CLUSTAL format seed alignment for MF_01105

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ARGA_BUCAI      --------------MKERNTELVQGFRHSVPYINAHRGKTFVIMLGGEAIKYGNFYSIIN
ARGA_BUCAP      --------------MRERTTELVQGFRHSVPYINAHRGKKFVIMLSGEAIKYGNFSGIIN
ARGA_ECOLI      -------------MVKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVN
ARGA_SHIFL      -------------MVKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVN
ARGA_SALTI      -------------MIKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHDNFSSIVS
ARGA_SALTY      -------------MIKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHDNFSSIVS
ARGA_YERPE      --------------MKERSTELVQGFRHSVPYINAHRGKTFVVMLGGEAIEHENFSSIVN
ARGA_VIBCH      --------------MKIRSTALVKGFRQSAPYVNAHRGKTMVVMLGGEAIADKNFPNIIS
ARGA_VIBVU      --------------MKIRSTALVKGFRQSTPYVNAHRGKTMVILLGGEAIADKNFSNIIN
ARGA_SHEON      ----------MRCKQRVRTTELVDGFRHSAPYVNAHRGKTFVVMLGGEALAQNQFRGILN
ARGA_PASMU      ----------------MRSTELVHWFRQSTPYVNMHRGKTFVIMLDGDTIACPNFVNIIN
ARGA_PSEAE      ------------------MPDYVNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVH
ARGA_PSEPK      ------------------MPDYVNWLRHASPYINAHRDCTFVVMLPGDGVEHPNFGNIVH
ARGA_RALSO      MAHTPATADVAPIPPTPEQQQFVDWLRAVAPYIHAFRDKTFVIGFGGELVKAGMLGALVN
ARGA_NEIMA      ---------------MIVPDLFVAHFREAAPYIRQMRGKTLVAGIDDRLLEGDTLNKFAA
ARGA_NEIMB      ---------------MSAPDLFVAHFREAVPYIRQMRGKTLVAGIDDRLLEGDTLNKLAA
                                      *  :*   **:.  *. .:*  : .  :    :  :  

ARGA_BUCAI      DIGLLHSLGIRLVVVYGACPQINTSLKEKNIKIIYHKSIRITDLASLEQVKQAAGKLQLD
ARGA_BUCAP      DIGLLHSLGIRLIVVYGSCPQINANLKEKNIKITYHKYIRVTDLLSLEQVKQAAGRLQLD
ARGA_ECOLI      DIGLLHSLGIRLVVVYGARPQIDANLAAHHHEPLYHKNIRVTDAKTLELVKQAAGTLQLD
ARGA_SHIFL      DIGLLHSLGIRLVVVYGARPQIDANLAAHHHEPLYHKNIRVTDAKTLELVKQAAGTLQLD
ARGA_SALTI      DIGLLHSLGIRLVVVYGARPQIDANLAAHHHEPIYHKNTRVTDAKTLELVKQAAGLLQLD
ARGA_SALTY      DIGLLHSLGIRLVVVYGARPQIDANLAAHHHEPIYHKNTRVTDAKALELVKQAAGLLQLD
ARGA_YERPE      DIGLLHSLGIRLVVVYGARPQIDSNLADHNYEPIYHKHTRVTDARTLEMVKQAAGLLQLD
ARGA_VIBCH      DIALLHSLGVKVVLVHGARPQINQILEKNQRDTPYHKGVRITDESSLGLVMQAAGQLQHA
ARGA_VIBVU      DIALMHSLGVKVVLVYGARPQINQLLDKQSSQTPYHKHIRVTDENSLSIVMQAAGQLQLA
ARGA_SHEON      DVALLHSLGIKVVLVYGARPQIDAALAANGIEPAYHDGVRITDEDSLKVIKQVAGALQFD
ARGA_PASMU      DISLLHSLGIKLVLVFGARYQINELLQQHQIESVYHKNIRITDLTSLELVKQAVGKLNYD
ARGA_PSEAE      DLVLLHSLGARLVLVHGSRPQIEARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIA
ARGA_PSEPK      DLVLLHSLGVRLVLVHGSRPQIESRLADRGLTPHYHRGMRITDAATLDCVIDAVGALRLA
ARGA_RALSO      DIALLHAMGMHIVLVHGSRPQVEEQLALRHVQTQFVDGIRVTDNAALESAKEASGELRLD
ARGA_NEIMA      DIGLLSQLGIRLVLIHGARHFLDRHAAAQGRTPHYCRGLRVTDETSLEQAQQFAGTVRSR
ARGA_NEIMB      DIGLLSQLGIRLVLIHGARHFLDRHAAAQGRTPHYCRGLRVTDETSLEQAQQFAGTVRSR
                *: *:  :* :::::.*:   ::     .     :    *:**  :*    :  * :.  

ARGA_BUCAI      ITARLSMSLTNTPLQGANISVVSGNFIISQPLGVDDGVDYCHSGRVRRIDKNAINCQLNN
ARGA_BUCAP      ITARLSMSLSNTPLQGANINVVSGNFIIAQPLGVDDGIDYCHSGRIRRIDKKAINCQLEN
ARGA_ECOLI      ITARLSMSLNNTPLQGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEDAIHRQLDS
ARGA_SHIFL      ITARLSMSLNNTPLQGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEDALHRQLES
ARGA_SALTI      ITARLSMSLNNTPLQGAHINVVSGNFTIAQPLGVDDGVDYCHSGRIRRIDEDAINRQLDN
ARGA_SALTY      ITARLSMSLNNTPLQGAHINVVSGNFTIAQPLGVDDGVDYCHSGRIRRIDEDAINRQLDN
ARGA_YERPE      ITARLSMSLNNTPLQGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEEAIHRQLDN
ARGA_VIBCH      ITARLSMSLNNTPMAGTQLNVVSGNFIISQPLGIDEGVDYCHSGRIRRIDVEGINRMLDL
ARGA_VIBVU      ITASLSMSLNNTPMAGTHLNVVSGNFVIAQPLGIDEGVDYCHSGRIRRIDTEAINRSLDQ
ARGA_SHEON      ITARLSMSLSNTPMQGAQINLVSGNFVIAQPLGVDNGVDFCLSGKVRRIDAQGLKRQLDN
ARGA_PASMU      IASRLSLRLPHSPL----IDVVSGNFVLAQPIGVDDGIDYQLSGKIRRINTESIQQQLDR
ARGA_PSEAE      IEARLSMDMAASPMQGARLRVAGGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDE
ARGA_PSEPK      IEARLSMDIAASPMQGSRLRVASGNLVTARPIGVLEGVDYHHTGEVRRVDRKGISRLLDE
ARGA_RALSO      IEATFSQALPNTPMAGARISVVSGNFVTARPVGIVNGVDFQHTGLVRKIDAESIQHSLSN
ARGA_NEIMA      FEAALCGSVSGFARAPS-VPLVSGNFLTARPIGVIDGTDMEYAGVIRKTDTAALRFQLDA
ARGA_NEIMB      FEAALCGSVSGFARAPS-VPLVSGNFLTARPIGVIDGTDMEYAGVIRKTDTAALRFQLDA
                : : :.  :   .     : :..**:  ::*:*: :* *   :* :*: :  .:   *. 

ARGA_BUCAI      GAIVLIGPVAVSVTGESFNLTSEEIATQVSIELKAEKMIGFCGNQGVINDEGKIISELLS
ARGA_BUCAP      GAIVLIGPVAVSVTGESFNLTSEEIATQVSIKLKAEKMIGFCSKQGVIDSQGKTISELLP
ARGA_ECOLI      GAIVLMGPVAVSVTGESFNLTSEEIATQLAIKLKAEKMIGFCSSQGVTNDDGDIVSELFP
ARGA_SHIFL      GAIVLMGPVAVSVTGESFNLTSEEIATQLAIKLKAEKMIGFCSSQGVTNDDGDIVSELFP
ARGA_SALTI      GAIVLMGPVAVSVTGESFNLTSEEIATQLAVKLKAEKMIGFCSSQGVTNSEGGIISELFP
ARGA_SALTY      GAIVLMGPVAVSVTGESFNLTSEEIATQLAVKLKAEKMIGFCSSQGVTNSEGGIISELFP
ARGA_YERPE      GAIVLLGPVAVSVTGESFNLTSEEVATQLAIKLKAEKMIGFCSSQGVTDSEGNIISELFP
ARGA_VIBCH      GSIVLLGPIASSVTGECFNLLSEEVATQVAIKLKADKLIGFCPQQGIIDTKGNAIAELFP
ARGA_VIBVU      GSIVLLGPIASSVTGECFNLLSEEVATQVAIKLKADKLIGFCSEQGVIDEEGNAVAELFP
ARGA_SHEON      HCIVLMGPIAASVTGESFNLTAEEIATQVAIKLKADKMIGFSSQNGILDRNGDVIAELMP
ARGA_PASMU      DAIVLIGPIAPSVTGESFNLPFEEIASQLAIKLKAEKLIGFSATQGILDENNQTISDLLP
ARGA_PSEAE      RSIVLLSPLGYSPTGEIFNLACEDVAMRAAIDLEAEKLILYGAEQGLLDASGKLVRELRP
ARGA_PSEPK      RSIVLLSPLGYSPTGEIFNLACEDVATRAAIELGADKLLLFGAEPGLLDADGRLVRELRP
ARGA_RALSO      RKIVLLSPLGFSPTGQAFNLSMEDVATNTATALKADKLIFITEVPGIMDRVGKLQQELSM
ARGA_NEIMA      GNIVWLPPLGHSYSGKTFHLDMLQTAASVAVSLQAEKLVYLTLSDGISRPDGTLAVTLSA
ARGA_NEIMB      GNIVWLPPLGHSYSGKTFYLDMLQTAASAAVSLQAEKLVYLTLSDGISRPDGTLAETLSA
                  ** : *:. * :*: * *   : *   :  * *:*::      *:    .     *  

ARGA_BUCAI      NDIKNIIKKLEKKGD----YISSTVRFLKGSIKACKSGVNRSHLISYHKSGALLQELFSR
ARGA_BUCAP      NNIQNEIKKLEGKGD----YISSTIRFLRGSIKACKSGVNRSHLISYHKNGALLQELFSR
ARGA_ECOLI      NEAQARVEAQEEKGD----YNSGTVRFLRGAVKACRSGVRRCHLISYQEDGALLQELFSR
ARGA_SHIFL      NEAQARVEAQEEKGD----YNSGTVRFLRGAVKACRSGVRRCHLISYQEDGALLQELFSR
ARGA_SALTI      NEAQARVEELEAQGD----YNSGTVRFLRGAVKACRSGVRRCHLISYQEDGSLLQELFSR
ARGA_SALTY      NEAQARVEELEAQGD----YNSGTVRFLRGAVKACRSGVRRCHLISYQEDGSLLQELFSR
ARGA_YERPE      NDAQKRIEDLEQDGD----YNSGTVRFLRGAVKACRSGVRRSHLLSYQEDGALIQELFSR
ARGA_VIBCH      SDVERLVKSMEQECAPDDEECFSTMRFLRAALKACRAGVPRSHLVSYKEDGALIQELFSF
ARGA_VIBVU      SDAEKFIQKLSVDVDPDSDFHSGTLRFLKGAVAACRAGVPRSHLISYKIDGALIQELFSF
ARGA_SHEON      NDAQKILNKLAEQGS----ACIGTMAFLKASIDACRNGVPRCHLVSYLDDGALLQELFSR
ARGA_PASMU      QDAELYLAKLIQQNQ----YHSSQARFLQAAIEACRFGIKRSHLISYEEDGSLLQELFTR
ARGA_PSEAE      QQVPAHLQRLGNSYQ---------AELLDAAAQACRAGVKRSHIVSYTEDGALLSELFTR
ARGA_PSEPK      QQVAPHLQRLGSDYQ---------GELLDAAAEACKGGVARSHIVSYAEDGALLTELFTR
ARGA_RALSO      ESAIERLREGRLSAD--------TAYYLQHIVKAMRGGVRRAHLIPFALDGSILLELFLH
ARGA_NEIMA      QEAQSLAEHAGGETR----------RLISSAVAALEGGVHRVQILNGAADGSLLQELFTR
ARGA_NEIMB      QEAQSLAEHAGGETR----------RLISSAVAALEGGVHRVQILNGAADGSLLQELFTR
                ..          .              :     * . *: * :::    .*::: ***  

ARGA_BUCAI      DGIGTQMVMESAEKIRGASINDIGGILELIRPLEHKGILVRRSREQLEIEVDKFTIIEHD
ARGA_BUCAP      DGIGTQMVMESAEKIRQANINDIGGILELIRPLEKKGILVRRSREQLEMEVDKFTIIERD
ARGA_ECOLI      DGIGTQIVMESAEQIRRATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRD
ARGA_SHIFL      DGIGTQIVMESAEQIRRATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRD
ARGA_SALTI      DGIGTQIVMESAEQIRRATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRD
ARGA_SALTY      DGIGTQIVMESAEQIRRATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRD
ARGA_YERPE      DGIGTQIVMESAEQVRRATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIERD
ARGA_VIBCH      DGIGTQIVMASAEQIRQATIDDIGGIFDLIRPLEEQGILVRRSREQLEQEIHKFTIIDKD
ARGA_VIBVU      DGIGTQVVMASAEQVRQACIDDIGGILELIRPLEEQGILVRRSREQLEQEVERFTIIEKD
ARGA_SHEON      EGIGTQIVTESAERLRRASISDIGGILNLIRPLEEQGILVRRSREQLEIEIEQFMLIERD
ARGA_PASMU      DGVGTQLSMEHSETIRLATVSDIPALLELIRPLEQQGILVKRSREQLEMEINQYTIIDRD
ARGA_PSEAE      TGNGTLVAQEQFEQLREAGIEDVGGLIELIRPLEEQGILVRRSREVLEREIEQFSIVERE
ARGA_PSEPK      GGGGTLVSQEQFEVVREATIEDVGGLLELISPLEEQGILVRRSREVLEREIEQFSVVERE
ARGA_RALSO      DGVGTMVSHTDLEYLREATLDDVGGIVQLIEPLEADGTLVPRERRLLERDIANFSVIEHD
ARGA_NEIMA      NGIGTSIAKEAFVSIRQAHSGDIPHIAALIRPLEEQGILLHRSREYLENHISEFSILEHD
ARGA_NEIMB      NGIGTSIAKEAFVSIRQAHSGDIPHIAALIRPLEEQGILLHRSREYLENHISEFSILEHD
                 * ** :       :* *   *:  :  ** *** .* *: *.*. ** .: .: :::::

ARGA_BUCAI      NLTIACAALYPFFKEKIGEMACLAVHPDYRNSSRGDALLKKIKMNAKDMHLKRIFVLTTQ
ARGA_BUCAP      NLTIACAALYPFFKEKIGEMACVAVHPDYRNSSRGDLLLQTMKLNAKKLNLKKIFVLTTQ
ARGA_ECOLI      NTTIACAALYPFPEEKIGEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTR
ARGA_SHIFL      NTTIACAALYPFPEEKIGEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTR
ARGA_SALTI      NMTIACAALYPFVEEKIGEMACVAVHPDYRSSSRGEVLLERVAAQARQMGLRKLFVLTTR
ARGA_SALTY      NMTIACAALYPFVEEKIGEMACVAVHPDYRSSSRGEVLLERVAAQARQMGLRKLFVLTTR
ARGA_YERPE      NLTIACAALYPFPDEHIGEMACVAVHPDYRSSSRGEMLLNRITNQARQMGLKKLFVLTTR
ARGA_VIBCH      GLVIGCSALYPYPEERMAEMACVAIHPEYRDGHRGLHLLVHSKHQAKQMGIRHLFVLTTH
ARGA_VIBVU      GLIIGCAALYPYIDEHMAEMACVAIHPDYRDGNRGLLLLNYMKHRSKSIGIEQIFVLTTH
ARGA_SHEON      GLVIGCAALYPFEEDNAGEFACLVVHPDYRDADRGSLLLKNIIGQARSRGYSRLFALTTR
ARGA_PASMU      GVIIACAALNCYADEKMAEMACVAVHPDYRNSSRGDILLEAIQKRAKQLGIEKLFVLTTR
ARGA_PSEAE      GLIIACAALYPIADSEAGELACLAVNPEYRHGGRGDELLERIEERARGLGLKTLFVLTTR
ARGA_PSEPK      GMIIACAALYPIADSEAGELACLAVNPEYRHGGRGDELLERIESRARQMGLSTLFVLTTR
ARGA_RALSO      GIIFGCAALYPYPKEGVGEMACLTVAPDTQGTGDGERLLKHVEARARAVGLKRLFVLTTR
ARGA_NEIMA      GNLYGCAALKTFAEADCGEIACLAVSPQAQDGGYGERLLAHIIDKARGIGISRLFALSTN
ARGA_NEIMB      GNLYGCAALKTFAEADCGEIACLAVSPQAQDGGYGERLLAHIIDKARGIGISRLFALSTN
                .   .*:**    .   .*:**:.: *: :    *  **     .::      :*.*:*.

ARGA_BUCAI      SIHWFQERGFILVDIEVLPESKKKMYNYQ-RGSKILMIDVI----
ARGA_BUCAP      SIHWFQERGFILVDVEILPESKKKMYNYQ-RCSKILMIDLF----
ARGA_ECOLI      SIHWFQERGFTPVDIDLLPESKKQLYNYQ-RKSKVLMADLG----
ARGA_SHIFL      SIHWFQERGFTPVDIDLLPESKKQLYNYQ-RKSKVLMADLG----
ARGA_SALTI      SIHWFQERGFTPVDIELLPESKKKMYNYQ-RRSKVLMADLG----
ARGA_SALTY      SIHWFQERGFTPVDIELLPESKKKMYNYQ-RRSKVLMADLG----
ARGA_YERPE      SIHWFQERGFTPAEVDVLPIQKQELYNYQ-RRSKILLADL-----
ARGA_VIBCH      STHWFREQGFNEVDVEALPMAKKSLYNYQ-RRSKILMLQL-----
ARGA_VIBVU      SVHWFREQGFYEIGVDSLPMAKKSLYNYQ-RRSKILALPL-----
ARGA_SHEON      SIHWFLEHGFVIEDVDALPQKKKQLYNYQ-RRSKILALDL-----
ARGA_PASMU      TVHWFQERGFQLAEIADLPDKKRQHYNYQ-RRSKILIQALQNKKG
ARGA_PSEAE      TAHWFRERGFQPSSVERLPAARASLYNFQ-RNSQVFEKSL-----
ARGA_PSEPK      TAHWFRERGFAPSGVERLPAARASLYNYQ-RNSKIFEKPL-----
ARGA_RALSO      TEHWFLKRGFVHATVDDLPEDRRKLYNWQ-RRSMVLMKKL-----
ARGA_NEIMA      TGEWFAERGFQTASEDELPETRRKDYRSNGRNSHILVRRLHR---
ARGA_NEIMB      TGEWFAERGFQTASEDELPETRRKDYRSNGRNSHILVRRLHR---
                : .** ::**       **  : . *. : * * ::   :