----------------------
MNMC_BURCC      SQLEGEPWPLERELADAVDPARFLIRALRARRVGSAG----------------------
MNMC_BURL3      SQLEGEPWPLERELADAVDPARFLIRALRARRVGRAG----------------------
MNMC_BURVG      SQLEGEPLPLERELVDAVDPARFLIRALRGRKLG-------------------------
MNMC_BURM1      SQLDGEPWPIERELAEAVDPARFLIRALRARQVSAAD----------------------
MNMC_BURMA      AQIDGEPWPLERELAEAIDPARFLVRALRHGRVA-------------------------
MNMC_BURM9      AQIDGEPWPLERELAEAIDPARFLVRALRHGRVA-------------------------
MNMC_BURM7      AQIDGEPWPLERELAEAIDPARFLVRALRHGRVA-------------------------
MNMC_BURP0      AQIDGEPWPLERELAEAIDPARFLVRALRHGRVA-------------------------
MNMC_BURP1      AQIDGEPWPLERELAEAIDPARFLVRALRHGRVA-------------------------
MNMC_BURPS      AQIDGEPWPLERELAEAIDPARFLVRALRHGRVA-------------------------
MNMC_BURMS      AQIDGEPWPLERELAEAIDPARFLVRALRHGRVA-------------------------
MNMC_BURP6      AQIDGEPWPLERELAEAIDPARFLVRALRHGRVA-------------------------
MNMC_BURTA      AQIEGEPWPLERELAEAIDPARFLIRALRRGRVA-------------------------
MNMC_PARPJ      SQLEGEPWPLERDLAEDIDPARFLLRALRQGAVS-------------------------
MNMC_PARXL      SQLEGEPWPLERDLAEDIDPARFLLRALRQGTVS-------------------------
MNMC_PARP8      SQIEGEPWPIERDLAEALDPARFLLRALRQGTAS-------------------------
MNMC_LEPCP      AWVSGAPAPVDADLRNALDPARLSK----------------------------------
MNMC_METPP      SWISGAPCPLEADLRDALDPARYALPRWRSDS---------------------------
MNMC_BORBR      ARLCGEPGPLETDLLAQIAPR--------------------------------------
MNMC_BORPA      ARLCGEPGPLETDLLAQIAPR--------------------------------------
MNMC_BORPD      ACLHGEPLPLPADLLAAVAPR--------------------------------------
MNMC_BORA1      ARLCGEPLPLETDLLASVGPR--------------------------------------
MNMC_AZOSB      SQLDGEPLPLERDLVDALDPARFLLRPARTLRGED------------------------
MNMC_AROAE      SHIAGEPLPLERELVDALDPARYLLRPARGMTREG------------------------
MNMC_DECAR      SQLEGEPLPLERDLVDALDPGRFLIKAARNSGGELPSDEETSEPAA-------------
MNMC_THIDA      DLITGQPLPLEAELMRGIAPARFAGNRKTA-----------------------------
MNMC_ACIAC      ARMMGEPLPVEVRLARALSTERLPAD---------------------------------
MNMC_ACISJ      ARLHSEPLPLDAPLARALSSERWLGYEPQ------------------------------
MNMC_DELAS      ARLHDEPLPLDARLAAALASERLGRRR--------------------------------
MNMC_POLNA      ARLHGEPLPVELRQADALLPQYATRLQPSGS----------------------------
MNMC_POLSJ      ARLHAEPLPLEQRLAEALRPQYGEAKLVSED----------------------------
MNMC_MAGMM      ALLSGGPLPLEADLWCAVHPARLLVRSLKKPPL--------------------------
MNMC_LEPBJ      SLILGEPAPVEFSLLESLHPARFLYRRIRK-----------------------------
MNMC_LEPBL      SLILGEPAPVEFSLLESLHPARFLYRRIRK-----------------------------
MNMC_LEPIN      SLILGEPVPVESSVLEHLHPARFLYRKVRK-----------------------------
MNMC_LEPIC      SLILGEPVPVESSVLEYLHPARFLYRKVRK-----------------------------
MNMC_MARMS      SLITGTPSPLEQKVSHKLHPSRFIIRDLKRSQIL-------------------------
MNMC_HYDCU      AMVTGDAQVMPKSLYHAVHPARFAIRHWRSGKR--------------------------
MNMC_CAMJJ      ALINNEPLCLEKKYIHAIHPARFLIRKLKKGL---------------------------
MNMC_CAMJ8      ALINNEPLYLEKKYIHAIHPARFLIRKLKKGL---------------------------
MNMC_CAMJR      ALINNEPLCLEKKYIHAIHPARFLIRKLKKGL---------------------------
MNMC_CAMJE      ALINNEPLCLEKKYIHAIHPARFLIRKLKKGL---------------------------
MNMC_CAMJD      ALINNEPLCLEKKYIHAIHPARFLVRKLKKGL---------------------------
MNMC_CAMC1      DLVLARPLCIERSLFFELHPARFLIRKLKKGLK--------------------------
MNMC_CAMHC      DLVTNRPFCLPKSLINELAPSRFLIRKLKKGLK--------------------------
MNMC_CAMFF      DIALNRPVCTTNSILNSLNPARFLVRKLKRGLVR-------------------------
MNMC_LEGPA      GLINKEISILPRKLIQAISPSRFLRKKIIQGP---------------------------
MNMC_LEGPH      GLINKEISILPRKLIQAISPARFLRKKIIQGP---------------------------
MNMC_LEGPL      GLINREISILPRKLIQAISPARFLRKKIIQGP---------------------------
MNMC_LEGPC      GLINKEISILPRKLIQAISPARFLRKKIIQGP---------------------------
MNMC_ACIBT      AQILGEACPVPKSLLQKLDAQRFQKKVKPKKPYFKSQ----------------------
MNMC_ACIBY      AQILGEAYPVPKSLLQKLDAQRFQKKVKPKKPYFKSQ----------------------
MNMC_ACIBC      AQILGEACPVPKSLLQKLDAQRFQKKVKPKKPYFKSQ----------------------
MNMC_ACIAD      AHILGEACPVSANLLQKLNPQRFLKKVKIKKPYYSS-----------------------
MNMC_PSYA2      DMMLGCFTPLSAVTLARLSPNRARLHKVQKSHKRSL-----------------------
MNMC_PSYCK      DMMLGCFTPLSAAMLARLSPNRARLHKVHKHKTRQAVI---------------------
MNMC_PSYWF      DMMTAQFVPLPAALLAKLSVHRSSLKKPLS-----------------------------
MNMC_PSEAE      AWICGEPLPLPRAVAEACHPNRFLLR-----DLVRGQRG--------------------
MNMC_PSEAB      AWICGEPLPLPRAVAEACHPNRFLLR-----DLVRGQRG--------------------
MNMC_PSEA7      AWICGEPLPLPRAVGEACHPNRFLLR-----DLVRGQRG--------------------
MNMC_PSEMY      AWLEDEPLPLPREVAEACHPNRFMLR-----QLIRGTGSPT------------------
MNMC_PSEP1      AWVCGEPLPLPRAVAQACHPNRFGLR-----RLIRGK----------------------
MNMC_PSEPK      AWVCGEPLPLPRAVAQACHPNRFGLR-----RLIRGK----------------------
MNMC_PSEPG      AWVCGEPLPLPRAVAEACHPNRFALR-----RLIRGK----------------------
MNMC_PSEPW      AWVSGEPLPLPRAVAEACHPNRFGLR-----RLIRGK----------------------
MNMC_PSEE4      AWACGEPLPVPRAVAEACHPNRFALR-----RLIRGK----------------------
MNMC_PSEF5      AWLENEPLPLPRSVAEACHPNRFALR-----RLIRGKA---------------------
MNMC_PSEPF      AWLDNEPLPLPRSVAEACHPNRFALR-----RLIRGK----------------------
MNMC_PSE14      AWVDNEPLPLPRSVAEACHPNRFALR-----GLIRGGGK--------------------
MNMC_PSEU2      AWLDNEPLPLPRSVAEACHPNRFALR-----GLIRGKGKQTVGH---------------
MNMC_PSESM      AWLDNEPLPLPRSVAEACHPNRFALR-----GLIRGGGK--------------------
MNMC_PSEU5      AWLDDEPLPLPREVAEACHPNRFLLR-----KLIRGT----------------------
MNMC_CHRVO      SLLEGEPAPLPADLMRAVHPSRFLLR-----DLIRRKLDPDAL----------------
MNMC_METFK      CAIHHEPAPVDSELLAVLDPNRFVLRKLGLKRLVRGLACHPLRR---------------
MNMC_NITMU      ATACGQLLPLPLSVVNALSPVRRASP--AIPVSIKG-----------------------
MNMC_CHRSD      SRLCDEPLPLERELIDHLHPGRRLIADIIRGNATRGNATLSTSSPNDDAQPSPTTTETP
MNMC_HAHCH      DMLEGTPAPIEDSLVQRVLPNRFSQE---------------------------------
MNMC_MARN8      DRICQQPACLNTRLARRVETGRLYRNQLTV-----------------------------
MNMC_IDILO      CQLTGELTPLTQDALRRISVSRFKG----------------------------------
MNMC_PSEA6      SQISGQPLPMANDLLNTLNPNRFLIRQLIRREV--------------------------
MNMC_PSET1      SSLNNEPRPLSERVSQAIHPARFIVRDLIRNKI--------------------------
MNMC_COLP3      AELCNTPYPVDSQMLFNLSPNRFIIRDIIKRKIKS------------------------
MNMC_SHEB5      AQLCGEPIPLDKETLCKLNPNRMWLRKLLKGKAL-------------------------
MNMC_SHEB9      AQLCGEPIPLDKETLCKLNPNRMWLRKLLKGKAL-------------------------
MNMC_SHEB8      AQLCGEPIPLDKATLCKLNPNRMWLRKLLKGKAL-------------------------
MNMC_SHEPC      AQLCGEPIPLDKATLCKLNPNRMWLRKLLKGKAL-------------------------
MNMC_SHESW      AQLCSEPIPLDKATLCKLNPNRMWLRKLLKGKSL-------------------------
MNMC_SHESM      AQLTGEPLPLDWPTLNKLNPNRMWLRKLLKGKAL-------------------------
MNMC_SHESR      AQLTGEPLPLDWPTLNKLNPNRMWLRKLLKGKAL-------------------------
MNMC_SHESA      AQLTGEPLPLDWSTLNKLNPNRMWLRKLLKGKAL-------------------------
MNMC_SHEON      AQLTDEPLPLDWPTLNKLSPNRMWLRKLLKGKAL-------------------------
MNMC_SHEDO      AQLCGEIAPISATTLALLNPNRMWMRKLLKGKALC------------------------
MNMC_SHEFN      ANLCGELSPLSVELQALLSPNRMWLRKLLKGKALM------------------------
MNMC_SHESH      AQLCGEVIPLSMPMLEMLNPNRFWMRKLIKGKAL-------------------------
MNMC_SHEWM      AQLCGEIIPLDNATLELLNPNRMWMRKLIKGKAL-------------------------
MNMC_SHELP      AQLCGELLPATQDILALLNPNRMWMRKLIKGKAL-------------------------
MNMC_SHEAM      DSLSGTLPVLDGDVMEALNPNRMWLRKLKKGKALD------------------------
MNMC_SACD2      HSIFGELQPIATETLLHLHPARFLFRDLTRNRI--------------------------
MNMC_DICNV      AMMLGDPLPIDRKLLTSIVPTRFLVKDIIRGHLNN------------------------