CLUSTAL format seed alignment for MF_01106

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ARGJ_METAC       ------------------------------------------------MKKIEGGICA--
ARGJ_METMA       ------------------------------------------------MKQIEGGICA--
ARGJ_ARCFU       -----------------------------------------------------MEITD--
ARGJ_METJA       ------------------------------------------------MRVIDGGVTA--
ARGJ_METTH       -------------------------------------------MYTMELRFIRGGVCA--
ARGJ_METKA       -------------------------------------------------------MRA--
ARGJ_HELHP       ---------------------------------------------MFEIIPIKGGVNA--
ARGJ_COREF       --------------------------------------------------MAQTGITA--
ARGJ_CORGL       --------------------------------------------------MAEKGITA--
ARGJ_MYCLE       -------------------------------------MTKIVEIVNETRLLRAQGVTA--
ARGJ_MYCTU       ----------------------------------------MTDLAGTTRLLRAQGVTA--
ARGJ_STRCO       -----------------------------------------------------MSVTA--
ARGJ_BIFLO       -----------------------------------------------------MSVTF--
ARGJ_DEIRA       ------------------------------------------------MTEPLPDVTF--
ARGJ_THET2       -----------------------------------------------------MAVRL--
ARGJ1_NOSS1      ---------------------------------------------MADWQEITGGITA--
ARGJ_SYNY3       ---------------------------------------------MADWQVIEGNITA--
ARGJ_THEEB       ---------------------------------------------MSHWQQITGGVTA--
ARGJ_CITLA       MYLSVPHYPSLKFTAFQSHKRNFRVFAVATNEAANYLPEAPILIPDGPWKQIDGGVTA--
ARGJ_BACAM       ----------------------------------------MIQLSEDQIVKVTGDVSS--
ARGJ_BACSU       ----------------------------------------MIQLSEDQIVKVTGDVSS--
ARGJ_BACHD       --------------------------------------MNVINETANVLKLETGSVTS--
ARGJ_GEOSE       --------------------------------------MTITKQTGQVTAVADGTVVT--
ARGJ_STAAM       -----------------------------------MKHQETTSQQYNFSIIKHGDIST--
ARGJ_STAAW       -----------------------------------MKHQETTSQQYNFSIIKHGDIST--
ARGJ_OCEIH       ---------------------------------------METTTVKEISILKNGHVTS--
ARGJ_LISIN       ------------------------------------------------MELIKGNIAS--
ARGJ_LISMO       ------------------------------------------------MELIKGNIAS--
ARGJ_STAES       ------------------------------------------------MNIIKGNIAS--
ARGJ_STRMU       ------------------------------------------------MKIIDGNIAS--
ARGJ_LACLA       ------------------------------------------------MKEIKGTIAS--
ARGJ_LACPL       ------------------------------------------------MQVLTNTKFETV
ARGJ_THEMA       -------------------------------------------------------MFT--
ARGJ_CALS4       ------------------------------------------------MEILDGKIEL--
ARGJ1_CLOAB      --------------------------------------------MDTIKVLNNKNITD--
ARGJ2_CLOAB      --------------------------------------------------MINYMI----
ARGJ_LEPIN       -----------------------------------------------------MHM----
ARGJ2_NOSS1      ------------------------------------------------MSLTASST----
ARGJ_AQUAE       -------------------------------------------------------M----
ARGJ_AGRFC       ----------------------------------------------MSVAVSPLAPKSYP
ARGJ_RHIME       ----------------------------------------------MSGSVSPLAPKTFA
ARGJ_BRUME       ----------------------------------------------MSASVSPLAPKYYP
ARGJ_BRUSU       ----------------------------------------------MSASVSPLAPKHYP
ARGJ_RHILO       ----------------------------------------------MSTTISPLAPKKYP
ARGJ_BRADU       ----------------------------------------------MSSSVSPLAPKTVP
ARGJ_CAUVC       --------------------------------------------------------MPFP
ARGJ_NEIMA       -------------------------------------------------MAVNLTEKTAE
ARGJ_RALSO       -------------------------------------------------MAVNLVAPAAD
ARGJ_PSEPK       -------------------------------------------------MAVGLGPLPT-
ARGJ_PSESM       -------------------------------------------------MAVGLGPLPA-
ARGJ_PSEAE       -------------------------------------------------MAVGLGPLST-
ARGJ_CHLTE       -------------------------------------------------MRPVVADPASD
ARGJ_YEAST       ------------------------------------MRISSTLLQRSKQLIDKYALYVPK
                                                                             

ARGJ_METAC       ----VKGVTANGIKLG----------KMGITVIRA--E---GPAAGVFTKNKVTAAPVVL
ARGJ_METMA       ----VRGVSAYGIKPG----------KMGIAVIRA--E---GPAAGVFTRNKVVAAPVTL
ARGJ_ARCFU       ----IGGVLCNGIKEG----------KYGLGLVRV--R---GSIAGVFTQNKIRAAPVIV
ARGJ_METJA       ----PKGFKANGYKEG----------KFGVAIIISEKD---AVGAGTFTTNKVVAHPVVL
ARGJ_METTH       ----VDGVLAAGCREG----------KYGVGLIIN-RG---STAAAVFTSNRVRAEPVKL
ARGJ_METKA       ----PEGFLLGGIKRE----------GIGVGLIFSERR---CAVAGTFTENTLRAAPVEH
ARGJ_HELHP       ----PQGFYADGVSAGLKPPLPNGAPALDVAFLYSEDV---LKPFTLFTSNRFQAAPITH
ARGJ_COREF       ----PKGFVASATTAGIKPS-G----KPDMALVVNQGPE--YTAAAVFTRNRVIASPVKV
ARGJ_CORGL       ----PKGFVASATTAGIKAS-G----NPDMALVVNQGPE--FSAAAVFTRNRVFAAPVKV
ARGJ_MYCLE       ----PAGFQAAGITAGIKVS-G----APDLALVFNEGPD--YAAAGVFTRNKVKAAPVLW
ARGJ_MYCTU       ----PAGFRAAGVAAGIKAS-G----ALDLALVFNEGPD--YAAAGVFTRNQVKAAPVLW
ARGJ_STRCO       ----AKGFTAAGITAGIKES-G----SPDLALVVNTGPR--RSAAGVFTSNRVKAAPVLW
ARGJ_BIFLO       ----AQGFSAAGVAAGISSVEG----KKDLALVVNNGPL--DAAAGVFTSNRFCAAPVQW
ARGJ_DEIRA       ----PQGFRAAAMAAGIKPS-G----KPDLSCVVSERD---CAWAFAGTRSTTAAACVTR
ARGJ_THET2       ----PRGFRAGATRAGIKPS-G----RPDLALLVSGLP---AAWAYAATQNRAAAPSIHR
ARGJ1_NOSS1      ----PKGYRAAGITAGLKPSG-----LPDLALIVSDVE---AIASGVFTTSQVKAACVDY
ARGJ_SYNY3       ----PKGFKAAGITAGLKPSG-----SPDLSLIYSETE---AIAAGVFTTSQVRAACVDY
ARGJ_THEEB       ----AKGYRAAGITAGLKASG-----APDLALIVSDVP---AIAAGVFTTNHMCAAPVRY
ARGJ_CITLA       ----AKGFKAAGLYGGLRAKGE----KPDLALVTCDVD---AISAGAFTKNVVAAAPVLY
ARGJ_BACAM       ----PKGFQAKGVHCGLRYSK-----K-DLGVIISETP---AVSAAVYTQSHFQAAPIKV
ARGJ_BACSU       ----PKGFQAKGVHCGLRYSK-----K-DLGVIISETP---AVSAAVYTQSHFQAAPIKV
ARGJ_BACHD       ----AKGFSAVGIHTGVKRKR-----K-DLGAIVCEVP---ASSAAVYTLNKVQAAPLKV
ARGJ_GEOSE       ----PEGFQAAGVNAGLRYSK-----N-DLGVILCDVP---ASAAAVYTQSHFQAAPLKV
ARGJ_STAAM       ----PQGFTAGGMHIGLRANK-----K-DFGWIYSSSL---ASSAAVYTLNQFKAAPLIV
ARGJ_STAAW       ----PQGFTAGGMHIGLRANK-----K-DFGWIYSSSL---ASAAAVYTLNQFKAAPLIV
ARGJ_OCEIH       ----PSGFYAGGVHCGLRRKK-----L-DLGWIYSDTP---ASAAGVYTQNTFQAAPLLI
ARGJ_LISIN       ----PKGFYADGKHAGLKRKR-----N-DIGWIYSEVP---ANSAAVYTMNQMQAAPIFV
ARGJ_LISMO       ----PKGFYADGKHAGLKRKR-----N-DIGWIYSEVP---ANAAAVYTMNQMQAAPIFV
ARGJ_STAES       ----PLGFSADGLHAGFKKKK-----L-DFGWIVSEVP---ANVAGVFTTNKVIAAPLKL
ARGJ_STRMU       ----PLGFSADGLHAGFKKRK-----K-DFGWIVSEVP---ASVAGVYTTNKVIAAPLIV
ARGJ_LACLA       ----PKGFLADAVHAQLKYKN-----L-DLGLILSQVP---AAIAGVFTTNKVCAAPVLI
ARGJ_LACPL       AFQWPAGFYSDGIHIGLRRHK-----K-DFGWLFSKVP---ASAAGTYTTNQFQAAPTKL
ARGJ_THEMA       ----PRGFKFAGVHCKIKRKR-----K-DLGIIFSEVP---CVAAGVFTTNVVKAAPVIY
ARGJ_CALS4       ----PKGFVASGVFAGIKRSK-----K-DLALIYSERL---ANISAVFTTNRVKAAPVIL
ARGJ1_CLOAB      ----VPYFKAIGVASGIKGNN-----KSDLCVIYSEKP---CIAAGTFTTNKVKAAPVLL
ARGJ2_CLOAB      ----PKGFLCCGKHVGIKKRKL------DLGVVYSEKL---CSAAAVFTKNKFCGIPIIV
ARGJ_LEPIN       ----PKGFLSFGINIGIKDDTK------DFGVIYSEIP---CKATAVFTKNNFPGAPVIV
ARGJ2_NOSS1      ----PQGFSTFITNLGIRDTTE------DFVFLRSDVP---CVADGVFTQSLFAGPSVTI
ARGJ_AQUAE       ----AEILMGVGNAGLKESGNP------DILVVYLPYP---CTASFVFTDNYFKAGSVIY
ARGJ_AGRFC       DMPALRGVRMATAAAGIKYKNRT-----DVLLMVFDK---PASVAGVFTKSKCPSAPVDF
ARGJ_RHIME       EMPALRGVRMATAAAGIKYKNRT-----DVLMMLFDR---PASVAGVFTRSKCPSAPVDH
ARGJ_BRUME       AMPVIHGVRIATAAAGIKYKGRT-----DLMLMVFDR---PAEAAGVFTRSLCPSAPVDF
ARGJ_BRUSU       AMPVIHGVRIATAAAGIKYKGRT-----DLMLMVFDR---PAEAAGVFTRSLCPSAPVDF
ARGJ_RHILO       KMPVIEGVRIATAEAGIKYKNRT-----DLLAMVFDA---GTAVAGVFTKSKCPSAPVDF
ARGJ_BRADU       DMPVIAGVRLATAEAGIRYKNRT-----DVLLAVMDK---GTAVAGVFTKSKCPSAPVEW
ARGJ_CAUVC       TIPPIAGVEIATGRAGFYKHERE-----DLLLMRFAE---GTSAAGVFTRHGVGSAPVDW
ARGJ_NEIMA       QLPDIDGIALYTAQAGVKKPGHT-----DLTLIAVAA---GSTVGAVFTTNRFCAAPVHI
ARGJ_RALSO       SLLPIDGVDLGWAEAGIRKANRK-----DVLLVRIAE---GASVAGVFTQNRFCAAPVQV
ARGJ_PSEPK       -LHPVPGFELGIASAGIKRPGRK-----DVVVMRCAE---GSSVAGVFTLNAFCAAPVIL
ARGJ_PSESM       -LHPVPGFELGISSAGIKRPGRK-----DVVVMRCAE---GSSVAGVFTLNAFCAAPVIL
ARGJ_PSEAE       -LHPVPGFELGIASAGIKRPGRK-----DVVVMRCAE---GSSVAGVFTLNAFCAAPVTL
ARGJ_CHLTE       AVFWPEGFTLAGINCGIK-PTSK-----DLMLMLCDE---PASTASVFTTNLCCAAPVEL
ARGJ_YEAST       TGSFPKGFEVGYTASGVKKNGSL-----DLGVILNTNKSRPSTAAAVFTTNKFKAAPVLT
                                             ..                  *     .     

ARGJ_METAC       SKG-VIET-QHQLSAIIANSGNANAFTGDDGFLDAMEMASALSESLDLEPDT-----VAV
ARGJ_METMA       SRE-RIET-EHRLSAVIANSGNANAFTGDDGFLDAMEMASMVAENLGLDPDN-----VAV
ARGJ_ARCFU       CEE-NIR--DGVVEGVIVNSGNANAYTGEQGMRDAREMCRIAANLLGCEERR-----VAV
ARGJ_METJA       SRE-LIKN-RDKFRAIVANSGNANCFT-KDGMEDAKEMQRLVAELFNINEDE-----VLV
ARGJ_METTH       TER-VIAD--GSISAIVANSGNANCFTGREGMDDARRMARKVAESLSMDESE-----VAV
ARGJ_METKA       SEE-VCD--RGVARGVIVNSGHANAMTGEEGYQDVLRTAEAIAELMGAPEDE-----IVV
ARGJ_HELHP       FKH-FIK--GKESNFVLINTKNANAMTGERGVQDVCDILSSLTQKFPFIQN------PIM
ARGJ_COREF       SRENVADG-Q--LKAVLYNAGNANACNGTQGDADARESVNTLATKLGLAPED-----IGV
ARGJ_CORGL       SRENVADG-Q--IRAVLYNAGNANACNGLQGEKDARESVSHLAQNLGLEDSD-----IGV
ARGJ_MYCLE       TQRVLSTG-Q--LRAVILNSGGANACTGPAGFQDAHTTAEAVAAALSDWGTETGAIEVAV
ARGJ_MYCTU       TQQVLTTG-R--LRAVILNSGGANACTGPAGFADTHATAEAVAAALSDWGTETGAIEVAV
ARGJ_STRCO       SEQVLKSG-E--VTAVVLNSGGANACTGPKGFQDTHATAEKAADVLGTGAGE-----VAV
ARGJ_BIFLO       SRKVVADG-H--VKAVILNSGGANACTGEAGYAQSVATAETVAGLIGAEPND-----VAV
ARGJ_DEIRA       NRELYASG-AP-LRALVVNAGVANAATGQQGARDNADMADALASVLAVGEAE-----VIT
ARGJ_THET2       GRALYASG-KP-LRAVVVNAGNANCATGERGYEDDRRMAELAALRLGLSPEE-----VLT
ARGJ1_NOSS1      CRQRLQAK-Q-SARAILCNAGQANAATGSQGIKDAEESAELLAKELNISPEL-----ILL
ARGJ_SYNY3       CRQRLQAK-A-SARAILVNSGQANAGTGKQGWDDAVESAQLLAQGLNISPES-----ILL
ARGJ_THEEB       CRQRLQTK-G-TAQAILCNSGQANAATGEQGWQAVLAQADMVATALGFSPEM-----VLV
ARGJ_CITLA       CKKALDIS-E-TARAVLINAGQANAATGDAGYQDVIECVNNLSKILQIRPEE-----ILV
ARGJ_BACAM       TQDSLKHG-P-TLKAVIVNSAIANACTGEQGLKDAYTMRESFASQLGIEPEL-----VAV
ARGJ_BACSU       TQDSLKHG-P-TLKAVIVNSAIANACTGEQGLKDAYTMRESFASQLGIEPEL-----VAV
ARGJ_BACHD       TQESIAVE-G-KLQAMIVNSGIANACTGKRGLDDAYTMRAVGAETFHIPEHY-----VAV
ARGJ_GEOSE       TQASLAVE-Q-KLQAVIVNRPCANACTGAQGLKDAYEMRELCAKQFGLALHH-----VAV
ARGJ_STAAM       TEDTLQKS-KGKLQALVVNSANANSCTGQQGIDDARQTQTWVAQQLQIPSEH-----VAV
ARGJ_STAAW       TEDTLQKS-KGKLQALVVNSANANSCTGQQGIDDARQTQTWVAQQLQIPSEH-----VAV
ARGJ_OCEIH       TKHTIEHS-K-QIQSIIVNSANANSFTGKQGYEDALLMQKLVANQLNIEQHH-----VAV
ARGJ_LISIN       TKDSFKNS-A-KLQAIIVNSGNANAVTGNQGMLDALSMRAKTAEKLAIPMDT-----VAV
ARGJ_LISMO       TKDSFQSN-A-KLQAIIVNSGNANACTGNQGMLDALAMRAQTAEKLEIPLDS-----VAV
ARGJ_STAES       TKNSIEKS-G-KMQAIVVNSGIANSCTGKQGEKDAFKMQQLAANKLQIQPEY-----VGV
ARGJ_STRMU       TRESVKKA-Q-KMQALVVNSGVANSCTGLQGMEDAYTMQKWTATKLKIAPEL-----VGV
ARGJ_LACLA       DRQIVKK--G-QARAIICNSAVANAVTGEQGYANALKTQKLLAEKFELKAEE-----VAV
ARGJ_LACPL       TKQMIDQG-H-QLQGLLLNSAIANSCTGEQGWQNALQEQAWLANKLNVAPNL-----IGV
ARGJ_THEMA       DMEILKKN-PNGIKAVVVNSGVANACTGEQGMINARRMAEKTAEELGVPVES-----VLV
ARGJ_CALS4       DMERAKKG-K--AQAIVINSGNANACTGEKGIEDAKSMAKKVAEVLEIEEED-----VLV
ARGJ1_CLOAB      DLKHIESE-N--IYAIVANSGNANACTGDDGYEKAYLMAECTAKHLKIKPEE-----VLV
ARGJ2_CLOAB      GKENIKD---NKLQSIVVTSGVANVATGEEGLKNTYRILNKLSCELNIKSEN-----ILP
ARGJ_LEPIN       GKEHVRS---GVLQAIVINSKNSNVATGEKGIQNSREICKIIGESLGIKETL-----VLP
ARGJ2_NOSS1      SRQNLQD---GQAQGIIIISKNANVANGAVGIADAQEIIQLVAQETGIAAEN-----LAI
ARGJ_AQUAE       SERIARDK--ERIRAFVVNSGNANCGTGEEGIKHAEMMAEKVAQILDIPKDE-----VFV
ARGJ_AGRFC       CRANLG---SGAARAVVVNSGNANAFTGVKGKAATELTAKSAAAAVGCSEGE-----IFL
ARGJ_RHIME       CRQNLP---GGIARAVVVNSGNANAFTGKKGREATRLTAEAAAKAVGCSEAE-----VFL
ARGJ_BRUME       CRRNLV---HGKARAVVVNSGNANAFTGLKGREATQATAEAAAKAIGCATTD-----IFL
ARGJ_BRUSU       CRRNLV---HGKARAVVVNSGNANAFTGLKGREATQATAEAAAKAIGCATTD-----IFL
ARGJ_RHILO       CRQNLA---AGKARVLVVNSGNANAFTGKKGRESTALTGEAAAKAAGCTAGE-----VFL
ARGJ_BRADU       CRAKLK---GGKARALVVNSGNANAFTGKTGRSSTALTAKIAAKAVGCSESE-----IFL
ARGJ_CAUVC       CKRQLAATGGADVRALVVNAGCANSFTGKPGADAVRRVATAVGKRFDCRQRD-----VMM
ARGJ_NEIMA       AKSHLFD--EDGVRALVINTGNANAGTGAQGRIDALAVCAAAARQIGCKPNQ-----VLP
ARGJ_RALSO       CREHLAS--GQGARAIVVNTGNANAGTGAPGLALARQTCEAVAGLLGIAPQQ-----VLP
ARGJ_PSEPK       SKQRVQG--T--VRYLLTNTGNANAGTGAPGLAAAERTCAKLAELAGVPAES-----VLP
ARGJ_PSESM       AKQRVQG--T--VRYLLTNTGNANAGTGEPGLVAARRTCEALAQLTGVDASA-----VLP
ARGJ_PSEAE       AKQRFLG--E--VRYLLTNTGNANAGTGEAGLAAAAQTCAKLAELAGVAETS-----VLP
ARGJ_CHLTE       SKAALSAS-GGKMRAVICNSGNANAATGAAGMQNARLMAESTAQAFDLNAGE-----VLV
ARGJ_YEAST       SKKVLETARGKNINAIVVNSGCANSVTGDLGMKDAQVMIDLVNDKIGQK-NS-----TLV
                                .:     :*  .   *                             

ARGJ_METAC       ASTGVIGRRLDVSWIREHLPEVLEGLG--SSPECSLAAAKAIMTTDKALKEVAVELDC--
ARGJ_METMA       ASTGVIGRRLDVSFIKEHLPEVLEGLG--SSPECSRAAAKAIMTTDRALKESAVELDC--
ARGJ_ARCFU       ASTGVIGRKLDMEWIRKKAPEVYSGLG--NSVENAERFGRAIVTTDRFVKKAYSE-----
ARGJ_METJA       ASTGVIGRKMDMNIIKDRINKVYNLIK--EG-NSSINAAKAIMTTDTKPKEIAVEFEV-N
ARGJ_METTH       ASTGVIGRRMPIDKIEFLIQSAAAQLE--NSEAASGALAEAIMTTDTFPKEVAVEFELET
ARGJ_METKA       CSTGVIGERPPVDKIVRYAREVWEDIG--PTERHVREFSRAIMTTDTEEKIALYEGDG--
ARGJ_HELHP       SSTGVIGQYLPKEKIIASFAS-FDFNA--KCENAHTRAADAIRTTDAFSKEIALRVRLDN
ARGJ_COREF       CSTGLIGELLPMDKVTAGIEALTAEGA--LGDNG-AAAAQAIMTTDTVDKETVVFA----
ARGJ_CORGL       CSTGLIGELLPMDKLNAGIDQLTAEGA--LGDNG-AAAAKAIMTTDTVDKETVVFA----
ARGJ_MYCLE       CSTGLIGDRLPMDKVLAGVRAIVHKMA--GGVTGGDDAAHAIMTTDTVPKQVALHNR---
ARGJ_MYCTU       CSTGLIGDRLPMDKLLAGVAHVVHEMH--GGLVGGDEAAHAIMTTDNVPKQVALHHH---
ARGJ_STRCO       CSTGLIGVLLPMDKLLPGVEA--AAGQ--LSEHGGEKAAIAIKTTDTVHKTSVVTR----
ARGJ_BIFLO       CSTGLIGELLPLDNVLAGAKSAHEALA--ATAEAGTDASHAIMTTDTKPKTVELTGS---
ARGJ_DEIRA       ASTGVIGHLLPMDKVLSGVEHLPEELE--GAALP---FATAIMTTDTRSKLAHVTLS---
ARGJ_THET2       ASTGVIGVPLPVEKIAKGLPEI--GLT--PFAEA---FAEAILTTDTRPKVAEAEVA---
ARGJ1_NOSS1      ASTGVIGQRIKMDALRNGIPKLIASLT--D--TGSDAAAGAIITTDLVTKSIALETTI-G
ARGJ_SYNY3       ASTGVIGQRIKMEQLRQGITPLIQSLA--P--NGGDKAARAIMTTDLVPKTIALETEI-D
ARGJ_THEEB       ASTGVIGQPIPLEKMRQALPTLTANLS--D--GGGEAAARAIMTTDLVPKQIALEAEW-E
ARGJ_CITLA       ESTGVIGHRIKKDALLNSLPQLVRSLS--SSVGGAASAAVAITTTDLVSKSVAIESQV-G
ARGJ_BACAM       SSTGVIGEHLDMEKIHAGIELLKE--T--P--AGSGDFEEAILTTDTVIKQTCYELAI-G
ARGJ_BACSU       SSTGVIGEHLDMEKIHAGIELLKE--T--P--AGSGDFEEAILTTDTVIKQTCYELAI-G
ARGJ_BACHD       TSTGVIGEFLPMDVITNGIRQLKPEAT--I--EGAHAFNEAILTTDTVEKHTCYQTIV-N
ARGJ_GEOSE       ASTGVIGEYLPMEKIRAGIKQLVPGVT--M--ADAEAFQTAILTTDTVMKRACYQTTI-D
ARGJ_STAAM       ASTGVIGEYLPMDKIKTGTEHIKDTNF--A--TPGA-FNEAILTTDTCTKHIAVSLKI-D
ARGJ_STAAW       ASTGVIGEYLPMDKIKTGTEHIKDANF--A--TPGA-FNEAILTTDTCTKHIAVSLKI-D
ARGJ_OCEIH       ASTGVIGERLPMDKVRNGIRQLSHTQ---V--DAES-FEKAILTTDTSTKHVAVQVEI-D
ARGJ_LISIN       ASTGIIGEMLPMDKIMTGIDLLEKQT------GNAADFEEAILTTDTFQKQISFQTEI-G
ARGJ_LISMO       ASTGIIGDMLPMDKINAGIEMLEKQT------GNAADFEEAILTTDTFQKQISFQTEI-G
ARGJ_STAES       ASTGVIGKVMPMSILKNGFSKLVKN-------GNADDFAKAILTTDTHTKTCVVNEEF-G
ARGJ_STRMU       ASTGVIGDLMPMDTLQKGLSKLVVN-------GNSDDFAQAILTTDTKVKTVAVTEQF-G
ARGJ_LACLA       CSTGVIGVQLPMEKIATGISKLSQNE------GTAAYFAKAILTTDTQTKTINFEAEI-G
ARGJ_LACPL       ASTGLIGAQLPMDKIKNGLPQLTPT--------KSDAVTYAVLTTDQHPKTVCVQCEL-S
ARGJ_THEMA       SSTGVIGVQLPMDKVENGIEEAARVLS--N--DP-LPFAEAIMTTDTKVKMHSTKVMI-D
ARGJ_CALS4       CSTGVIGVPLPMEKVLKGIEVAALSLS--K--EGGYDAAHAIMTTDTFLKAVTVKFNV-E
ARGJ1_CLOAB      ASTGVIGVPLPIDKVMFGIEKAFSILP--K--SDANKAIDAIMTTDTVQKKIFVEFML-D
ARGJ2_CLOAB      SSTGIIGKQLPIDCIITGINGIKSSLS--K--YNWEEFNRAIMTTDKELKIKS-----CK
ARGJ_LEPIN       SSTGVIGVPLKMEIILPACKKAKSLLK--P--GNLEEVAEAIMTTDTRKKISSRNIK-TK
ARGJ2_NOSS1      ASTGVIGRRYPIEKIRAGLVGMGQKLT--A--ADFDLAARGIMTTDTVSKIAA-----RQ
ARGJ_AQUAE       FSTGIIGKYLPIENVLKGIEQACSNLE--L--LDLKRASEVISTTDRFPKYDF-----AK
ARGJ_AGRFC       ASTGVIGEPLDASKFAGVLGDMNVR----AEADFWQEAAKAIMTTDTYPKVSTRTAEIGG
ARGJ_RHIME       ASTGVIGEPLDATKFAGVLDKLAAS----ATQDFWFEAAKAIMTTDTYPKVATRSAEIGG
ARGJ_BRUME       ASTGVIGEPLDAGKFSHLLGDMAES----ATEDFWTEAAKAIMTTDTYPKVATETVLLGQ
ARGJ_BRUSU       ASTGVIGEPLDAGKFSHLLGDMAES----ATEDFWTEAAKAIMTTDTYPKVATETVLLGQ
ARGJ_RHILO       ASTGVIGEPLDTTKFSHLLAGLVSD----GKPDLWTEAAKAIMTTDTYPKVATQTVKLGD
ARGJ_BRADU       ASTGVIGEPLDATKFDGVLGRLAET----AEPGDYLAAAKAIMTTDTFPKVATATVKLGK
ARGJ_CAUVC       ASTGVIGVILDDSKITARLPEVESR----LKADAWAEAGRAIMTTDTFPKGAYATAVIDG
ARGJ_NEIMA       FSTGVILEPLPADKIIAALPKMQ--------PAFWNEAARAIMTTDTVPKAASREGKVGD
ARGJ_RALSO       FSTGVILEPLPVDRLIAGLPAAQAN----AKPDNWLAAAESIMTTDTVPKAASGTCTLSG
ARGJ_PSEPK       FSTGVIGEPLPVEKIEGALQAALDN----LSENNWAEAATGIMTTDTLPKGASRQFQHDG
ARGJ_PSESM       YSTGVIGEPLPVEKIEGALQAALDD----LSVDNWAAAATGIMTTDTLPKGASRQFTHDG
ARGJ_PSEAE       YSTGVIGEPLPVAKIEAALPAALAD----LAEDRWAEAAAGIMTTDTLPKGASRQFVHDG
ARGJ_CHLTE       ASTGVIGQQLPVEKIAGAMPSLKAT----SGSTQWCDAAEAIMTTDTFPKAFGVDVKLSG
ARGJ_YEAST       MSTGVIGQRLQMDKISTGINKIFGEEKFGSDFNSWLNVAKSICTTDTFPKLVTSRFKLPS
                  ***:*        .                          : ***   *          

ARGJ_METAC       --GVRIGAIAKGSGMIEPNM--GTMLCFAYTDALV-PADVLDAALRIAVDKTFNMVVVDG
ARGJ_METMA       --GVRIGAIAKGSGMIEPNM--GTMLCFAYTDAKV-PADVLDAALKIAVDKTFNMVVVDG
ARGJ_ARCFU       --KARIAAVAKGAGMIAPNM--ATMLCFAFTSAKF-DSGELYDMLRRAADKTFNRLTVDG
ARGJ_METJA       GKTVRVGGIAKGAGMIAPNMLHATMLCFITTDIEI-DKESLTNILQKVVDKTFNNISVDG
ARGJ_METTH       GEKARIGAVAKGSGMIAPNM--ATMLSFITTDVDA-SSSELTEALRVAVDESFNMLIVDG
ARGJ_METKA       ---WSLLGIAKGAGMIHPNM--STMLAFLLTDVGA-KPKELQMWLRDVVNDTFNMITVDG
ARGJ_HELHP       GESFCIGAMAKGAGMIQPAL--ATMLCFITTDALV-PQNEGDRILRECAKTSFNAISVDG
ARGJ_COREF       -DGWTVGAMGKGVGMMAPSL--ATMLVCLTTDASI-TPAMARIALAKATAVTFETLDIDG
ARGJ_CORGL       -DGWTVGGMGKGVGMMAPSL--ATMLVCLTTDASV-TQEMAQIALANATAVTFDTLDIDG
ARGJ_MYCLE       -NKWTVGGMAKGAGMLAPSL--ATMLCVLTTDAVV-EPAALDQALRRATAHTFDRLDIDG
ARGJ_MYCTU       -DNWTVGGMAKGAGMLAPSL--ATMLCVLTTDAAA-EPAALERALRRAAAATFDRLDIDG
ARGJ_STRCO       -DGWTVGGMAKGAGMLAPGL--ATMLVVITTDADL-ETEALDRALRAATRVTFDRVDSDG
ARGJ_BIFLO       -NGWKIGGMVKGSGMIAPQL--ATMLCVITTDAVV-SAGQMQAALAVAAEHSFNRIDVDG
ARGJ_DEIRA       -NGARIVGTAKGSGMIHPDM--ATMFAFAFTDAQV-DQGALRGAFPAIVARTFNAVTVDG
ARGJ_THET2       --GARIVGLAKGSGMIHPNM--ATMLAFLVTDALV-PQEALRAGWRRVVERTFNQVTVDG
ARGJ1_NOSS1      DRPVRIGGIAKGSGMIHPNM--ATMLAFVTCDAAV-SSHLWQQMLTRAADRSFNSITVDG
ARGJ_SYNY3       GRPVRMGGIAKGSGMIHPNM--ATMLAFVTCDAAV-STALWQQMLSRATQKTFNQVTVDG
ARGJ_THEEB       GQTIRIGGMAKGSGMIHPKM--ATMLAFITCDAAV-SPHLWQEMLQRACDRSFNQITVDG
ARGJ_CITLA       GSTIRIGGMAKGSGMIHPNM--ATMLGVVTTDAVV-ACDVWRKMVQISVDRSFNQITVDG
ARGJ_BACAM       GKTVTIGGAAKGSGMIHPNM--ATMLGFVTTDAAI-EEKALQKALREITDVSFNQITVDG
ARGJ_BACSU       GKTVTIGGAAKGSGMIHPNM--ATMLGFVTTDAAI-EEKALQKALREITDVSFNQITVDG
ARGJ_BACHD       GKTVTVGGVAKGSGMIHPNM--ATMLSFVTTDANI-DHGHLQGALSAITNETFNRITVDG
ARGJ_GEOSE       GKTVTVGGAAKGSGMIHPNM--ATMLAFITTDANV-SSPVLHAALRSITDVSFNQITVDG
ARGJ_STAAM       GKTVTIGGSAKGSGMIHPNM--ATMLAFITTDASI-ESNTLHQLLKSSTDHTFNMITVDG
ARGJ_STAAW       GKTVTIGGSTKGSGMIHPNM--ATMLAFITTDASI-ESNTLHQLLKSSTDHTFNMITVDG
ARGJ_OCEIH       GKLVTIGGAAKGSGMIHPNM--ATMLSFITTDANV-NQDSLQQALRKVTDQSYNQITVDG
ARGJ_LISIN       GKTVTMSGVAKGSGMIHPNM--ATMLAFITTDAAI-PAELLQKLLKIKVDKTFNQITVDG
ARGJ_LISMO       GRKVTMSGVAKGSGMIHPNM--ATMLAFITTDAAI-PAELLQKLLKIKVDKTFNQITVDG
ARGJ_STAES       SDTVTMAGVAKGSGMIHPNL--ATMLAFITCDANI-SSQTLQQALKDVVEVTFNQITVDG
ARGJ_STRMU       RDEVTMAGVAKGSGMIHPNM--ATMLAFITCDAVI-SSETLQLALSQNVETTFNQITVDG
ARGJ_LACLA       GQIVNMAGVCKGSGMIHPNM--ATMLAFITTDAKI-AQALLQKTLSEIIETTFNQITVDG
ARGJ_LACPL       GQLVTLTGFAKGSGMIHPKM--ATMLGFVTTDAQI-DGPVLQDMLSTNVDQTFNQITVDG
ARGJ_THEMA       GKEITVLGIAKGSGMIHPNM--ATMLSFITTDAKI-SEEALKKLLKLSVDDSYNMIDVDG
ARGJ_CALS4       GKDITMTGFAKGSGMIHPNM--ATMLSFVLTDASV-EKATLDKAFKNTVNRTYNMISVDG
ARGJ1_CLOAB      KKKVTICAIAKGSGMIHPNM--ATMLSFIVTDANI-TKDLLNKALKESVKDSYNMISVDR
ARGJ2_CLOAB      IGDATVLGIAKGSGMIEPNM--ATMLAYFFTDASI-KAVELKGILKRAVDKSFNMISIDH
ARGJ_LEPIN       SGQGTIYGIAKGAGMIEPNM--ATMLCYILSDVSLPEGTDLYSILKSSVDQSFNCLTIDS
ARGJ2_NOSS1      VGNAKLVGIAKGVGMIEPNM--ATMLAFFFTDAAI-SANTLRQIFRSTIDKTFNCLSIDT
ARGJ_AQUAE       AGEVETFGFAKGAGMIHPSM--ATMLAFVFTNANL-EYLTLKRIHESVTEKTFNSITVDG
ARGJ_AGRFC       V-IVTINGISKGAGMIAPDM--ATMLSFVVTDADI-EPAALQSLLSAGVGPTFNSVTVDS
ARGJ_RHIME       V-KVAINGIAKGAGMIAPDM--ATMLSFVVTDADI-APAALQALLQAGVEPTFNSVTVDS
ARGJ_BRUME       V-PVTINGIAKGAGMIAPDM--ATMLSFVVTDAPI-KADALQSLLSKGVGSTFNSVTVDS
ARGJ_BRUSU       V-PVTINGIAKGAGMIAPDM--ATMLSFVVTDAPI-KADALQSLLSKGVGSTFNSVTVDS
ARGJ_RHILO       T-DVTINGISKGAGMIAPDM--ATMLSFIATDAPI-AAPVLQDLLSRGTAKTFNAVTVDS
ARGJ_BRADU       A-KVTINGMAKGAGMIAPDM--ATMLSFVFTDAPI-APAALQALLKSGVEDTFNAVTIDG
ARGJ_CAUVC       H-EVKIAGIAKGSGMIAPDM--ATMLAFVATDAAI-APAALQTLVSLYTRTTFNCVTVDG
ARGJ_NEIMA       KHTVRATGIAKGSGMIHPNM--ATMLGFIATDAKV-SQPVLQLMTQEIADETFNTITVDG
ARGJ_RALSO       K-PVRLSGISKGAGMIRPNM--ATMLGFIATDANV-DEAVLQGLVRHAADHSFNSVTVDG
ARGJ_PSEPK       V-TVTVTGISKGAGMIRPNM--ATMLGYIATDAKV-APKVLKDLMLDGANKSFNRITIDG
ARGJ_PSESM       V-TITVTGISKGAGMIRPNM--ATMLGYIATDAKV-SQSVLQDLIRDGANKSFNRLTIDG
ARGJ_PSEAE       V-TVTVTGISKGAGMIKPNM--ATMLGYIATDAKV-AQGVLQDLLRDAANKSFNRITIDG
ARGJ_CHLTE       G-TARIAGIAKGSGMICPNM--ATMLAFLGTDATI-EPALLQELLAAANAVSFNAITVDG
ARGJ_YEAST       GTEYTLTGMAKGAGMICPNM--ATLLGFIVTDLPI-ESKALQKMLTFATTRSFNCISVDG
                        .  ** **: * :  .*::     .                   ::: :  * 

ARGJ_METAC       DTSTNDMVLFTSTCKSGI------KPCMECL-DEFEDALIYLFTDLAKKMARDGEGATKL
ARGJ_METMA       DTSTNDMVLFTSTCKSGV------KPCLDCL-DDFEEGLVCVFTDLAKKMAKDGEGATKL
ARGJ_ARCFU       DTSTNDTVLLISTGKERV------ER------DVFEEELCSVFYSIAKQMARDGEGATKV
ARGJ_METJA       DTSTNDTVFVLANGLSGV------NY-EECG-EEFENALLYVCRELAKMIVKDGEGATKF
ARGJ_METTH       DESTNDMVIISSTRTSG-----------RID-SNFREALVAVCRELARMMARDGEGVTKS
ARGJ_METKA       DESTNDSVVLLANGSSNL------KVGSDVTITEFQRALEEVCTELAEKIVRDGEGATKL
ARGJ_HELHP       DMSTNDSVFLFANGRSGV------YN-----EAAFKEALKMIMHKLATDMVRDGEGSTKL
ARGJ_COREF       STSTNDTVFLLASGASG----------VKPTQDELNDAVFAACSDLAEQMQADAEGVTKR
ARGJ_CORGL       STSTNDTVFLLASGASG----------ITPTQDELNDAVYAACSDIAAKLQADAEGVTKR
ARGJ_MYCLE       CCSTNDTVLLLASGASG----------ITPPQADLDDAVRHACDDLCAQLQADAEGVTKR
ARGJ_MYCTU       SCSTNDTVLLLSSGASE----------IPPAQADLDEAVLRVCDDLCAQLQADAEGVTKR
ARGJ_STRCO       CMSTNDTVLLLSSGSSG----------VTPEYDAFAEAVRTVCDDLGQQLIRDAEGASKD
ARGJ_BIFLO       CMSTNDTVLLLASGASG----------IEPDKDEFNKLVREACASLSRQIIGDGEGASHD
ARGJ_DEIRA       DTSTNDMTAVLANGAAG----------ETD-LTEFLTALEGVMRDLARQIAADGEGATRL
ARGJ_THET2       DTSTNDLALLMANGAYG----------EVP-LKAFFEGVEAVAQELARMIARDGEGATKL
ARGJ1_NOSS1      DTSTNDSLIALANGQS---RTPAITEVGAE-SEKLEAMLTAVCQHLAKAIARDGEGATCL
ARGJ_SYNY3       DTSTNDSLFALANGES---RTAAITEMGPN-AEKLEAMLTAVCQHLAKAIARDGEGATCL
ARGJ_THEEB       DTSTNDSVIALANGQS---RTPAIAEPGAA-ATRLEEMLTAVCVHLAKAIARDGEGATCL
ARGJ_CITLA       DTSTNDTVIALSSGLSGF-NSNIISSLKSREAGQLQECLDVVMQGLAKSIAWDGEGATCL
ARGJ_BACAM       ETSTNDMVLVMANGCAE---NECLTEDHPD-WPVFKKALLLTCEDLAKEIARDGEGATKL
ARGJ_BACSU       ETSTNDMVLVMANGCAE---NECLTEDHPD-WPVFKKALLLTCEDLAKEIARDGEGATKL
ARGJ_BACHD       DTSTNDMVVVMASGLAE---NEALTPEHPD-WANFYKALQLACEDLAKQIARDGEGATKL
ARGJ_GEOSE       DTSTNDMVVVMASGLAG---NDELTPDHPD-WENFYEALRKTCEDLAKQIAKDGEGATKL
ARGJ_STAAM       DTSTNDMVLVMANHQVE---HQILSQDHPQ-WETFVDAFNFVCTFLAKAIARDGEGATKL
ARGJ_STAAW       DTSTNDMVLVMANHQVE---HQILSQDHPQ-WETFVDAFNFVCTFLAKAIARDGEGATKL
ARGJ_OCEIH       DSSTNDMVLVLANGRAE---NNELNESHPE-WSVFMDAWNIVAIELAKMIARDGEGATKL
ARGJ_LISIN       DTSTNDMVVVMANGCAE---NPLIQEGTAD-FEKFAAMFQAVTEHLAKSIARDGEGATKL
ARGJ_LISMO       DTSTNDMVVVMANGCAE---NPMLQEGTAD-FAKFADMFQAVTEHLAKSIARDGEGATKL
ARGJ_STAES       DTSTNDMVLVMSNGCTN---NNEIKKDSED-YYKFKQMLLYIMTDLAKSIARDGEGASKL
ARGJ_STRMU       DTSTNDMVLVLSNGCTL---NKEILPDTPE-FDKFSAMLHFVMQELAKKIAKDGEGATKL
ARGJ_LACLA       DTSTNDTVLLMANGQAK---NNEILEGSSD-YLLFKEMLAKVCQSLAKQIAADGEGATKL
ARGJ_LACPL       DTSTNDMVVTLANGLAD---NPSLQAGTTD-YDIFNQALHYVLGQLAKQIAADGEGATKL
ARGJ_THEMA       DTSTNDMVIVLANGLAG---NTTIQPETDG-FWKLYEAVHEVNQVLAEKIVEDGEGATKV
ARGJ_CALS4       DMSTNDTAIVMANGMAE---NKAIQEGTYE-FDLFYKALEYVNKTLARLIAKDGEGATKL
ARGJ1_CLOAB      DTSTNDMALLLANGASG---NTLISSENSD-YEVFKKALHYVNVEISKMIAKDGEGATKL
ARGJ2_CLOAB      DTSTSDTAAILANGYVG-----------NVNLEVFEKTFTDMCIDMAKDIVRDGEGVSKL
ARGJ_LEPIN       DTSTSDTVALLCNGLSG-----------ESSVQDFSKALTEICIDLTKLIATDGEGATKL
ARGJ2_NOSS1      DTSTSDSAVILANGLAG-----------EVPEAEFASALQEIAHDLVLKIARDGEGATKV
ARGJ_AQUAE       CESTNDAFGIISLGEV------------EADPETVEFELLKVSESLAKQIVADGEGATKI
ARGJ_AGRFC       DTSTSDTLMLFATGAAAEDGQVKVTSADDERLSSFRAALNDLLKDLALQVVRDGEGARKM
ARGJ_RHIME       DTSTSDTLMLFATGAAAGDGQAKVEDAADPRLDGFRAALDDLLRDLALQVVRDGEGARKM
ARGJ_BRUME       DTSTSDTLMLFATGTAAERGAPEITDAADKRLADFKKALGRVLKSLALQVVRDGEGARKM
ARGJ_BRUSU       DTSTSDTLMLFATGTAAERGAPEITDAADKRLADFKKALGRVLKSLALQVVRDGEGARKM
ARGJ_RHILO       DTSTSDTLLIFATGKAAKRGAPEITDPKDARLGQFRRALGKVLKSLALQVVRDGEGARKQ
ARGJ_BRADU       DTSTSDTLLAFATGAAAEHGAPKISRASDPRLKAFVKAFNQVLANLAEQVARDGEGARKL
ARGJ_CAUVC       DRSTNDTLLLFATGQS---GAPKIHRAGDKRLADFREKLEGVLLDLALQLVKDGEGATKF
ARGJ_NEIMA       DTSTNDSFVIIATGKN---SQSEIDNIADPRYAQLKELLCSLALELAQAIVRDGEGATKF
ARGJ_RALSO       DTSTNDSFVVIATGRA---GTPRIDSESHPDYAALRDALTGLAQALAQKIVRDGEGATKF
ARGJ_PSEPK       DTSTNDCCMLIATGKA---DLPEVTEASGALFEALKKAVFEVCMEVAQAIVRDGEGATKF
ARGJ_PSESM       DTSTNDCCMLIATGQA---DLPEITEAKGLLFEALKKAVFDVCMEVAQAIVRDGEGATKF
ARGJ_PSEAE       DTSTNDCCMLIATGRA---ALPEVTQASGALFAALKQAVLEVSMELAQAIVRDGEGATKF
ARGJ_CHLTE       DTSTNDMAAIMASGKG-----PEVLRGSD-NARLFGEALRSVMTMLAQLIIVDGEGATKF
ARGJ_YEAST       DMSTNDTICMLANGAI----DTKEINEDSKDFEQVKLQVTEFAQRLAQLVVRDGEGSTKF
                   **.*     .                      .          :   :  *.**    

ARGJ_METAC       IEARVTGAKTYEDARLAVKAIVRSPLVKSAIFGKDPNWGRVVAAAGYSGAELEQ----ER
ARGJ_METMA       IEARVTGAKKYEDARLVAKTIVRSPLVKSAIFGKDPNWGRVVAAAGYSGAELEQ----ER
ARGJ_ARCFU       FEVRVDGARNDEDANLIARAVASSLLVKTAIFGCDPNWGRIIAAAGYSGADVD-----ER
ARGJ_METJA       MEVVVKGAKTEEDAVKASKAIVNSLLVKTAVFGGDPNWGRIVAAVGYSGADFNP----EV
ARGJ_METTH       FQVDVVNAGTHEDAKMAARAIAGSSLVKTAIFGADPNWGRIVAAAGYSGAEFDP----EE
ARGJ_METKA       MIVCVHGASNEVEARRAARAIASSNLVKAALFGENPNWGRIGAAVGAARVDVDP----DE
ARGJ_HELHP       VAFEVCGARDESQAICAAKALTNSLLVKTAIYGEDPNWGRIASTIGASGVECNE----ES
ARGJ_COREF       VSVTVTGTTTDEMAINAARTIARDNLFKCAMFGSDPNWGRVLAAVGMADADMDP----DH
ARGJ_CORGL       VAVTVVGTTNNEQAINAARTVARDNLFKCAMFGSDPNWGRVLAAVGMADADMEP----EK
ARGJ_MYCLE       VTVTVIGAASDDDALVAARMIARDNLVKTAVFGSDPNWGRVLAAVGMAPVALDP----DR
ARGJ_MYCTU       VTVTVTGAATEDDALVAARQIARDSLVKTALFGSDPNWGRVLAAVGMAPITLDP----DR
ARGJ_STRCO       IKVEVVNAATEDEAVQVGRTIARNNLLKCAIHGEDPNWGRVLSAIGTTDAAFEP----DR
ARGJ_BIFLO       IRITVTGATSEDAALACGRAVAASNLLKCAISGNDPNWGRIVSSLGTVPPEVAPYDS-NK
ARGJ_DEIRA       LTVRVTGAASEAEALGAARTCCVSPLLKSAVHGADPNWGRVIMAVGRSGAGVKV----EA
ARGJ_THET2       MVVRVVGAATEEEARRAARAIAGSALWKSALYGNDPNWGRILAALGNSGARFDP----LR
ARGJ1_NOSS1      IEVQVTGAHDEQAARQIAKTIAGSSLVKSAIFGRDPNWGRIAAAAGRAGVPFEQ----EN
ARGJ_SYNY3       MEIQVTGAPDDQSARAVARTIAGSSLVKSAVFGRDPNWGRIAGAAGRAGVKFDQ----NN
ARGJ_THEEB       IEVQVSGASDDTAARQVARTIASSMLVKSAIYGRDPNWGRIAAAAGRAGVPFDA----SN
ARGJ_CITLA       IEITVSGASTEAEAAKVARSVAGSSLVKSAIYGRDPNWGRIAAAAGYAGVPFDQ----MK
ARGJ_BACAM       IEAQVQGAKNNLDANVIAKKIVGSNLVKTAVYGTDANWGRIIGAIGHSAAQVTA----EE
ARGJ_BACSU       IEAQVQGAKNNLDANVIAKKIVGSNLVKTAVYGTDANWGRIIGAIGHSAAQVTA----EE
ARGJ_BACHD       IEVEVTGAANDQEAGMVAKQIVGSDLVKTAIYGADANWGRIICAIGYSGCEVNQ----ET
ARGJ_GEOSE       IEVRVRGAKTDEEAKKIAKQIVGSNLVKTAVYGADANWGRIIGAIGYSDAEVNP----DN
ARGJ_STAAM       ISVNVSGAKSISDARKIGKTIVSSNLVKSAIFGEDANFGRIITAIGYSGCEIDP----KC
ARGJ_STAAW       ISVNVSGAKSISDARKIGKTIVSSNLVKSAIFGEDANFGRIITAIGYSGCEIDP----NC
ARGJ_OCEIH       IEVIVKGASTNQQASQIAKAVISSNLVKTAIYGNDANWGRIIGAIGYSGVPVEA----SK
ARGJ_LISIN       IEVQVKGATKTEDARMIAKKIVSSSLVKTAAFGGDGNWGRIICAIGYSGGRFAP----DN
ARGJ_LISMO       IEVQVNGATKTEDARMIAKKIVSSSLVKTAAFGGDGNWGRIICAIGYSGGRFAP----DN
ARGJ_STAES       IEVTVKGAKESSAARMIAKSVVGSSLVKTAIFGEDPNWGRIIAAAGYAKTYFDI----NQ
ARGJ_STRMU       IEVEVINAPNSLDACMMAKSVVGSSLVKTAIFGEDPNWGRILAAVGYAGVDVPV----DN
ARGJ_LACLA       IEVTVKGAPNDLTARFIAKKIVGSSLVKTAIFGADPNWGRIISSIGQV-ANFEV----SD
ARGJ_LACPL       VECNVVHAATTFDGQQIAKAIVGSNLVKAAIFGEDPNWGRIISTIGATDADIDV----AT
ARGJ_THEMA       MEVHVINAPDIKSARLIARSIVSSNLVKTAIYGEDANWGRVIAAAGYSGATFDP----EK
ARGJ_CALS4       IEVNVINAKTENDARLAAKAIVNSNLVKTAIFGEDANWGRILAAVGYSGADFDV----DK
ARGJ1_CLOAB      IEAKVFGASSSRDAKVAAKSVITSNLVKAAVFGSDANWGRIICALGYSAAEIDP----SK
ARGJ2_CLOAB      IEATVMGCSSFESAKVIAKSIINSPLVKIAIYGSDPNWGRIAMAIGKSFED-DVDP--LK
ARGJ_LEPIN       IELTISGAKSEAQARKIGKSILNSPLVKTAIYGGDPNWGRLIMAVGKVFDE-PIPF--EG
ARGJ2_NOSS1      IEVTVDSAANYAQAKRVAKAIVNSPLVKTAVYGADPNWGRVAMAIGKCEDERDINP--DQ
ARGJ_AQUAE       IRVNVRSAITEIKAREIAEAIANSLLVKTAVFGRDPNWGRIAAAAGSTEFP--IDP--FK
ARGJ_AGRFC       VEVTVTGAENDAAAKKIALSIANSPLVKTAVAGEDANWGRVVMAVGKSG----EMADRDR
ARGJ_RHIME       VEVTVEGAENDAAAKRIALSIANSPLVKTAVAGEDANWGRVVMAVGKSG----EMAERDR
ARGJ_BRUME       VEVEVTGAKSAASAKKIALSIANSPLVKTAVAGEDANWGRVVMAVGKAG----EPADRDR
ARGJ_BRUSU       VEVEVTGAKSAASAKKIALSIANSPLVKTAVAGEDANWGRVVMAVGKAG----EPADRDR
ARGJ_RHILO       VEVTVTGAKSARSAKRIALSIANSPLVKTAVAGEDANWGRVVMAVGKAG----EPADRDR
ARGJ_BRADU       VEITVEGAKTKASARKIAMSIANSPLVKTAIAGEDANWGRVVMAVGKAG----EPADRDK
ARGJ_CAUVC       VKITVNGAESPASARKIARTIAESPLVKTAFAGEDANWGRIVMAVGRAD----EPVAREK
ARGJ_NEIMA       ITVRVENAKTRDEARQAAYAVARSPLVKTAFFASDPNLGRLLAAIGYAGV---ADLDTDL
ARGJ_RALSO       MTIRVEGGRSVDECRQVAYAVAHSPLVKTAFYASDPNLGRILAAVGYAGV---NDLDVDG
ARGJ_PSEPK       VTVQVNGGGNHQECLDVGYAVAHSPLIKTALFASDPNWGRILAAVGRAGV---PELDVSL
ARGJ_PSESM       VTVEVNGGGNHQECLDVGYAVAHSPLIKTALFASDPNWGRILAAVGRAGV---PDLDVSK
ARGJ_PSEAE       VTVQVNGGATHQECLDVGYAVAHSPLIKTALFASDPNWGRILAAVGRAGV---ANLDVSK
ARGJ_CHLTE       VELRVTGAKSNEEARMAAMTVANSPLVKTAIHGEDANWGRIIAAAGRSG----ASFVQEE
ARGJ_YEAST       VTVNVKNALHFEDAKIIAESISNSMLVKTALYGQDANWGRILCAIGYAKLNDLKSLDVNK
                 .   :                  . * * *  . : * **:  : *              

ARGJ_METAC       LSLSFSAGG----ETVELVKSGEISRVS---DLALLNKIMAN--------------EEII
ARGJ_METMA       LTLSFSGGG----EEVELVKAGEISTAS---DLSLLKKIMAN--------------DEII
ARGJ_ARCFU       ITLSLSDGR----DEVFLIDSG-RPLGN---EERARVLMEKA--------------EELV
ARGJ_METJA       VDVILSNYK----DEVYLVKDGIPLADEGTEELKKAEEIMKS--------------DEIK
ARGJ_METTH       ISVTLESDS----ESVVIVDHGDILAFEGTEELETAERVMTS--------------KEIR
ARGJ_METKA       LRIAFRSSE----GEIVTYEGGPVDFDE-----EKAKRVLSA--------------SEVE
ARGJ_HELHP       LRIAF--------DSVVVFDRGQICFDE--ENEARAAAVMEQ--------------ESFR
ARGJ_COREF       IAVYF--------NDQAVCLDSTGAPGAR-----EVDLSGAD----------------IA
ARGJ_CORGL       ISVFF--------NGQAVCLDSTGAPGAR-----EVDLSGAD----------------ID
ARGJ_MYCLE       LCMSF--------NGAAVCIDGVGTPCAR-----DVDLSTAD----------------ID
ARGJ_MYCTU       ISVSF--------NGAAVCVHGVGAPGAR-----EVDLSDAD----------------ID
ARGJ_STRCO       LNVAI--------NGVWVCKNGGVGEDRE-----LVDMRYRE----------------VH
ARGJ_BIFLO       VTVDV--------NGVRICENGGAGRDRS-----EVDMTPRE----------------VH
ARGJ_DEIRA       MKVSV--------QGVPVFAGGPLNYDAA---AVSQSMKTDE----------------VI
ARGJ_THET2       VRIVL--------QGIPLYEGAVLPFDRE---EAGQAMRAEE----------------VE
ARGJ1_NOSS1      LQIQL--------GDFLLLDNGQPLPFDR---AAASAYLKQAA------TGAYLQQDTVL
ARGJ_SYNY3       LLIKL--------GNYVLMDQGQPLEFDR---PGASNYLKQAA------SGAYLEQDTVL
ARGJ_THEEB       LAIAL--------GGIPMMRHGQPLPFDP---AAAHAYLVQQAAASTDASGQQSIDHPVV
ARGJ_CITLA       LKVSL--------GNILLMDGGEPQSFDR---AAASNYLRRAG----------ETHDTVR
ARGJ_BACAM       VEVYL--------GGQCLFKNNEPQPFS----ESIAKEYLEG--------------DEIT
ARGJ_BACSU       VEVYL--------GGQCLFKNNEPQPFS----ESIAKEYLEG--------------DEIT
ARGJ_BACHD       IDIAI--------GPIVTLKQSEPTGFS----EEEATAYLKEA-------------DPVK
ARGJ_GEOSE       VDVAI--------GPMVMLKGSEPQPFS----EEEAAAYLQQ--------------ETVV
ARGJ_STAAM       TYVQL--------NQIPVVDKGMAVLFD----EQAMSNTLTH--------------EHVT
ARGJ_STAAW       TYVQL--------NQIPVVDKGMAVLFD----EQAMSNTLTH--------------ENVT
ARGJ_OCEIH       LSIAI--------GGIQVVNNGEPIDFD----EKDCKQALNQ--------------ETVN
ARGJ_LISIN       ITIKI--------GGIEILNHSSQTIFN----QQALDAYLEE--------------EHIV
ARGJ_LISMO       ITIKI--------GGIEILNHSSQTIYN----QQALDAYLEE--------------EHII
ARGJ_STAES       VDIFI--------GRIPVLIRSSPVKYD----KEEIQEIMSA--------------EEIS
ARGJ_STRMU       IDIYL--------ADIPVMLASSPVDFD----EEDMQDVMRA--------------DTIK
ARGJ_LACLA       IELKL--------QDELVLYHSTPVDFD----AAFLSEKLKE--------------DKIE
ARGJ_LACPL       VDIEM--------NGVLLVQQSLAVDFD----MAAVQATLRD--------------NQIM
ARGJ_THEMA       LDLFFESEA----GRIKVAENGQGVSFD----EEEAKKILSE--------------KKIR
ARGJ_CALS4       VDIYLKSAK----GEVKVCENGSFFAFD----ESLAKEVLKE--------------KEIF
ARGJ1_CLOAB      VDISFSNND----SKVETCLKGTGLNFD----EEAAKKILDG--------------DHVI
ARGJ2_CLOAB      IEIAF--------NSNVIYDKGKIYEENFD----CIERYLRD-------------NNECK
ARGJ_LEPIN       LQIYF--------GTLPVKEAN---PETLK----KLSEYLKN-------------NTEIS
ARGJ2_NOSS1      VVIRF--------DEVQVYPNT-FQAENLE----KLKEIMS--------------KEKVN
ARGJ_AQUAE       LEIYV--------GGYLLYDGK-PHDENLE----KAKKHLIE-------------DREVD
ARGJ_AGRFC       LAIWFGGV--------RVAVNGERDPDYS---EAETTAVMRL--------------EDIT
ARGJ_RHIME       LAIWFGDI--------RVAVEGERDPAYS---EAAATAVMQG--------------ETIP
ARGJ_BRUME       LAIWFGDI--------RVAHQGERDPAYS---EDATSAYMEG--------------EDIR
ARGJ_BRUSU       LAIWFGDI--------RVAHQGERDPAYS---EDATSAYMEG--------------EDIR
ARGJ_RHILO       LSIWFGDI--------RLAHEGERDPGYS---EEATSTYMKR--------------DDIR
ARGJ_BRADU       LSISFNGI--------RVARSGARDPDYD---EAQVSEAMKA--------------PEIA
ARGJ_CAUVC       ISVKFGDL--------YAARDGLISAEYD---EAKMSAYVKN--------------QAFE
ARGJ_NEIMA       VEMYLDDI--------LVAEHGGRAASYT---EAQGQAVMSK--------------AEIT
ARGJ_RALSO       VNLWLDDV--------WVARDGGRNPDYR---EEDGQRVMKQ--------------AEIT
ARGJ_PSEPK       IDVYLDSV--------CIASKGGRSPSYT---EAQGSAVMAQ--------------EEIT
ARGJ_PSESM       IDVFLGGV--------CIASQGCRATTYT---EEQGSAVMAE--------------AEIT
ARGJ_PSEAE       IDVFLGDV--------CIASRGGRAASYT---EEQGAAVMAQ--------------AEIG
ARGJ_CHLTE       LSVYFDDE--------PILKPG-LDANFS---EERAKEVMSK--------------EEFT
ARGJ_YEAST       INVSFIATDNSEPRELKLVANGVPQLEID---ETRASEILAL--------------NDLE
                   : .                                                       

ARGJ_METAC       ITLDFGMG-KESATAWGCDLTYDYVRINAEYTT--
ARGJ_METMA       INLDLAMG-EESATAWGCDLTYDYVRINAEYTT--
ARGJ_ARCFU       IRLRLEKG-NGKGFAIGCDLTYDYVKLNAEYTT--
ARGJ_METJA       IVVDLKMG-EFENVCYGCDLSYEYVRINAEYTT--
ARGJ_METTH       IIVDLAAG-DESATAYGCDLTYDYVRINAEYTT--
ARGJ_METKA       IVVDLGVG-DASARAWGCDLTYEYVRINAEYRT--
ARGJ_HELHP       ITCDLGIG-EGHFVAYGCDLGYRYIDINADYRS--
ARGJ_COREF       VRVDLGAGGEGQATVRTTDLSYSYVEINSAYST--
ARGJ_CORGL       VRIDLGTSGEGQATVRTTDLSFSYVEINSAYSS--
ARGJ_MYCLE       ITVDLRIG-DSAATIRTTDLSHTYVEENSAYSS--
ARGJ_MYCTU       ITVDLGVG-DGQARIRTTDLSHAYVEENSAYSS--
ARGJ_STRCO       IVADLAAG-DATATIWTNDLTADYVHENSAYSS--
ARGJ_BIFLO       IDIDLNTGSDAEATVWTDDLTHEYVHINADYES--
ARGJ_DEIRA       FDVDLGVG-SARGEAWGCDLSAEYVSINADYTT--
ARGJ_THET2       VLVDLREG-QGAGEAYGCDLTEDYVRINALYTT--
ARGJ1_NOSS1      ISVKVGNG-HGTGKAWGCDLSYDYVKINAEYTT--
ARGJ_SYNY3       IQVDLGTG-SGQGTAWGCDLSYDYVRINADYTT--
ARGJ_THEEB       IEVSIGSG-SGRGVAWGCDLSYDYVKINAEYTT--
ARGJ_CITLA       IFISIGDG-QGEGRAWGCDLSYDYVKINAEYTT--
ARGJ_BACAM       IVIKMAEG-DGNGRAWGCDLTYDYIKINASYRT--
ARGJ_BACSU       IVIKMAEG-DGNGRAWGCDLTYDYIKINASYRT--
ARGJ_BACHD       ISVNLHIG-NGTGKAWGCDLTYDYVRINAGYRT--
ARGJ_GEOSE       IEVDLHIG-DGVGVAWGCDLTYDYVKINASYRT--
ARGJ_STAAM       IDVQLGLG-NAAATAYGCDLSYDYVRINASYRT--
ARGJ_STAAW       IDVQLGLG-NAAATAYGCDLSYDYVRINASYRT--
ARGJ_OCEIH       IVIDLQSG-MDTATAWGCDLTYDYIRINASYRT--
ARGJ_LISIN       IEVDLHIG-LESGTAWGCDLSYEYVKINACYRT--
ARGJ_LISMO       IEVDLHIG-LESGTAWGCDLSYEYVKINACYRT--
ARGJ_STAES       IQLDLHQG-NCEGQAWGCDLSYDYVKINALYTT--
ARGJ_STRMU       IIVDLHAG-DSVGKAWGCDLSYDYVKINALYRT--
ARGJ_LACLA       IIADLNAG-SGLGQAWGCDLTYKYVEINALYTS--
ARGJ_LACPL       IDVDLHHG-TASGQAWGCDLTYNYVKINASYHT--
ARGJ_THEMA       IILDMKQG-KETAKAWGCDLTEKYVEINGRYRT--
ARGJ_CALS4       IIVDMKAG-EFMATSWGCDLSYDYVKINGSYRT--
ARGJ1_CLOAB      IEVNLNNG-KFNATAWGCDLTYDYVKINGSYRS--
ARGJ2_CLOAB      IQANLNVG-DFAATVWGSDFTEDYIRINSYYTKRK
ARGJ_LEPIN       LNVVLNVG-TISMKFWGCDFTEKYIEENAYYTT--
ARGJ2_NOSS1      IHVSLNIG-TDVATVWGCDLTEGYVEINGKYST--
ARGJ_AQUAE       ITVELNEG-EYEWVCYSSDIGYDYIKLNAEYTT--
ARGJ_AGRFC       VKVDIGLG-QGTATVWTCDLTKEYVAINGDYRS--
ARGJ_RHIME       IRVDIGLG-SGRATVYTCDLTKEYVEINGDYRS--
ARGJ_BRUME       IRVDLSIG-RGKATVWTCDLTKEYVAINGDYRS--
ARGJ_BRUSU       IRVDLGIG-RGKATVWTCDLTKEYVAINGDYRS--
ARGJ_RHILO       IRADIGIG-RGKATVWTCDLTKEYVAINGDYRS--
ARGJ_BRADU       IKVSLGLG-KGRDRVMTCDLTKEYVAINGDYRS--
ARGJ_CAUVC       VSVDVGVG-RGSATVWTCDLTKQYVAINGDYRS--
ARGJ_NEIMA       VRIKLHRG-QAAATVYTCDLSHGYVSINADYRS--
ARGJ_RALSO       VRIALGRG-DATATVWTCDFSHDYVSINADYRS--
ARGJ_PSEPK       IRIELGRG-QCSETIWTTDLSHEYVKINAEYRT--
ARGJ_PSESM       IRIELGRG-DCSETIWTTDLSHEYVKINAEYRT--
ARGJ_PSEAE       IRIELGRG-TCSETIWTTDLSHEYVKINAEYRT--
ARGJ_CHLTE       ITLSLGKG-AGRATVWTCDLSHGYIEINGSYRS--
ARGJ_YEAST       VSVDLGTG-DQAAQFWTCDLSHEYVTINGDYRS--
                 .   .  .          *:   *:  *. * .