CLUSTAL format seed alignment for MF_01107

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ARGD_METTH            --------------------------------------------------MDS-------
ARGD_METAC            ---------------------------------------------MTENIIESGDPQARY
ARGD_ARCFU            ------------------------------------------------------------
Q5SJU9_THET8          ---------------------------------------------------MDLDAFTLF
ARGD_COREF            -----------------------------------------------MKNLATVED----
F8E0T1_CORRG          -------------------------------------MTTPKQYAEQNPEQGNGQN----
ARGD_MYCTU            ----------------------------------------------MTGASTTTAT----
C3JQR6_RHOER          ---------------------------------------------------MSTID----
ARGD_STRCL            ---------------------------------------------------MSNQE----
D7BYP9_STRBB          ---------------------------------------------------MSNEQ----
J7LHM4_NOCAA          ---------------------------------------------------MTSSD----
ARGD_BIFLO            -------------------------------------------MATEHEEKLGTED----
K4IRC3_BIFAP          -------------------------------------MTKADAPTAETVEPMRTPEGPQS
ARGD2_BORPA           ----------------------------------MEFSQFKVN-----------------
ARGD_RALSO            ----------------------------------MAFADYPVQ-----------------
ARGD2_BRADU           ----------------------------------MTTATHPYD-----------------
D2BIK8_DEHMV          ---------------------------------MDNWQELEHK-----------------
ARGD_PROMA            -------------------------------MVDAPHSKCGTFGFVGSSP----------
A2BY08_PROM5          -----------------------------MELVDAPHSKCGTFGFVGSSP----------
ARGD_NOSS1            -----------------------MSLQTLIEQATNPPESGSAASSPFSTD----------
E6UBF2_RUMA7          ------------------------------------MNTIEQFNE---------------
D8IAY1_BRAP9          --------------------------------MACKKNNNNQNNEKSKLKKEYINNSK--
ARGD_HAEDU            ----------------------------------MTSDQIKQLDAN--------------
Q187Z9_CLOD6          ---------------------------------MNNDNTISKWNE---------------
ARGD_WOLSU            -----------------------------------MGEALDKE-----------------
A6Q3W6_NITSB          ----------------------------------MNLQAIDQT-----------------
ARGD_CANGA            ------MYKRYFSTSLK----------------TNQQALKKILEEK--------------
ARGD_YEAST            ------MFKRYLSS-------------------TSSRRFTSILEEK--------------
ARGD_NEUCR            -MAFRTALRRVAAVNAAPATRLAGAGAGAATAARRSYATASQLTHPDPTEDSPSG-----
ARGD_YARLI            -------MNRFSKI--------------------RQYSTLLQTAEK--------------
ARGD_DEBHA            --MLRNIPRSLRKDGGK-------RIPGLISRVANQFSTTSSLLNKKSIPDAPEDSHT-G
ARGD_SCHPO            -MFQRRSLLSVRSSGSQ-----------------IAFRRFVSLTHKDPTPDTTSCNII-K
ARGD_DICDI            MFNKLNKINKIKNCFNK-------------SIYQINYSSKPIFKEGITNVKLDRDNKDGT
ARGD_CAMJE            ----------------------------------MDYKEQ--------------------
A4XM22_CALS8          ----------------------------------MKIDEIISYDKQ--------------
ARGD_YERPE            -------------------------------MTDKLAVNRNTFDQ---------------
ARGD_ECOLI            ------------------------------MAIEQTAITRATFDE---------------
ARGD_SHEON            -------------------------------MSVDMKLNRAQFDA---------------
ASTC_SALPC            ---------------------------------MSLSVTRENFDE---------------
ASTC_SALNS            ---------------------------------MSLSVTRENFDE---------------
ASTC_SHIB3            ---------------------------------MSQPITRENFDE---------------
ARGD_BUCAP            ------------------------------MIGKIKLITRDSFNK---------------
ARGD_XANAC            --------------------------------MSTAADSPLSLAH---------------
ARGD_XYLFT            --------------------------------MSAVSESVLSLSR---------------
ARGD1_BRADU           -----------------------------------MIVMTNSAAP---------------
ARGD1_CAUVC           -------------------------------------------MS---------------
ARGD2_CAUVC           ---------------------------------MSTATSSTTSQH---------------
ARGD_MYXXA            -----------------MTALSQSEPSLSASSDSSTDALVQKAKR---------------
ARGD_CHLTE            --------------------------------------------MNT------------P
B3EFM7_CHLL2          --------------------------------------------MKQ------------L
I3ZFJ4_TERRK          --------------------------------MKLDNGRMKLDNMKQDGTITGGAADMNL
Q312C1_DESAG          --------------------------------------------MTT------------F
T2GCQ9_DESGG          -------------------------------------------MDAR------------F
ARGD1_BORPE           ------------------------------------------------------------
F4GBM1_ALIDK          -----------------------------------------------------------M
N8SJL7_ACILW          ------------------------------------------------------MNNITL
N9GR10_ACIHA          ------------------------------------------------------MTNITL
Q4FSU9_PSYA2          ------------------------------------------------------------
ARGD2_PSESM           ------------------------------------------------------------
A0A2S6F968_LEGPN      ------------------------------------------------------------
ARGD_LEPIN            -------------------------------------------------MNDADIHKELF
ARGD_BACSU            ------------------------------------------------------------
ARGD_BACCR            ------------------------------------------------------------
ARGD_LACPL            ------------------------------------------------------------
I9L3N6_LACPE          ------------------------------------------------------------
ARGD_LISIN            ------------------------------------------------------------
ARGD_STRMU            ------------------------------------------------------------
ARGD_STAEQ            ------------------------------------------------------------
ARGD_LACLA            ------------------------------------------------------------
F2F8U6_SOLSS          ------------------------------------------------------------
D5EL86_CORAD          ------------------------------------------------------------
D2R6P7_PIRSD          -------------------------------MATTHPHEVAPLSSADTVE----------
Q9RZC5_DEIRA          --------------------------------------MTATQAKPRQPDLKTSLPGPKT
Q1IZP5_DEIGD          ---------------------------------------MTILPKPRRPELKTALPGPKT
                                                                                  

ARGD_METTH            EEIIELERKFIMQTYTRQP-IVLSHGKGATVWD-IEGNSYIDCFAGVAVNSIGHAHPKVA
ARGD_METAC            DSVIEKDSKYVMQTYGRQP-LVLSKGKGAVVQD-IYGKEYIDCVAGIAVNNVGHCHPTVV
ARGD_ARCFU            MDWIEREKKHILQTYTRQK-VVIERGEGCYVYD-VNGKRYLDLVAGIATVSIGHCNSHLV
Q5SJU9_THET8          ERHINPGLAGLLR-FTGLD-RVESHAEGPYVWD-TQGKRYLDFLGLYGTLNLGHRHPKVV
ARGD_COREF            --TLTSWPQVLLNTYGTPP-VELVTGKGSTVTD-ADGNVYIDLLAGIAVNALGHAHPAII
F8E0T1_CORRG          --WQQHWEADVMGTYGTPQ-RQLVRGAGAHVTD-SEGSTYLDLLAGIAVNALGHGHPAMV
ARGD_MYCTU            --MRQRWQAVMMNNYGTPP-IALASGDGAVVTD-VDGRTYIDLLGGIAVNVLGHRHPAVI
C3JQR6_RHOER          --LQQRWSASLMNNYGVPR-VALVRGDGAVLTD-ADGKQYVDFLAGIAVNILGHGHPAVV
ARGD_STRCL            --FAQRWQGVMIDSYGTPG-LSFVRGEGSTLWD-ADGTAYTDFVSGLAVNALGHAHPAVV
D7BYP9_STRBB          --LTQRWQGALMDNYGTPR-VPLTHGEGAKVWD-ADGKEYLDFVGGIAVNALGHAHPAVV
J7LHM4_NOCAA          --LRERFEASLMPNYGVPP-IALTLGRGCEVYD-ADGRQYLDLIAGIAVSSLGHGHPALV
ARGD_BIFLO            SKWLGEYSQVHMNVFGTPL-RVMDHGQGAHIWD-VDGNEYLDFLAGIAVNSLGYAHPKWV
K4IRC3_BIFAP          SQWADRYERVHMQVFGRPG-RVMDHGRGAWIWD-LDGNRYLDMMAGIAVNALGYAHPAWN
ARGD2_BORPA           ---------ALMEITACPD-LVFVRGQGSWLED-HAGKRYLDFVQGWAVNTLGHCAPEMK
ARGD_RALSO            ---------SLMYITNRPE-IVFTEGKGSWLTD-HNGKRYLDFVQGWAVNCLGHSNDGMI
ARGD2_BRADU           ---------ALMDITARPK-AVFVRGAGSYLWD-DSRKRYLDFVQGWAVNCLGHSPSAIA
D2BIK8_DEHMV          ---------YYMQTFYRAP-ITIVKGQGVKVWD-DAGKEYLDFVAGWAVNSLGHCHPAVV
ARGD_PROMA            -----TAPTFLLDTYKRLP-LKIVKGNGCWLWD-ETGKKYLDAVAGIATCSLGHSDKKLS
A2BY08_PROM5          -----TAPT-LMNTYTRFN-ISFKKGEGCWLWD-TRGKKYLDAVAGIATCSLGHSDRILR
ARGD_NOSS1            -----SFDASVMSTYGRFP-LALERGAGCRVWD-TQGKEYLDFVAGIATCTLGHAHPAMV
E6UBF2_RUMA7          ---------HVMPTYGRYD-LVLDKGAEQTAVS-EDGKQYIDFGSGIGTNSLGYCNEEWV
D8IAY1_BRAP9          --------KYVANTYARFD-LVLESAKDTKLKD-VEGKEYIDLGSGIGVNSIGYGNKNWI
ARGD_HAEDU            ---------YIAQTYAKFD-LALSHGQGCEVWD-FDGNKYLDFTSGIGVNSLGWADPDWL
Q187Z9_CLOD6          ---------YFIDTYNQPN-FVIDYGEGSCFFD-TNGNKYIDFTSGYGVSSLGYSNSNLK
ARGD_WOLSU            ---------YVLHSYGRNY-VQFTQGKNATLWD-SEGKDYIDFASGIAVCSVGHGNERLA
A6Q3W6_NITSB          ---------YVLHTYARNY-VNFVQGDNAKLYD-DTGKEYIDFTSGIGVVSVGHGNKRLA
ARGD_CANGA            --------TYQVTTYARPSDLCITRGLNAKLFDDFNNKEYIDFTAGIAVTALGHANPKVA
ARGD_YEAST            --------AFQVTTYSRPEDLCITRGKNAKLYDDVNGKEYIDFTAGIAVTALGHANPKVA
ARGD_NEUCR            -KMVREHVPYMVTTYSRPP-PVFVKGKGSYLWD-LEDRKYLDFTSGIAVNSLGHCDEEFS
ARGD_YARLI            ---------YSVPTYAKPS-VILTKGKGAYLWD-SNDNKYIDFSAGIAVTALGHSNPEIT
ARGD_DEBHA            QYINTITKPFTVTTYARPN-VVMTHGKGSYLYD-LENRQYLDFSAGIAVTCLGHSHSKIT
ARGD_SCHPO            -----KEGANIISVYARYP-VVAAKGEGSYLFD-KEGRKYIDFTSGVAVTSLGHAHPEVA
ARGD_DICDI            SDYIKLHDNVIMNTYGRVSDIVFTHGKDSWLYD-MKGDKYLDFGAGIAVNALGHSNDGWS
ARGD_CAMJE            --------SHIIPTYKRFD-IVLEKGQGVYLFD-DKAKKYLDFSSGIGVCALGYNHAKFN
A4XM22_CALS8          ---------HYVNVFGDRIPIAFEKGEGCILYD-TENREYLDFISGISVCNLGHSHPKFV
ARGD_YERPE            ---------VILPVYAPAQ-FIPVKGKGSRVWD-QQGTEYIDFAGGIAVTALGHCHPALV
ARGD_ECOLI            ---------VILPIYAPAE-FIPVKGQGSRIWD-QQGKEYVDFAGGIAVTALGHCHPALV
ARGD_SHEON            ---------VMVPNYAPAA-VIPVRGEGSRVWD-QEGNEFIDFAGGIAVNCLGHCHPALV
ASTC_SALPC            ---------WMVPVYVPAP-FIPVRGEGSRLWD-QQGKEYIDFAGGIAVNALGHAHPALR
ASTC_SALNS            ---------WMVPVYVPAP-FIPVRGEGSRLWD-QQGKEYIDFAGGIAVNALGHAHPALR
ASTC_SHIB3            ---------WMIPVYAPAP-FIPVRGEGSRLWD-QQGKEYIDFAGGIAVNALGHAHPELR
ARGD_BUCAP            ---------LILPVYNPAF-FIPVKGKGSRLWD-QKGKEYIDFSGGIAVTSLGHCHPVLN
ARGD_XANAC            ---------YYLPVYRPRQ-VVLERGQGSRVWD-DAGREYLDLSSGIAVSGLGHNDPDLV
ARGD_XYLFT            ---------YYLPVYRPCQ-VVLVRGQGSRVWD-EQGRDYLDLAAGIAVCCLGHCDPDLV
ARGD1_BRADU           ---------HLLPVFARSD-LGFERGEGCWLIA-TNGDRYLDFTSGVAVNALGHAHPALV
ARGD1_CAUVC           ---------ALMNTYARAN-IDIVRGEGCWLYD-QDGRDYLDLAAGVAVNTLGHGDPRLV
ARGD2_CAUVC           ---------HIMGVYNRAP-LAFERGRGARLIS-TEGEEYLDCVAGIATNGLGHAHPALV
ARGD_MYXXA            ---------HLLQNYKQPP-FVLARGQGARVWD-MDGREYLDLIGGIATCALGHCHPEVV
ARGD_CHLTE            AINLETEKQLFFHNYARLP-LDIASGKGSFLYT-ASGERYLDMIAGVGVNAIGYGDKRLE
B3EFM7_CHLL2          PVTQETEKALFFHNYARLP-IAITHGEGCWLVS-DDGTRYLDMIAGIGVNALGYGDERLL
I3ZFJ4_TERRK          VATQAAEQKLLLQTYDRHP-ILLTRGEGVHLFD-DAGNEYLDLLSGIGVSALGYGHPAIT
Q312C1_DESAG          DELKQREESLLCRTYGRYP-LAVASARGSVLTD-FSGREYIDLLSGIAVTNLGHCHPALA
T2GCQ9_DESGG          STLKAREQAAVCRTYGRYP-LEIASAKDCRLYD-FEGKAYVDLLAGVAVVNCGHAREDLA
ARGD1_BORPE           ------MSSALANIYARLP-VSFTHGRGVWLWD-TGERRYLDALAGIGVSCLGHGHPGLV
F4GBM1_ALIDK          TALIEAASPHVMNTYGRVP-IALERGQGVRVWD-VNGKQYLDGLGGIAVNTLGHNHPRLV
N8SJL7_ACILW          APVQTDQPSHLMPVFGRQP-ISFVRGRGAYLYT-EDGTEYLDALTGIAVCGLGHAHPVIA
N9GR10_ACIHA          APVQPDQPSHLMATYGRQA-ISFVRGRGAYLYT-ADGTEYLDALTGIAVCGLGHAHPVIA
Q4FSU9_PSYA2          -----MSATYLMPTYLRQP-ISFTRGSGSWLYT-RDETPYLDALTGIAVCGLGHCHPQVT
ARGD2_PSESM           -----MTTACLMSTYQPLA-LSFTRGLGTRLWD-QSGREYLDAVAGVAVTNVGHSHPMLV
A0A2S6F968_LEGPN      --------MSLITSYSPMP-VTFTHGEGVWLYD-EQGKKYLDGLSGIAVCGLGHAHPDVT
ARGD_LEPIN            QHTKELADHYLLNTYARYD-VAFRYGVNELLFD-FDNKQYIDFHCGVAVTNLGHADPDII
ARGD_BACSU            -------MSSLFQTYGRWD-IDIKKAKGTYVED-QNGKTYLDFIQGIAVSNLGHCHEAVT
ARGD_BACCR            ------MTSHLFQTYGRRT-IEFVKGTGTKVID-NKGKEYLDFTSGIGVCNLGHCHPTVL
ARGD_LACPL            -----MTMQHVFPTYQRFP-FAITDGQGVHLTD-NHGKTYLDFTAGIGVCNFGYHQPQIQ
I9L3N6_LACPE          -----MTMQHVFPTYQRFP-FVIEDGQGVHLTD-NHGNTYLDFTAGIGVCNFGYHQPQIQ
ARGD_LISIN            -------MKHVFPTYNRFP-VDIVKGNGTVVKD-ATGKTYLDFTSGIAVCNLGHCPENVT
ARGD_STRMU            -------MSNLFQNYTRAD-LEFIKAEGNYLFD-TQGKKYLDFSTGIGVTNLGFHP-QVQ
ARGD_STAEQ            -------MSYLFNNYKRDN-IEFVDANQNELID-KDNNVYLDFSSGIGVTNLGFNM-EIY
ARGD_LACLA            -------MTNLFENYGRLP-FSLIKGEDQYLFD-DRGNKYLDFTSGIGVMNLGYSFEKGK
F2F8U6_SOLSS          -------MSALFQNYARRP-FAIVEGKGTEVFD-TTGKRYLDFTSGIAVCSLGHAHPSIV
D5EL86_CORAD          -----MHHPTLMKNYGPPA-FNAVRGEGVYLYD-DADKRYLDFSSGIAVTSIGHSHPKWV
D2R6P7_PIRSD          -----LFKQYVIGNYTRYP-VNLVRGEGSLVWD-AEGNRYLDFFPGWGCNLLGHCPEKIV
Q9RZC5_DEIRA          AEIMARDQATLSTSYMRPYPFVPDFGKGVWLTD-VDGNTMLDFFAGIAVSTTGHAHPHVV
Q1IZP5_DEIGD          RAILERDAQHLSTSYMRPYPFVPDHGEGVWLTD-VDGNTMLDFFAGIAVSTTGHAHPHVV
                                               .               *     .    *       

ARGD_METTH            LAICHQAQRLIHSS-NIYYTREQVELAKLLTAIS-------------------PHDRVFF
ARGD_METAC            KAIQAQAENLIHVS-NLYYTEIQAEFAETLASIT-------------------GMERVFF
ARGD_ARCFU            ERLKEQLEKLIHIS-NLYYTTPQVELAEKLSEIA-------------------GMDRFFF
Q5SJU9_THET8          EAVKRQLDRMPMSV-RVLVSEPTARLAAKLAEITPE-----------------GLEMVFF
ARGD_COREF            EAVTTQLSQLGHVS-NLFATRPVVEVAAELVQRFALDDATIASQ-----------TQVFF
F8E0T1_CORRG          QAVTEQMNTLMQTS-NVWAHPQVMELASQVKSIVAEGFASEVDAHGNPVSESIQGAKVFF
ARGD_MYCTU            EAVTRQMSTLGHTS-NLYATEPGIALAEELVALLGA----------------DQRTRVFF
C3JQR6_RHOER          EAVTTQLSTLGHVS-NLYASEPVVELAEQLLAHLG-----------------NVTGRAFF
ARGD_STRCL            GAVSRQIASLGHIS-NFYSAEPTITLAERLIELFG------------------RPGRVFF
D7BYP9_STRBB          RAVSDQIATLGHVS-NLFIAEPPVALAERLLQLFG------------------RPGRVYF
J7LHM4_NOCAA          KAVAHQAATLAHTS-NLFVHEREVQLAERLIGLLG------------------GDAKVFF
ARGD_BIFLO            KAVADQAAKVAHIS-NYFASEPQIELASKLVKLAGAP----------------EGSKVYF
K4IRC3_BIFAP          KALVEQAGKMAHIS-NFFASQPQIELAERLLDLAQAP----------------KGSRVFF
ARGD2_BORPA           RALAEQADKLMNPS-PAFYNLPSIELAQRLTSASCFD-------------------RVFF
ARGD_RALSO            EALNAQAKKLINPS-PAFYNEPMAKLAGLLSAHSCFD-------------------KVFF
ARGD2_BRADU           DALAAQAKRLLTPS-PAFYNEPSLKLAQALVANSAFD-------------------QVFF
D2BIK8_DEHMV          KAVSEQAGILIQTS-NNFYTIPQLKLAQLLVDNSVLD-------------------RIFF
ARGD_PROMA            KVLSQQLRKIQHVS-NLYRIPEQEDLAQWLVNQSCAD-------------------SVFF
A2BY08_PROM5          KKLVAQLKKLQHIS-NLYKIEEQEELSKYLTKQSCAE-------------------SVFF
ARGD_NOSS1            EAVTRQIQKLHHVS-NLYYIPEQGELAQWIIQHSCAD-------------------RVFF
E6UBF2_RUMA7          DAVCAQVKKIQHTS-NYYYTKVQADFAQKLCGITGYS-------------------KMFF
D8IAY1_BRAP9          NAVVNQAKTLQHTS-NLFYTKPYIDLAKKLCSITKYD-------------------KVFF
ARGD_HAEDU            EAVIAQLHKLSHTS-NLFYTEPSARLAKHLVQVSGLK-------------------RVFF
Q187Z9_CLOD6          NALKEQVDKLLHTS-NLYFNEPVLCSGEKIINSSGMA-------------------KVYF
ARGD_WOLSU            GAICDQAKKLIHTS-NLYYIEPQARLAEKLVKLSGYDM------------------RVFF
A6Q3W6_NITSB          EAICDQAQKIIHIS-NLYLIEPQARLAQKIVDLSEYDM------------------RLFF
ARGD_CANGA            EILQTQATKLVHSS-NLYFTKECLDLSEKLIEKTKKFGGQHDAS------------KVFL
ARGD_YEAST            EILHHQANKLVHSS-NLYFTKECLDLSEKIVEKTKQFGGQHDAS------------RVFL
ARGD_NEUCR            KIIAEQAQELVHAS-NLYYNPWTGALSKLLVESTKASGGMHDAS------------SVFV
ARGD_YARLI            KILAEQSSQLMHCS-NLFNNEWAPRLQESLVEETLKSGGMKGAR------------KVFL
ARGD_DEBHA            EIISDQAATLMHCS-NLYHNLYAGELANKLVTNTINSGGMKEAQ------------RVFL
ARGD_SCHPO            RLAADQCSKLVHSS-NLFYNEPAIELSNVINNSLAKNSGIAGPT------------KIFF
ARGD_DICDI            EVVANQSKKLTHLS-NLYYNQPAIELAQSMIASTPIF------D------------KVFF
ARGD_CAMJE            AKIKAQVDKLLHTS-NLYYNENIAAAAKNLAKASALE-------------------RVFF
A4XM22_CALS8          AALKDQIEKLIHTS-SLFYIENQTLLAKKLCEISPFD-------------------KVFF
ARGD_YERPE            SALHQQGETLWHTS-NVFTNEPALRLAQKLIAAT-FADRV------------------FF
ARGD_ECOLI            NALKTQGETLWHIS-NVFTNEPALRLGRKLIEAT-FAERV------------------VF
ARGD_SHEON            NALKTQGEKLWHLS-NVMTNEPALELATKLVNST-FAERV------------------YF
ASTC_SALPC            EALNEQANRFWHTG-NGYTNEPALRLAKKLIDAT-FAERV------------------FF
ASTC_SALNS            EALNEQANRFWHTG-NGYTNEPALRLAKKLIDAT-FAERV------------------FF
ASTC_SHIB3            EALNEQASKFWHTG-NGYTNEPVLRLAKKLIDAT-FADRV------------------FF
ARGD_BUCAP            KVLRQQSKKLWHIS-NIFTNEPALRLADKLISSS-FASRV------------------FF
ARGD_XANAC            AALTEQAGKLWHTS-NVFFSAPPLKLAEELVSASRFAHKV------------------FL
ARGD_XYLFT            AALVEQAGRLWHTS-NVFYSEPSLRLAQELVDVSRFAERV------------------FL
ARGD1_BRADU           KALQEQATKLWHMS-NLFQSPDGEKLATRLCNES-FADFV------------------FF
ARGD1_CAUVC           QALKTQADILWHAS-NLYRLPAQEALATKLTDAT-FADRV------------------FF
ARGD2_CAUVC           EVLKAQAEKLWHVS-NIYRIPEQEELADALCANS-FADVV------------------FF
ARGD_MYXXA            AAAKAQLDSLWHVS-NVFYSQPQIDLAAQLTEWS-GLSRA------------------FF
ARGD_CHLTE            QAITEQASKYIHVS-NLFMQKPQFDLAAKLLEISRMSK-------------------VFF
B3EFM7_CHLL2          QAINAQAARLIHAS-NLFLLKPQFDLASRLLDISGLSK-------------------VFF
I3ZFJ4_TERRK          KAMMAQAATLLHTS-NLFYHDGTATLAVKLTELTGMDR-------------------VFF
Q312C1_DESAG          EVMHAQAGRLVHLS-NLFYQQEQLELAEKLLGTTHLGK-------------------AFF
T2GCQ9_DESGG          QAAYDQMLRLVHTS-NLCYTQEQVRLAEVLTRLSGLGK-------------------AFF
ARGD1_BORPE           AAISEQAARLIHTS-NIYEVPQQAALARRLAELSGMSE-------------------VLF
F4GBM1_ALIDK          PALQEQIAKLIHTS-NYYHVPGQEELARLLTGRARMTN-------------------AFF
N8SJL7_ACILW          EAIAEQAATLIHTS-NLFEVPWQTAAAQKLAEVAGMEE-------------------VFF
N9GR10_ACIHA          SAIAEQAATLVHTS-NLFEIPWQTAAAQKLAEVSGMEE-------------------IFF
Q4FSU9_PSYA2          DAIQQQAATLVHTS-NLFGIDWQERAGEALCNAAQMDS-------------------VFF
ARGD2_PSESM           DAIRDQAGLLLHTS-NLYSIDWQQRLAQKLTRLAGMDR-------------------VFF
A0A2S6F968_LEGPN      RTIQEQAARLIHTS-NVFHIKEQELLAAKLTSMARMEQ-------------------VFF
ARGD_LEPIN            EVVRSQADKLFHTS-NLFYSEEASKLAELLILNSFPGK-------------------VFL
ARGD_BACSU            EAVKKQLDSVWHVS-NLFQNSLQEQAAQKLAAHSAGDL-------------------VFF
ARGD_BACCR            KGVQEQLDDIWHIS-NLFTNSLQEEVASLLTENRALDY-------------------VFF
ARGD_LACPL            AAVTQQLTHIWHTS-NLYENELQDAVAGLLANGEE-RL-------------------VYF
I9L3N6_LACPE          QAVAEQLTHIWHTS-NLYENDLQDQVAGLLAHGED-RL-------------------VYF
ARGD_LISIN            EAIQSQLANIWHTS-NLYECALQDSVAELITDGTD-KL-------------------VFF
ARGD_STRMU            VALQKQAEQIWHTP-NLYQNSLQEEVAAKLMAGKD-YL-------------------AFF
ARGD_STAEQ            QAVYNQLNLIWHSP-NLYLSSIQEEVAQKLIGQRD-YL-------------------AFF
ARGD_LACLA            VAVKAQLDSLSHLS-NLYQNPLQEDVAEKLSQNHS-YK-------------------AFF
F2F8U6_SOLSS          ETIQKQSQKLWHIS-NLFESPGQEKLAASLVEDLHLSY-------------------AFF
D5EL86_CORAD          KAIQDQASNLAHCS-NLFGIPGQQKLADRLVAKTGPGR-------------------VLF
D2R6P7_PIRSD          RAVQEQVATLIHVP-NTWHMDVQGRWAQMLSQRSFGGK-------------------AFF
Q9RZC5_DEIRA          QAVQRQIEKFTHVCLTDYPQEITTSLAERLVKHVERPGEK---------------WRVFF
Q1IZP5_DEIGD          KAVQEQVTKFSHVCLTDYPQEITTSLAERLVRHVEQPGEK---------------WRVFF
                           *                       :                             .

ARGD_METTH            ANSGAEANEGAIKLARKFTG------------KSEIIAAENSFHGRTLATVTATGQKKYS
ARGD_METAC            CNSGAESVEAAMKLARVATG------------KSAFVAAEHSFHGRTIGALSVTHKSMYR
ARGD_ARCFU            CNSGAEAVEAALKFARRATG------------RKKFVSFTGDFHGRTMGALSVTHKEKFR
Q5SJU9_THET8          GNSGAEAVEAAIKLARAYTG------------KPGIVTTQGGFHGKTMGALSLTPKPEYQ
ARGD_COREF            CNSGAEANEAAFKLARLTG-------------RHRILAATNGFHGRTMGSLALTGQPDKR
F8E0T1_CORRG          CNSGAEANEAAFKIARATG-------------RSKILAAKRGFHGRTMGSLALTGQPDKQ
ARGD_MYCTU            CNSGAEANEAAFKLSRLTG-------------RTKLVAAHDAFHGRTMGSLALTGQPAKQ
C3JQR6_RHOER          CNSGTEANEAAFKLARATG-------------RKKIIAAEGSFHGRTMGALALTGQPAKR
ARGD_STRCL            CNSGAEANETAFKIGRLTG-------------RSRIVAAQSGFHGRTMGSLALTGQPAKR
D7BYP9_STRBB          SNSGAEAVEAAFKIGRRTG-------------RTHMVATAGGFHGRTMGALALTGQPAKQ
J7LHM4_NOCAA          TNSGTEANEAALKLVKRAAG----------PGRHYFVAAERGFHGRSSGSLALTGKDSIR
ARGD_BIFLO            GNSGAEGNEAALKLAKLYGRTLPGALPSIGGKPARILAMTHGFHGRTMGALSATWKPGIR
K4IRC3_BIFAP          ANSGTEANEAAIKLARLHG-------ARMGGHPGRILALTHSFHGRSMGSLSLTWKPAIR
ARGD2_BORPA           ANSGAEANEGAIKLARKWGRVNRNGA-------YKIITMNHGFHGRTLATMSASGKPGWD
ARGD_RALSO            ANSGAEANEGAIKLARKWGKKHKSGAG---KNRFEIITFDHSFHGRTLATMSASGKAGWD
ARGD2_BRADU           ANSGAEANEGAIKLARKYGSLHKGGA-------FEIISFEGGFHGRTLATMSASGKKAFE
D2BIK8_DEHMV          CNSGTEATEGAVKLARRYGKLKLKGA-------YEVITATGSFHGRTLAMVSASGQSKYQ
ARGD_PROMA            CNSGAEANEAAIKLARKYGQIKRGI------KRPIILSAKSSFHGRTLAALSATGQTKYQ
A2BY08_PROM5          CNSGAEANESAIKLIKKFGNKIYTG------KETFILAAESSFHGRTLATLSATGQPKYQ
ARGD_NOSS1            CNSGAEANEAAIKLARKYAHTVLDI------EKPIILTANASFHGRTLATITATGQAKYQ
E6UBF2_RUMA7          GNSGAEANECAIKVARKYSFDKYG---KE-AERNIIITLVNSFHGRTMGTLSATGQDVFH
D8IAY1_BRAP9          CNSGAESNEAAIKCARKYSFNKYANNDKN-YKRNKIVTLKNSFHGRTMATISATGQEVFH
ARGD_HAEDU            ANSGAEANEGAIKVARKYSHDKYG------DTRSTIISLVNSFHGRTISTLAATGQKLFH
Q187Z9_CLOD6          CNSGTEANETAFKIARKYSSDKYG------NGRGTIISLKDSFHGRTMMSLMATGMDKYH
ARGD_WOLSU            ANSGAEANEGAIKIARKFGESHEGEVK-----RYKIITLESSFHGRTITALKATGQEKMH
A6Q3W6_NITSB          ANSGAEANEGAIKIARKYGEV-DGEIK-----RYKIITLKHSFHGRTITALKATGQEAMH
ARGD_CANGA            CNSGTEANEAALKFAKKHGITKNP-------KKQGIIAFENSFHGRTMGALSVTWNKKYR
ARGD_YEAST            CNSGTEANEAALKFAKKHGIMKNP-------SKQGIVAFENSFHGRTMGALSVTWNSKYR
ARGD_NEUCR            CNSGSEANEAGIKFARKVGKVLDPSG-----SKVEIVCFQNAFHGRTMGSLSATPNPKYQ
ARGD_YARLI            ANSGTEANEAALKFARKVGTLSSP-------DKTEFVNFEKAFHGRTMGALSVTPNPKYQ
ARGD_DEBHA            CNSGTEANEAALKFARKYGKSFSD-------DKYEMITFKNSFHGRTMGALSVTPNEKYQ
ARGD_SCHPO            ANCGTEANETALKFARKAAFEKYGE------GKSQIVYFNNSFHGRSLGSLSITANPKYK
ARGD_DICDI            ANSGTEANEAALKFAKKIGIAKGGV------DKHEIIAFSHGFSGRSMGSLSCTHKSKYR
ARGD_CAMJE            TNSGTESIEGAMKTARKYAFNKGVK-------GGQFIAFKHSFHGRTLGALSLTANEKYQ
A4XM22_CALS8          CNSGAEANEAAIKLVRNYFYKKGS-------NRYKIITLINSFHGRTLATTAATGQKKYQ
ARGD_YERPE            ANSGAEANEAAFKLARHYAIER-HSPYK-----TKIIAFHNAFHGRTLFTVSVGGQPKYS
ARGD_ECOLI            MNSGTEANETAFKLARHYACVR-HSPFK-----TKIIAFHNAFHGRSLFTVSVGGQPKYS
ARGD_SHEON            ANSGAEANEAALKLARRYALEK-HGVEK-----DEIIAFDKAFHGRTFFTVSVGGQAAYS
ASTC_SALPC            CNSGAEANEAALKLARKYAHDR-VGNHK-----SGIVAFKNAFHGRTLFTVSAGGQPTYS
ASTC_SALNS            CNSGAEANEAALKLARKYAHDR-VGNHK-----SGIVAFKNAFHGRTLFTVSAGGQPTYS
ASTC_SHIB3            CNSGAEANEAALKLARKFAHDR-YGSHK-----SGIMAFKNAFHGRTLFTVSAGGQPAYS
ARGD_BUCAP            ANSGAEANEAAFKLARYYSSKI-YNLKK-----NKIISFYNSFHGRTFFTVSVGGQAKYS
ARGD_XANAC            CNSGTEANEAAIKLVRKWASSQGRPADK-----RVIVTFRGSFHGRTLASVTATAQPKYQ
ARGD_XYLFT            CSSGTEANEAAIKLVRKWAAAQGRLPEH-----RTIVTFRGSFHGRTLGAVTATAQPKYQ
ARGD1_BRADU           CNSGAEALEGVIKLVRHHHFSK-GHPER-----YRIITFEGAFHGRTLATLAATGSAKYL
ARGD1_CAUVC           ANSGAEAVEAAIKTARRWQGAK-GRPER-----YRVLTFGNAFHGRTLATISATDQMKVR
ARGD2_CAUVC           TNSGTEAVECALKTARKYHSAN-GQPER-----IDIYGFDGSFHGRTYAAVNASGNPSYV
ARGD_MYXXA            CNSGAEANEALLKLTRKVMKDR-GTPER-----FEVISFDSSFHGRTLATVTATGQAKYQ
ARGD_CHLTE            CNSGTEAIEAAIKLARRFAAR----NGD--TDKTQVLSLTNCFHGRTYGALSLTAKPKYV
B3EFM7_CHLL2          ANSGTEAIEAAIKLSRKRTVM----TGC--SDKKEILSLSNCFHGRTYGAMSLTAKPKYT
I3ZFJ4_TERRK          CNSGTEAWEAALKLARAHAGMLR-AEGK--TIGTRFIAMEHSFHGRTMGSVATTHKLKYR
Q312C1_DESAG          CNSGAEANEAAIKLARRYAQR----VKE--RDAGTVITLTGAFHGRTLATVAATGQAKFQ
T2GCQ9_DESGG          CNSGAEANEAAVKLARRYMRT----VKS--RDAYEIITLEGSFHGRTLGMIAATGQGKVK
ARGD1_BORPE           NNSGSEANEAAIKLARYYGYK-----QG--NTHAHIITMDSSWHGRTLATLAATGSDKAR
F4GBM1_ALIDK          CNTGLEANECAIKIARKYGVD-----KG--IEKPEIVVYDHAFHGRSIATMTATGNPKVR
N8SJL7_ACILW          SNSGAESNEGAIKIARKFGHM-----QG--IASPKIIVADQSFHGRTMATLSATGNKKVQ
N9GR10_ACIHA          SNSGAESNEGAIKIARKFGAQ-----QG--ISNPKIIVAEQSFHGRTLATLSATGNKKVQ
Q4FSU9_PSYA2          ANSGAEANEAALKLARLYAHQ-----QG--FKRPKVIVMEQSFHGRTLLSLSATANPKAR
ARGD2_PSESM           NNSGAEANETALKLARLHGWH-----KY--IEQPLVVVMENAFHGRTLGTLAASDGPAVR
A0A2S6F968_LEGPN      ANSGAEANEAAIKLTRLFGHK-----KG--IETPSIIVMEKAFHGRTMATLTASGSRKVQ
ARGD_LEPIN            TNSGTEAIEGAFKLARKYAYS-----KS--IVDPIILSLEKSFHGRSVSGMSLTGQDKIR
ARGD_BACSU            CNSGAEANEGAIKLARKATGKTK------------IITFLQSFHGRTYAGMAATGQDKIK
ARGD_BACCR            CNSGAEANEAALKLARKHTGKSL------------VVTCQQSFHGRTFGTMSATGQDKVK
ARGD_LACPL            ANSGTEANEAALKLARKYTGKTG------------ILAFQHSFHGRTYGAMSMTGNPHIQ
I9L3N6_LACPE          ANSGTEANEAALKLARKYTGKTN------------ILAFQHSFHGRTYGAMSMTGNPHIQ
ARGD_LISIN            CNSGTEANEAALKLARKYTGKEK------------IITFEKSFHGRTFGSMSATGQAKIH
ARGD_STRMU            CNSGAEANEAAIKIARKATGKQE------------IITFQNSFHGRTFGSMSATGQDKIK
ARGD_STAEQ            CNSGTEANEAAIKLARKATGKSE------------IIAFKKSFHGRTYGAMSATGQKKIT
ARGD_LACLA            CNSGTEANEAALKLTHLIKKDQK------------ILAFTDGFHGRTFGAMSATMQEKIQ
F2F8U6_SOLSS          CNSGAEANEAAIKLVRKHTGKHK------------IIVFEQSFHGRTFGAMSATGQDKVR
D5EL86_CORAD          CNSGAEANEALIKLARLHGRNISG--EE--GKRYTVVAANNAFHGRTYGGMSATPQEKIQ
D2R6P7_PIRSD          CNSGTEANEAAIKLARLHAGKG----------RYKIITFTGGFHGRTFGSLSATAQPKYH
Q9RZC5_DEIRA          SNSGAEAVEAAVKLARNHTGRQ------------HIISTMGSFHGRTYGAITLTGSKTKY
Q1IZP5_DEIGD          GNSGAEAVEAAIKLARHHTGRS------------HVISTLGSFHGRTYGAITLTGSKTKY
                       . * *. *  .*  :                   .      : *::             

ARGD_METTH            EPF-RPLPEGFKHVPYGDI-------------GAMADAVGDE---------TAAIILEPV
ARGD_METAC            DPFMPPVSSETTFVPYSDA-------------EAIRQAISEN---------TAAVILEPI
ARGD_ARCFU            KPF-EPLVSPVEFAEFNNP-------------ESLEKVVDEE---------TAAVIVELV
Q5SJU9_THET8          DPA-RPLLPGVKVVPYGDL-------------KALEEAIDET---------TAAVIVEPI
ARGD_COREF            IPF-APLPSGVEFYPYGDL-------------DYLTTLVESDP------TDTAAIILEPI
F8E0T1_CORRG          APF-EPLPAGVKFYTYGDI-------------ESVKQLADED---------TAAIFLESI
ARGD_MYCTU            TPF-APLPGDVTHVGYGDV-------------DALAAAVDDH---------TAAVFLEPI
C3JQR6_RHOER          APF-EPMPAGVEFVPYGDV-------------EALEQAVDSD---------TAAVFLEPI
ARGD_STRCL            EPF-LPLPGDVTHVPYGDA-------------EALRAAVTED---------TAMVILEPI
D7BYP9_STRBB          EPF-LPLPGDVTHVPYGDV-------------DALRAAVTTD---------TALFIVEPM
J7LHM4_NOCAA          EPF-GPFGMDVRFVPHGDL-------------EALTEAVDEH---------CVAVFLEPT
ARGD_BIFLO            KPY-DPLVPNIEFVRAGDK-------------VALHDAFAQTGLGRYGKGPVAAVILELI
K4IRC3_BIFAP          EPF-QPLVPGMGFLPAEDG-------------EAIEEAFAQ---GETSGEPVAAIILELI
ARGD2_BORPA           TMF-APQVEGFPKAEINDL-------------DSVRALIDAQ---------TVAVMLEPV
ARGD_RALSO            TIF-APQVPGFPKAILNDI-------------ASVEALITDE---------TVGVMLEPV
ARGD2_BRADU           PLF-EPKVAGFKKAKLNDI-------------ASVEKLINDN---------TVAVMLEPI
D2BIK8_DEHMV          EPY-TPLPTGFINVEYNNP-------------QAIKAAITDK---------TCAVMLEPI
ARGD_PROMA            KGF-EPLVEGFEFFSFNDS-------------NSVQDLYENLEKDE---PRVAAILIEPI
A2BY08_PROM5          KGF-EPMVKGFKFFKYNDI-------------ASVKKLFDECQKND---QKVSGVLIEPI
ARGD_NOSS1            KYF-DPLVPGFHYVNYNDI-------------SAVEAAISELDEGD---YRVAAILIEPL
E6UBF2_RUMA7          NYF-FPFLPGFVNVKANDI-------------DDLNKVIAEND------GKVCAIMFECI
D8IAY1_BRAP9          NYF-FPFLEGFLFAEANNY-------------EDTIEKLKDN---------ACAIMMELI
ARGD_HAEDU            QHF-FPFTAGFEHLIANDL-------------NAFKTRIAQND--------ICAIILEVV
Q187Z9_CLOD6          KYF-YPLPEGFKYVERNNI-------------EDLKNNLDST---------VCAIILEAI
ARGD_WOLSU            HYF-GPYPDGFVYA--KNL-------------DHVFKLVDEK---------TCAVLLELV
A6Q3W6_NITSB          TYF-GPFPDGFVYA--DSI-------------EQIPELIDDH---------TVAVMIELI
ARGD_CANGA            TPF-GDLVPHVSFLNINDE-------------LSKIKDFINTKK-----DEIAGLIIEPI
ARGD_YEAST            TPF-GDLVPHVSFLNLNDE-------------MTKLQSYIETKK-----DEIAGLIVEPI
ARGD_NEUCR            APF-APMVPGFKVGTYNDI--------------AAIPSLVT--------EKTCSVIVEPI
ARGD_YARLI            APF-APLVPGVKTGVYND---------------PKAADLIT--------EKTCGVIVEPV
ARGD_DEBHA            KPF-APLVPGVKIAEPNDI--------------SSVEKLISK-------EKTCAVIIEPI
ARGD_SCHPO            RGF-QPLLPDVVQAVYNDP--------------ASIEQFVN--------DKTAAVIVEPV
ARGD_DICDI            EIY-GPLVPGVHFAEYNDI--------------ESVKKLMSK-------SKTCAVIIEPV
ARGD_CAMJE            KPF-KPLISGVKFAKYNDI--------------SSVEKLVN--------EKTCAIILESV
A4XM22_CALS8          KPF-EPMPEGFLNVE------------------ADIEKIRSAID-----DKTAAIMIELV
ARGD_YERPE            DGF-GPKPADIIHVPFNDL-------------AAVKAVM-DDHTC--------AVVLEPI
ARGD_ECOLI            DGF-GPKPADIIHVPFNDL-------------HAVKAVM-DDHTC--------AVVVEPI
ARGD_SHEON            DGF-GPKPQSITHLPFNDV-------------AALEAAV-SDKTC--------AIMLEPL
ASTC_SALPC            QDF-APLPPDIRHAAYNDL-------------NSASALI-DDNTC--------AVIVEPV
ASTC_SALNS            QDF-APLPPDIRHAAYNDL-------------NSASALI-DDNTC--------AVIVEPV
ASTC_SHIB3            QDF-APLPPDIRHAAYNDI-------------NSASALI-DDATC--------AVIVEPI
ARGD_BUCAP            DFF-GPKPPAIMHAKFNEI-------------NSVKSII-DDNTC--------AVVMELI
ARGD_XANAC            EGY-EPLPGGFRYVDFNDV-------------AALEAAMAGGDVA--------AVMVEPI
ARGD_XYLFT            EGY-EPLPGGFRYVDFNHI-------------EALEAAMVGGDVA--------AVMLEPI
ARGD1_BRADU           EGF-GPPMDGFDQVPHGDI-------------EAVKKAI-GPQTA--------GILIEPI
ARGD1_CAUVC           EGF-TPLYDAFDTTPFNDI-------------EGAARAI-TPQTA--------AILVEPI
ARGD2_CAUVC           DGF-GPRLPGYSQLTFGDH-------------DAIKAAIASPTTA--------AIIVEPV
ARGD_MYXXA            KGF-EPLPAGFTHVPYGDL-------------EAVRKAV-GPATA--------AILVEPI
ARGD_CHLTE            DGF-EPLVPETGMIDFNDV-------------EDLERKVSNRTA---------AVFVEFV
B3EFM7_CHLL2          DGF-DPLLPETGMVTFNDI-------------ADLDAKVSAKTA---------AVFIEVV
I3ZFJ4_TERRK          EPF-APLMPDVVFVPFNDV-------------AALRAAFTNEVC---------GIALECL
Q312C1_DESAG          DGF-APIPQGFRQVEWGSL-------------DALEAAMDDDVV---------AVLAEIV
T2GCQ9_DESGG          EHF-QPLPEGFVTVPWEDL-------------TAMEAAISERTA---------GIMVEVV
ARGD1_BORPE           QGF-GPMPSGFIQVPYNDL-------------PAIRAAGEAEPR-------VTAVLLEVL
F4GBM1_ALIDK          NGF-GPLLEGFIRVAPNDI-------------EALQEATEGNPN-------VVAVLMEPI
N8SJL7_ACILW          EGF-GPLVEGFVRVPFGDI-------------EAIEEAAINHPD-------IVAILIEPI
N9GR10_ACIHA          EGF-APLVDGFVRVPFGDV-------------EAIQEAAIHHPD-------IVAILIEPI
Q4FSU9_PSYA2          EGF-YTLDDDFIRVPFGDI-------------AAIEQAAHDYED-------ICAVFVEPI
ARGD2_PSESM           LSY-SDLPGDYIKVPFGDL-------------LAFDKVCVTHGHR------IAAVLVEPI
A0A2S6F968_LEGPN      AGF-EPLVPGFIRAPFNDL-------------DAIHTIAANRED-------VVAVMVEPI
ARGD_LEPIN            KGY-GELLKGIEFIEPNND-------------EALVAAFERYQGR------IVALIEEPI
ARGD_BACSU            TGF-GPMLGGFHYLPYNDP-------------SAFKALGEEG--D------IAAVMLETV
ARGD_BACCR            EGF-GPLLPSFLHIPFNDI-------------KALEEVMNE---E------VAAVMVEVV
ARGD_LACPL            AGY-APLVPGITFATYNDD-------------AAL-DKITP---E------LAAVILEVV
I9L3N6_LACPE          AGY-APLVPGISFAPYNNE-------------ASL-AQITP---D------LAAVILEVV
ARGD_LISIN            QGF-GRLVPGFTYVPYNDI-------------ESFKTELDE---N------TAAVMLEVI
ARGD_STRMU            VGF-GDAVPHFHYAVFNDL-------------NSVKALVTE---N------TAAVMLELV
ARGD_STAEQ            DQF-GPVVPGFKFAIFNDF-------------NSFKSLTSN---N------TAAVIIEII
ARGD_LACLA            AGF-SPLLPNFVASPFNDV-------------VALEQILEKE--K------IGAIIFEII
F2F8U6_SOLSS          NGF-GPLVSEFVTLPFNDV-------------TALKAAADA---D------TAAIMLEMI
D5EL86_CORAD          GGF-RPMLDGFKFGELNDI-------------TSFDRLVDD---S------VAAVFIETI
D2R6P7_PIRSD          EGL-GPMVAGFLYAPHGDL-------------AAASSLVDDE---------TCAIMIEPI
Q9RZC5_DEIRA          KRGFGPLLPAVSHVPYPNPFRPPLGSTPENCGQAVIDHIESLFVGILPADEVAAIIVEPM
Q1IZP5_DEIGD          KRGFGPLLPNVSHVPYPNPFRPPLGSTSETCGQAVLDHIESLFQTVIPADEVAAVIIEPL
                                                                            .  *  

ARGD_METTH            QGEGGVIIPPEG--YLKDVQELARQNDVLLILDEVQTGFGRTGAMFASQLF-----GVEP
ARGD_METAC            QGEGGINIPDPG--YLKEVREICDETGALLIFDEVQTGFGRTGTWFCKEQF-----GVEP
ARGD_ARCFU            QGEAGVYPADRE--FVKAIEELREKYGFLLIVDEVQTGFGRTGRWFAKDHY-----GIEP
Q5SJU9_THET8          QGEGGIRVPPEG--YLRGVRELTREKGVLMIADEVQTGLGRTGKLFGVDWE-----GVSP
ARGD_COREF            QGETGVIPAPEG--FLTGVRELCDKHGLLFIVDEVQTGIGRTGDFFAHQHE-----GVTP
F8E0T1_CORRG          QGETGVIPAPEG--FLVELRRLCDDLGILLVVDEVQAGMGRTGQWFGFHHD-----RVLP
ARGD_MYCTU            MGESGVVVPPAG--YLAAARDITARRGALLVLDEVQTGMGRTGAFFAHQHD-----GITP
C3JQR6_RHOER          MGEGGVVVPPEG--YLVEARRITAERGALLVLDEVQTGIGRTGWFYAHQAV-----GIVP
ARGD_STRCL            QGESGVVVPPKG--YLRAAREITEATGTLLVLDEVQTGIGRTGHWFAAQAE-----GVEA
D7BYP9_STRBB          QGENGVVVPPAG--YLAAAREITRATGTLLVLDEIQTGIGRTGHWLECQAQ-----GVEP
J7LHM4_NOCAA          QGEAGVVPAPEG--YLAGVRALCDRTGAAFVLDEIQSGIGRTGEWFAHQGE-----AVRP
ARGD_BIFLO            QGEAGVQPLGAD--YVKFVRELCDINHALLIIDEVQTGIGRTGKWFAFQRDDL-SGGVTP
K4IRC3_BIFAP          QGEAGVLPLNPD--YVSQVRELCSRHGALMILDEVQTGMGRTGHWFAFQDQSL-SGGACP
ARGD2_BORPA           QGEAGVIPATRE--FMQGLRKLADEHGILFIVDEVQTGMGRTGSLFAYQQF-----DVIP
ARGD_RALSO            QGEGGVLPATQE--FMQQLRALTRKHKLLLIVDEVQAGCGRCGTLFAYQLS-----NIEP
ARGD2_BRADU           QGESGVWPATDQ--FLQELRALTKAHGLLLILDEIQTGMGRTGKLFHYEHT-----GIAP
D2BIK8_DEHMV          QGESGVNVPDSG--YLKAVRQICDETGRLLILDEIQTGIGRTGKLFAYEHS-----GIEP
ARGD_PROMA            QGEGGLNLGDQK--FFYFLRDYCNKNNILLLFDEVQSGMGRTGKLWGYEHF-----NVEP
A2BY08_PROM5          QGEGGVIPGDKL--FFKDLRKLCTQNNSLLILDEVQSGVGRTGKMWGYETL-----GIEP
ARGD_NOSS1            QGEGGVRPGDVE--YFQKLRQICDDTGILLMFDEVQVGMGRSGKLWGYEYL-----GVEP
E6UBF2_RUMA7          QGEGGVVGLDEA--FVKAIFDVAEKNDILTICDEVQTGVGRSGKFLACMNY-----GVKP
D8IAY1_BRAP9          QGEGGVIPLDKE--YVQKVKKYCEENDILFIVDEVQTGVGRTGKFLCSEHF-----GIKP
ARGD_HAEDU            QGEGGVCSLDQA--YLQAVQGLCQVQDILLIIDEVQTGIGRTGTMFAYQQF-----ELKP
Q187Z9_CLOD6          QGEGGVNVLEKD--YVLEIVKICQEKDIVVIFDEVQCGIGRTGKLFGYEYF-----DVKP
ARGD_WOLSU            QGEGGIEPQDRE--GIKKLERFLKERGVLLMVDEVQTGIYRSGELFASQAY-----GIVP
A6Q3W6_NITSB          QGEGGVEPQDKK--AVQNLSKVLKEKDVLLIVDEVQTGIYRTGEFLASNLY-----EIEP
ARGD_CANGA            QGEGGIFPIPIE--KLVALKEICQKNDIIVIYDEIQCGLGRTGNLWAHAAL---PKAAHP
ARGD_YEAST            QGEGGVFPVEVE--KLTGLKKICQDNDVIVIHDEIQCGLGRSGKLWAHAYL---PSEAHP
ARGD_NEUCR            QGEGGVMPATEE--FLVALGKRCREVGALLHYDEIQCGLARTGTFWAHSSL---PKEAHP
ARGD_YARLI            QGEGGVYKANDE--FLQALRNKCDEVGAMLIFDEIQCGLGRTGRLWAHD-------KVHP
ARGD_DEBHA            QGEGGVNAIDAE--FLVSLKKLCVDNEVVLIYDEIQCGLGRSGKLWAHCNL---PEEAHP
ARGD_SCHPO            QGEGGICPAKPE--FLIALRKACDKVGASLIYDEIQCGLGRSGDLWAHSIV---KDVASP
ARGD_DICDI            QGEGGLEAATVE--FMQQLYKLCKENDCLLIVDEVQCGIGRTGQLWAHTRFD--TEKCKP
ARGD_CAMJE            QGEGGINPANKD--FYKALRKLCDEKDILLIADEIQCGMGRSGKFFAYEHA-----QILP
A4XM22_CALS8          QAEGGIKVLEKK--FVNEIYKLCKENGILLIIDEVQTGIGRCGSLFCFEQY-----EVIP
ARGD_YERPE            QGEGGITSATPE--FLQGVRALCDQHNALLVFDEVQSGMGRSGKLFSYMHY-----GVTP
ARGD_ECOLI            QGEGGVTAATPE--FLQGLRELCDQHQALLVFDEVQCGMGRTGDLFAYMHY-----GVTP
ARGD_SHEON            QGEGGIIDADPA--FLKAVRELANKHNALVIFDEVQTGVGRTGELYAYMGT-----DIVP
ASTC_SALPC            QGEGGVIPATKA--FLQGLRELCDRHQALLIFDEVQTGVGRTGELYAYMHY-----GVTP
ASTC_SALNS            QGEGGVIPATKA--FLQGLRELCDRYQALLIFDEVQTGVGRTGELYAYMHY-----GVTP
ASTC_SHIB3            QGEGGVVPASNA--FLQGLRELCDRHNALLIFDEVQTGVGRTGELYAYMHY-----GVTP
ARGD_BUCAP            QGEGGIVPADVA--FVREIRDLCYKYNALLIFDEIQTGIGRTSKLYAYEHY-----EVQP
ARGD_XANAC            QGEGGVMPAAPG--FLSRVRALCDQHDALLVLDEIQCGMGRTGTLFAHWQE-----QVTP
ARGD_XYLFT            QGEGGVMPIAPG--YLAQVRALCDRYGALLVLDEIQCGMGRTGTLFAYWQE-----EVVP
ARGD1_BRADU           QGEGGVRSATPA--FLKALRQLCDEKGLLLAFDEVQTGMGRTGDLFAHRRT-----GVTP
ARGD1_CAUVC           QGEGGLTPATPG--FLAGLRALCDQHDLLLILDEVQTGIGRTGHLFAHELY-----GVRP
ARGD2_CAUVC           QGEGGARSIPTQ--CLVGLRQLCDEHGVLLIYDEVQCGMGRTGKLFAYEWAE----GGEP
ARGD_MYXXA            QGEGGVRMAPLG--FLVGLRALCDEHGLLLLVDEVQTGMGRTGKPFGFMHE-----GIVP
ARGD_CHLTE            QGEGGIHKVSEA--FIAKLKELAKEHDFLIVADEIQAGCGRTGAFFSYMPF-----DIQP
B3EFM7_CHLL2          QGEGGIHCISEA--FLARLAELRRQFDFLVVADEIQAGCGRTGKFFSYMHF-----DMQP
I3ZFJ4_TERRK          QGEGGIHPVSQE--FLAAARELCDSTGALLLCDEIQSGMGRTGKWCSYQHY-----GIQP
Q312C1_DESAG          QGEGGIRPMTPE--YAQGVQDICRRHGVLFMVDEVQSGMCRTGRFWAFQHY-----GLTP
T2GCQ9_DESGG          QGEGGVRPATRE--YLHGVQALCRKHDILFLIDEIQTGLGRTGRLFGFQHH-----DLQP
ARGD1_BORPE           QGEGGIRPSDMA--FLQGVRQLCTERGWLLMIDEVQSGIGRTGKWFAHQWA-----DIRP
F4GBM1_ALIDK          QGEGGLHPMRVE--YLQQVRKLCDANGWLLMLDEVQAGMGRTGKWFAHQWA-----GIVP
N8SJL7_ACILW          QGEGGVNTAPQGFSYLEEIRQICNQHNWLMMLDEVQTGNGRTGKYFAYQHT-----TIIP
N9GR10_ACIHA          QGEGGVNTAPQGFSYLEEVRALCNQHNWLMMLDEIQTGNGRTGKYFAYQHT-----NIIP
Q4FSU9_PSYA2          QGEGGLNTASNGFSYLEQIQAVCNTHNWLFMLDEVQTGNGRTGKYFAYQHS-----SARP
ARGD2_PSESM           QGEGGAQVAPAG--YLKALRERCTRRDWLLMLDEIQTGMGRTGKWFAFQHE-----GIVP
A0A2S6F968_LEGPN      QGEGGIYPAEEG--YLRALANFCEQNDWMLILDEIQTGNGRTGKLYSCMHY-----DIQP
ARGD_LEPIN            LGESGIIPLSRN--FLTLSRELTEENEALLIFDEIQTGMGRTGTLFAFETM-----GFSP
ARGD_BACSU            QGEGGVNPASAE--FLSAVQSFCKEKQALLIIDEIQTGIGRTGKGFAYEHF-----GLSP
ARGD_BACCR            QGEGGVIPVDLS--FLKEIETLCNKFGSLFIIDEVQTGIGRTGTLFAYEQV-----GIEP
ARGD_LACPL            QGEGGVFAGQTA--WLQAVNAKCQATGVLLIIDEVQTGIGRTGYRMAYEGY-----GLDP
I9L3N6_LACPE          QGEGGVYAGEQA--WLQHVNAKCQATGVLLIIDEVQTGIGRTGYRMAYEGY-----GLDP
ARGD_LISIN            QGEGGVIPGNAA--WLMEVQMLCKKAGALLIIDEVQTGLGRTGTLFGFQQT-----FLDP
ARGD_STRMU            QGESGVLPAEQD--FVTALADYCQKNGLLLIIDEVQTGMGRTGKLYAFQHY-----GIEP
ARGD_STAEQ            QGESGVLPADSL--FMKQLNEYCKQKDILIIVDEVQTGIGRTGKLYAHEHY-----QLSP
ARGD_LACLA            QGEGGVLPISPD--FVEALKS-CQQKGILLIIDEIQTGIGRTGKLFAFEHF-----DFEP
F2F8U6_SOLSS          QGEGGVNPVTEE--FAKAIHEIQQSSDILVIVDEVQTGIGRTGTRFAFEQT-----VIKP
D5EL86_CORAD          QGEGGIFEAEAN--FLHELRALCTERNAMLILDEVQCGIGRTGHFFAYDKS-----GVKP
D2R6P7_PIRSD          QGEGGVKIPSKE--FLEGLRKLCDERGLLLIFDEVQTGCGRTGQWFGYQHF-----GVEP
Q9RZC5_DEIRA          QGEGGYIVPPAD--FLPGLRALCDKHGIMLIFDEVQAGMGRTGKMFSFQHFDV-----QP
Q1IZP5_DEIGD          QGEGGYIVPPAD--FLPGLRALCDRHGILLIFDEVQAGMGRSGKMFSFQHFAANGQNCQP
                       .* *                           **:* *  * .                .

ARGD_METTH            DITTVAKAMGGGY-PIGAVLANE-RVAMAFE--PGDHGSTFGGNPWGCAAAIATIEVLM-
ARGD_METAC            DIMSMSKAIGGGF-PMGAIAAHN-GINFGR----GQHASTFGGGPLACAAALASVKVIR-
ARGD_ARCFU            DMITMAKAMGSGV-PIGCCALKE-EVAEKIQ--VGDHGSTFGGNPLACTAALATIEVIE-
Q5SJU9_THET8          DLMTLAKALGGGVMPIGACVGRR-EVFEVFKNNPLFHSSTFGGNPLAAAAALAAIEVTL-
ARGD_COREF            DVVTMAKGLGGGL-PIGACLATG-EAAKLFG--PGKHGTTFGGNPVSAAAARAVLSVI--
F8E0T1_CORRG          DVITMAKGLGGGL-PIGAVVAM--PRAQLLA--KGMHGTTFGGNPVVAAAANAVIRTIR-
ARGD_MYCTU            DVVTLAKGLGGGL-PIGACLAVG-PAAELLT--PGLHGSTFGGNPVCAAAALAVLRVLA-
C3JQR6_RHOER          DVITLAKGLGGGM-PIGACIATG-ATAELFG--PGKHGTTFGGNPVCAAAALAVLKTIA-
ARGD_STRCL            DVVTLAKGLGGGL-PLGAAVAFG-RAAELMT--PGHHASTFGGNPVSCART-RVLDTIA-
D7BYP9_STRBB          DVVTLAKGLGGGL-PIGATVAFG-PAAELLT--PGQHGSTFGGNPVACAAALAVLDTLA-
J7LHM4_NOCAA          DVLTLAKGLGGGL-PIGACVGFG-RFADAFH--KGDHGSTFGGNPVACAAALAVIETIE-
ARGD_BIFLO            DMVTFAKGVAGGF-PMGGMIAFGEKLAALFT--PGSHGSTFAGNPLGAAAGLATLDVIE-
K4IRC3_BIFAP          DVLTFAKGVAGGF-PMGGMITFGPGPSGLLT--PGLHGSTFGGNPMGSALALTTLETIQ-
ARGD2_BORPA           DIMTLAKGIGGGI-PLAALLAREEVCV--FAH--GDQGGTYNGNPLCAAVGVAVFDTIT-
ARGD_RALSO            DIMTLGKGIGGGV-PLSALLCTDEVAS--FEA--GDQGGTYNGNPLMTAVGCSVIEQLL-
ARGD2_BRADU           DIMTLGKGIGGGV-PLAALLATERAAC--FEH--GDQGGTFNGNPIMCAAGLAVLDEVG-
D2BIK8_DEHMV          DIITLAKGLAAGV-PIGAFMAKESASV--FAK--GEHGSTFGGNPLACAAGYATMKFIL-
ARGD_PROMA            DAFTLAKGLGGGH-SIGALLVKENASI--FEP--GDHASTFGGNPFACKAGLTVAKEIQ-
A2BY08_PROM5          DGFTLAKGLGGGH-AIGALLVKEKANI--FSP--GDHASTFGGNPFACRAALTVLEEIT-
ARGD_NOSS1            DIFTSAKGLGGGI-PIGAMMSKKFCDV--FQP--GEHASTFGGNPFACGVALAVCQTLE-
E6UBF2_RUMA7          NIVTMAKGLAGGL-PIGVCLADEKCCDVLTK---GTHGSTFGGNPVVCAGGLAVLNNVT-
D8IAY1_BRAP9          DITTLAKGLGGGL-PIGAILMNKKCSDVFVP---GDHASTFGANPVVAAGALEVLNIID-
ARGD_HAEDU            DIVTLAKGLAGGL-PIGAFLLADKVAETLAK---GDHGSTFGANPVSCAAANAVLTKLE-
Q187Z9_CLOD6          DIVTVAKGLGAGI-PVGGVLVNKKLSKVLGK---GDQGTTFGGNLLAMVAASVVLDEIS-
ARGD_WOLSU            DVITVAKGLAGGV-PIGAVMTTLK--DIFAP---GDHGSTFGGNFLSTRAGLEVLSILE-
A6Q3W6_NITSB          DIITLAKGLGGGV-PIGAVMTRLK--EIFKP---GDHGSTFGGNYLSTRAALEVVSILQ-
ARGD_CANGA            DIFTSAKALGNGF-PIAATVVNEKVNN-ALQV--GDHGTTYGGNPLGCAVSNYVLDVIG-
ARGD_YEAST            DIFTSAKALGNGF-PIAATIVNEKVNN-ALRV--GDHGTTYGGNPLACSVSNYVLDTIA-
ARGD_NEUCR            DILTTAKAIGNGF-PIAATIVNEHVAS-KIKV--GDHGTTFGGNPLACRLAHYIVGRLA-
ARGD_YARLI            DILTMAKALGNGF-PIGATMVTEAVAD-KIAI--GDHGTTYGGNPLASRVGHYVLSQVA-
ARGD_DEBHA            DILTMAKALGNGF-PIGAVMVSDKIEK-VLKV--GDHGTTYGGNPLGSKIGSYVVDQVS-
ARGD_SCHPO            DIITVAKPLANGL-PIGATIVSSKIAA-EIHP--GEHGSTFGGNPVACRVGTFCVNELG-
ARGD_DICDI            DIMTLAKPLAGGL-PIGAVLVSDKVAS-EIKP--GDHGTTFGGGPLVCEVGKYVFERIS-
ARGD_CAMJE            DIMTSAKALGCGL-SVGAFVINQKVASNSLEA--GDHGSTYGGNPLVCAGVNAVFEIFK-
A4XM22_CALS8          DIITLAKGLGNGI-PIGAMLCKKEVAS--FEP--GEHGSTFGGNFLATRAALEVLKIIE-
ARGD_YERPE            DILTTAKALGGGF-PISAMLTTEEIAS-VMTV--GTHGTTYGGNPLACAVAEAALDVIN-
ARGD_ECOLI            DILTSAKALGGGF-PISAMLTTAEIAS-AFHP--GSHGSTYGGNPLACAVAGAAFDIIN-
ARGD_SHEON            DILTTAKALGGGF-PIAAMLTTTEIAE-HLKV--GTHGSTYGGNPLACAIGNAVLDVVN-
ASTC_SALPC            DILTTAKALGGGF-PIGAMLTTQDYAS-VMTP--GTHGTTYGGNPLATAVAGKVLDIIN-
ASTC_SALNS            DILTTAKALGGGF-PIGAMLTTQNYAS-VMTP--GTHGTTYGGNPLATAVAGKVLDIIN-
ASTC_SHIB3            DLLTTAKALGGDF-PVGALLTTEECAS-VMTV--GTHGTTYGGNPLASAVAGKVLELIN-
ARGD_BUCAP            DILTIAKSLGSGF-PISATLTTNGIAS-VIKP--GIHGTTYGGNPLACSIAESVVNIVN-
ARGD_XANAC            DIVTLAKALGGGF-PIGAMLAGPKVAQ-TMQF--GAHGTTFGGNPLAAAVARVALRKLA-
ARGD_XYLFT            DIVTLAKGLGGGF-PIGAMLAGPKVAE-VMQF--GAHGTTFGGNPMAAAVARVALRKLA-
ARGD1_BRADU           DVMSLAKALGGGF-PIGAILATADAAA-GMGP--GSHGSTFGGNPLAIAAANAVLDVML-
ARGD1_CAUVC           DIIAVAKGLGGGF-PIGACLATEDAAS-GMTP--GSHGSTYGGNPLACAVASAVLDAVL-
ARGD2_CAUVC           HIMAVAKALGGGF-PIGACLATTEAAK-GMTV--AAHGSTFGGNPLAMAVGKAALEIIK-
ARGD_MYXXA            DGISVAKALGNGL-PIGAMLCKEELGA-SLTP--GTHGSTFGGNPVAAAAANAVVRILR-
ARGD_CHLTE            DLVCVAKPLGGGL-PLGAIIGSEKVAE-VFTP--GSHGTTFGGNPVACAAGLAMIEAIL-
B3EFM7_CHLL2          DLVCLAKPLGGGL-PLAAVLGSEKMAD-VFSY--GNHGTTFGGNPVACAAGLAMIDAIY-
I3ZFJ4_TERRK          DVTTLAKPLAGGL-PMGALLCTEAAAR-AITP--GMHGTTFGGGPLVCAVAIAVIDEIN-
Q312C1_DESAG          DVVTSAKALANGL-PMGAMLATDEAAK-GFEP--GSHATTFGAGALVSAVAARVVDIMQ-
T2GCQ9_DESGG          DLVTMAKGLANGL-PMGALLATDEAAS-GFAP--GSHATTFGGGPVVSVVALKVLEILE-
ARGD1_BORPE           DVMTLAKGLAGGV-PIGAMLAAGPAAG-VFAP--GSHGTTFGGGPLACAAGLAVIDAIE-
F4GBM1_ALIDK          DVMTLAKGLGSGV-PVGAVLAHGAASE-VLKP--GNHGSTFGGNPLAMRAGVETIRIME-
N8SJL7_ACILW          DVLTTAKGLGNGF-PIGAVMTQGRGVG-VLTA--GNHGSTYSGTALGSRVVYTILDIMQ-
N9GR10_ACIHA          DVMTTAKGLGNGF-PVGAVMTQGKAVG-ILGA--GSHGSTYGGTVLGSRVVYTVIDTIQ-
Q4FSU9_PSYA2          DVLTTAKGLGNGF-PVGACMVRGRANG-LFGA--GSHGSTYGGTPLASRVVHSVYDVLA-
ARGD2_PSESM           DVMTLAKGLGNGV-PIGACLARGKAAE-LFTP--GSHGSTFGGNPLACRVGCTVIDIIE-
A0A2S6F968_LEGPN      DILTTAKGLGNGM-PIGACLMSKRAKD-LFKP--GNHGSTFGGNPLACATALTVLEVIE-
ARGD_LEPIN            DAMTLAKGLGSGF-PIGALIVGEKYQD-LFTQ--GSHGSTFGGNHLAAAVAYETIRIIQ-
ARGD_BACSU            DIITVAKGLGNGF-PVGAVIGKKQLGE-AFTP--GSHGTTFGGNMLAMAAVNATLQIVF-
ARGD_BACCR            DIVTVAKALGNGI-PVGAMIGGKELGT-SFTA--GSHGSTFGGNYIAMAAAKEVLQVSK-
ARGD_LACPL            DIYTVAKGLANGL-PVGAMVGRRQLAT-AFGP--GSHGSTFAGNAVAMAAAKCVLPQLT-
I9L3N6_LACPE          DIYTVAKGLANGI-PVGAMVGRKQFAS-AFGP--GSHGSTFAGNALAMAAAKSVLTQLT-
ARGD_LISIN            DIFTLAKGLGNGL-PIGAMVGKEHLSS-AFGP--GSHGSTFGGNKLALAAAKEILLTMK-
ARGD_STRMU            DIFTLAKGLANGV-PVGAMLAKKQFGS-AFGP--GSHGSTFGGNKLAMAASSAVLDIMT-
ARGD_STAEQ            DIITLAKGLGNGL-PIGAMLGKKNLGH-AFGY--GSHGTTFGGNRLSLAAANQTLSIIN-
ARGD_LACLA            DIFTLAKALANGI-PTGAMLAKNKYAS-YFSA--GKHGSTFGGNPLAMASANEVLKE-I-
F2F8U6_SOLSS          DIVSMAKGLGGGF-PIGGILGTEKLFN-TFSA--GTHGTTFGGNPLGVAVAQTVIDQIF-
D5EL86_CORAD          DAVGMAKGLGAGF-PMGAIWASEAYAE-LFQP--GSHGTTFGGNPLASAAANAVLDVIE-
D2R6P7_PIRSD          DLITLAKSLCGGI-AGGALLAKNEIAP-ALRP--GMHAATFGGNPIAARAGIAAIEMIE-
Q9RZC5_DEIRA          DIITSAKGIASGM-PLGALLAKESVMTWPVGS----HGSTYGGNPVAAAASHATLDLLEG
Q1IZP5_DEIGD          DIITLAKGIASGL-PISALLAKESVMTWPVGS----HGSTFGGNPVAAAAAHATLDLLEG
                      .    .* :  .  . .                   :. *: .                 

ARGD_METTH            -------DEKLPERAAKMGSYFLGRLRQVLHGC-DAVRDIRG-VGLMIGIEID-------
ARGD_METAC            -------EEKLLERSKEMGAYFMKKLAGMVR---DDVVEVRG-KGLMIGVEIK-------
ARGD_ARCFU            -------REGLVENSARMGEYFVKRLKESFE-------NVIG-VGLMIGFDV--------
Q5SJU9_THET8          -------EEDLPGRALELGRHLMEGLKVLKEEHPHLIEDVRG-RGLMVGVEFAD--A---
ARGD_COREF            -------DEEFCADVARKGELFAE---QLRGVA--GVADVRG-RGLMLGVVLD---Q---
F8E0T1_CORRG          -------DENLLQNVTKQGNLFAT---ALAADP--SVVEVRG-RGLMLGVVLN---E---
ARGD_MYCTU            -------SDGLVRRAEVLGKSLRH-GIEALGHP--LIDHVRG-RGLLLGIALT---A---
C3JQR6_RHOER          -------AEDLISRADSLGKSISA-GIEDLGHP--LVDHVRG-SGLLLGVVLT---E---
ARGD_STRCL            -------ADGLLDRVKQLGSAPDEWSVRDAAAI--RWSPMSG-AGLMLGIVLN---E---
D7BYP9_STRBB          -------ADDILEGVKRTGERLRD-GIESLDHP--LISHVRG-SGLLLGIVLA---E---
J7LHM4_NOCAA          -------TEGLLAHTKVMGDLLAE-QIEGIDHP--LLAGQRG-SGLWRALRLT---A---
ARGD_BIFLO            -------DENLVANAEARGEQLRD-GIMATGNP--LFVSVRG-RGLLDAVELK---H---
K4IRC3_BIFAP          -------REGLLERARQMGERLRA-GLTDCGNP--LYTQVRG-RGLLDAVQLS---A---
ARGD2_BORPA           -------APGFMEAAQARTRQLSEGLLALSAKRGLR-GERGM--GLLRALVLDRDDA---
ARGD_RALSO            -------APGFLAGVQERGAYLRAQLLELSEAFGLA-GERGE--GLLRALLLGKDIG---
ARGD2_BRADU           -------KPDFLKSVTETGLLLESELQKVSARHGLG-GVRGR--GLLLALDLKLPIA---
D2BIK8_DEHMV          -------DNHISEHAGIMGSYLAKGFEKLKAKHRLIQGYRGC--GLLMALGFNTDIA---
ARGD_PROMA            -------NRNLLENTYCRGNQLREGLQKLINNYPHHLEEVRG-IGLMLGLAIKKNSN---
A2BY08_PROM5          -------RRKILNNVISRGNQLNEGFIKLSDKFPNIINGIRG-IGLIQGLVIN-NSY---
ARGD_NOSS1            -------RENILQNVQDRGEQLRSGLRAIAAKYPHHLTEVRG-WGLINGLELAADIP---
E6UBF2_RUMA7          -------KEGFLDEVIKKGDYIREKLKDVPEV-----TGISG-MGLMLGVSLKTK-----
D8IAY1_BRAP9          -------K-SLLKEVEKKSKYIKSKLTKLNNV-----VSVDG-IGLMLGIGLKEGL----
ARGD_HAEDU            -------P-LFLTEVMRKGQKLRKALQSLPHV-----KSISG-LGLMIGVEFDEHI----
Q187Z9_CLOD6          -------KDGFYNEVLEKGNYIRKSIESFNNK-----VVLKT-KGIGLMIGIETNI----
ARGD_WOLSU            -------SLYQEGTLQKSIDRFSAELRALCVEFPSLFECEVG-LGLMRGIRAKSAE----
A6Q3W6_NITSB          -------EFKESGKLDERLIYFETKLKDIAKRYEHLFEKEVG-LGLMRGLRAKSSE----
ARGD_CANGA            -------DQAFLDSVTKKGELLKKGLLKIKEQHPDKISDVRG-SGLIWGVEFKD------
ARGD_YEAST            -------DEAFLKQVSKKSDILQKRLREIQAKYPNQIKTIRG-KGLMLGAEFVE------
ARGD_NEUCR            -------DKQLQEGVKAKSEVFLRGFEKLRNKFPSLVKEVRG-KGLILGLQLSE------
ARGD_YARLI            -------SKEVLDNVKKVSQQIRDAVAEVQEEFPELITEVRG-DGLLLGIQFSK------
ARGD_DEBHA            -------DKEFLLEVEEKSEKFTKGLSKIANKHPDHIGEVKG-KGLLLGLQLKGNL----
ARGD_SCHPO            -------SSKILQNVRKQHKALTSRFDDFVAKYPNLIRGYAG-RGLLLGLQFTE------
ARGD_DICDI            -------QPSFLKEVQEKGKYLTDGLKKLKDQFPNSILEIRTVGGLFVGIQLDH------
ARGD_CAMJE            -------EEKILENVNKLTPYLEQSLDELINEF-DFCKKRKG-LGFMQGLSLDKSV----
A4XM22_CALS8          -------EENIIDNVKNMGSYLKQKLLELKELF-KSIVDVRG-LGLLIGVEFSF------
ARGD_YERPE            -------TPEVLNGIEQRHGLFVQALQSI-NSKYD-VFSDIRGMGLLIGAELTAKYR---
ARGD_ECOLI            -------TPEVLEGIQAKRQRFVDHLQKI-DQQYD-VFSDIRGMGLLIGAELKPQYK---
ARGD_SHEON            -------TPEVLNGVKHREQLLRDGLNKI-NEKYH-VFSEVRGKGLLLGAVLNEQYQ---
ASTC_SALPC            -------TPEMQNGVRQRHDAFIERLNTI-NVRFG-MFSEIRGLGLLLGCVLQTEFA---
ASTC_SALNS            -------TPEMQNGVRQRHDAFIERLNTL-NVRFG-MFSEIRGLGLLLGCVLQTEFA---
ASTC_SHIB3            -------TPEMLNGVKQRHDWFVERLNTI-NHRYG-LFSEVRGLGLLIGCVLNADYA---
ARGD_BUCAP            -------TKKFLLGVEKKSKKIISELNII-NKRFG-LFTEIRGKGLLIGIVLRPELS---
ARGD_XANAC            -------SPQIADNVVRQSAALRAGLEAL-NAEFG-LFAQIRGRGLMLGAVLAPEHA---
ARGD_XYLFT            -------SVEIAANVQRQSVALRAGLEEI-SEAFGGVFTQVRGRGLMLGAVLAPLYA---
ARGD1_BRADU           -------KPGFFDHVQKMSLLLKQKLASVIDRHG-DVVSEVRGEGLLIGIKAVVPS----
ARGD1_CAUVC           -------APGFLETVRERAALVDALLERLLRRHS-DLFVRAQGHGLMRGLQVRASA----
ARGD2_CAUVC           -------SPETLDNVKTVSGFFTQQLNGLKDRFP-DVIVDVRGKGMLIGVKLIPNN----
ARGD_MYXXA            -------RPGFLDEVQEKGAYLLARARELQGRLPAGRIQAVRGQGLLVGVQLDHKV----
ARGD_CHLTE            -------ADGLMQNALEVGSMMRTAFEKMAEKHA-QILEIRQ-YGLMIGVTVHRE-----
B3EFM7_CHLL2          -------ADGLMEKAAQTGTMMKSALLELASRHP-QILEVRQ-YGLMIGITVDKE-----
I3ZFJ4_TERRK          -------RANLLAHVSEVGSYFVEQLRGLAQEHD-SILEVRG-MGFMIGVEIRTAEL---
Q312C1_DESAG          -------QEKLAERADRVGGAFMADVRSLAARLPGTIQEVRG-LGLMIGIVLTFP-----
T2GCQ9_DESGG          -------KERLVERSAKLGERFKARFLEIRDRLPDKIAQVRG-LGLMLGIELTAP-----
ARGD1_BORPE           -------QEGLLGNAHEVGAHLHAALAS-ELAGAPGVIEVRG-RGLMLGIELDRP-----
F4GBM1_ALIDK          -------EEGLLQNAADVGAHLKAGLQQ-ALGSVPGVNEVRG-QGLIIGVELDRP-----
N8SJL7_ACILW          -------KENIVANAAEKGAYIVDQLRN-KLADQNVI--VRG-FGLMIGIELPKE-----
N9GR10_ACIHA          -------QENAVENAATVGAYIVDQLRA-QLAENNVQ--VRG-FGMMIGIQLPKD-----
Q4FSU9_PSYA2          -------NSDIMKNAVTEGQFIRDGMVD-AFGEYGVS--SRG-AGMMIGIALPEDMD---
ARGD2_PSESM           -------QQALVENAGVRGQHLLGRLQE-VLGGHPQVMQVRG-RGLMIGIELREA-----
A0A2S6F968_LEGPN      -------RDRLCERVTKNSALLMDKLIS-NLGEHPNVKAIRG-KGYMIGIELDRP-----
ARGD_LEPIN            -------TREILNNVNICSDIAFTRLRE-MQEKYPVISEVRG-KGLHIGLELKVP-----
ARGD_BACSU            -------QPDFLQEAADKGAFLKEQLEAELKS--PFVKQIRG-KGLMLGIECDG------
ARGD_BACCR            -------KPSFLKEVQEKGEYVLEKLQEELQHV-ECIQNIRG-KGLMIGIECKH------
ARGD_LACPL            -------PA-LLTTVRAHAKLVWQSLATQVEPI-PVVKQITG-KGLMIGIHLDEQI----
I9L3N6_LACPE          -------PE-LLTDVRAHAAALWQALETQVAPL-PAVKQLTG-KGLMVGIHLDEQL----
ARGD_LISIN            -------QTGFLEEVNAKAAYFRNLLEEHFEQL-ENVVAIRG-EGFLIGIELGS------
ARGD_STRMU            -------KAGFLEQAWENAHYLQEQLTSALQVA-DTVTQVRG-LGYMIGIETTA------
ARGD_STAEQ            -------DADLLNDVQSKGQFLIENLRKSLVNK-RNVIEVRG-VGLMVGIEVTN------
ARGD_LACLA            -------DSDFLEKVTDKGIFFLKLLTEKLSVK-ATVKSIRG-LGLMIGIQLTDEK----
F2F8U6_SOLSS          -------NDAFLDNVKQKSAYFVNKLEEAFPE---EKYSVQG-KGLMLGLSLGGE-----
D5EL86_CORAD          -------EEELLEHVQFCAEVWHEALQGLVEKYPQHIAGMRG-AGYMVGLALKTEG----
D2R6P7_PIRSD          -------EEGLLAQAVQLGHLFERRMQDLQAKCDLVREVRVA--GVMVGVELSVEG----
Q9RZC5_DEIRA          QVKHEGCGDSLMDNAAQVGDFILGELKGMQDEFPFIGDVRGR--GLFIGIEFVKPDGSPD
Q1IZP5_DEIGD          VVRHPGCGENLMANAASVGAFIMDELRKMQVDFPFLGDVRGR--GLFIGLEFVKPDGSPD
                                                                  *               

ARGD_METTH            -GECAGVVDAAREMGVLINCTAG--KVIRIVPPLVIKKEEIDAAVDVLGHVISDL-----
ARGD_METAC            -YPCGKFVDFAREQGVLVNCTSD--SVLRLVPPLVITKEQIDTVVDVLEQA---------
ARGD_ARCFU            -GDAAEFVRKCLENGLLVNNTSE--RRIRLVPPLVITEREVDKAVEIMLN----------
Q5SJU9_THET8          -DIGALVVAEMAERGVLTAFGLNNPKVVRLEPPLIIGKEHVDEALAVFAEALKATEKALE
ARGD_COREF            -PVAKQAVTAGFKHGLILNAPAD--NIIRLTPPLVITDDEIRDAVRALAAVLAELNA---
F8E0T1_CORRG          -DLRVDP----LDFGLILNRPSP--DVLRIVPPLNLTDGDAEEGVEKLKRMLQAHRETAR
ARGD_MYCTU            -PHAKDAEATARDAGYLVNAAAP--DVIRLAPPLIIAEAQLDGFVAALPAILDRAVGAP-
C3JQR6_RHOER          -DVAPAVENAAREAGYLVNAAQP--GVIRLAPPLILTDEQAETFVAALPAIFDSALSADQ
ARGD_STRCL            -PLAPQVQLAAQKAGFLVNVPAP--DVVRLIPPLVIEETEVDAFLQALPGLLDAVHERDR
D7BYP9_STRBB          -SLAPQVQQAAQDAGLLVNAVAP--DVVRLAPPLVVGDEEVDAFLRAFPGALDAVQGRN-
J7LHM4_NOCAA          -PHAAHVQEQAAVRGFLINAVSP--DTLRIAPPLVITPEQIGVFIEALPTVLDAAEAAAT
ARGD_BIFLO            -PCSHAVMNYCLEHGLIVNAVAP--NALRFAPPLIVTAQDVDQALAILKDVPTDLPDD--
K4IRC3_BIFAP          -PCAGDLASWALDHGLIVNAVAP--DALRLAPPLIIQADQIDLAVDILSKAPASLADKGL
ARGD2_BORPA           -PAIVEAARMLAPEGLLLNAPR--GNLLRFMPALNVTEADMARMLEQLDGVIAAVRK---
ARGD_RALSO            -GQLVEAAREMNPTGLLLNAPR--PNILRFMPALNVTTDEIDTMIGMLRTLLKAHG----
ARGD2_BRADU           -PGIVAQAFE---AGVLLNAPQ--VDTLRFMPALNVTRAEIAEMIDCLDAILTKAGAARR
D2BIK8_DEHMV          -KEIEESCLE---EGLLLNAVK--PNALRFMPSLNITQADIDEALSKLERVLTRYENSGV
ARGD_PROMA            -LTSQKIVELAIKEGLLVIGAG--EKVIRMLPPLIITKREIETLLTRLNACFRKLNN---
A2BY08_PROM5          -TDPKTITLKAFDKGLLLVPAG--GNVVRFVPPLIISRNEIKILLKKLNLIFEEL-----
ARGD_NOSS1            -LTAADVVKAAINEGLLLVPAG--PKVVRFVPPLIVTEAEINTALKLLEKALATVTA---
E6UBF2_RUMA7          --TAGDVCKACLDNGLLILTA---KEKLRFLPPLNISYEEIDKGLAILKDILEK------
D8IAY1_BRAP9          --NAREIVEKCISKGVIPLTA---KNKIRLLPPLTITDKELEKAVSILSECIG-------
ARGD_HAEDU            --NVADVVTNCLKQGVLFLTA---KTKLRMLPPLIINDEQLERGVTVLAQVLSEM-----
Q187Z9_CLOD6          --ESSIIEEKARKKGLLILTAG--KNVLRFLPPLTISYKEIDEALEILKDILLEIN----
ARGD_WOLSU            --IQKSVIDEAFKKRVLVLRSG--RNTVRFLPPLTLSEREMQEGFSRLREALKGI-----
A6Q3W6_NITSB          --IQGEVIEKSFHEGLLVLKAG--RNTVRFLPPLTITKEEIDEGFQRFENGLKRVEVA--
ARGD_CANGA            --APGAIVQKARELGLLVITAG--KTTVRFVPSLTIEDEVVEEGLTIFNKAVNDVFSK--
ARGD_YEAST            --PPTEVIKKARELGLLIITAG--KSTVRFVPALTIEDELIEEGMDAFEKAIEAVYA---
ARGD_NEUCR            --DPTPVIKAARERGLLVITAG--TNTLRFVPSLLVTEGEIEEGLKILEESFEAVMVKA-
ARGD_YARLI            --DPSKVVAAARENGLLVITAG--TNTVRLVPALNIDQEAVTEGLEILKKAIRDNAKDL-
ARGD_DEBHA            --DVGDVVAKCRENGLLVISAG--MNVLRIVPALNIPNEAIEEGLDVLDKCIDELSKDPK
ARGD_SCHPO            --PPAKFIELARQQGLLLLPGG--NNNTRVLPSLNVKDEVIAKGLDIMESTLKALSK---
ARGD_DICDI            --NVSDLVSYAKSQKILIINAG--DDVIRFCPPLTITKQEIDQLLLVLKNYLIKVNSNKK
ARGD_CAMJE            --KVAKVIQKCQENALLLISCG--ENDLRFLPPLILQKEHIDEMSEKLRKALKSF-----
A4XM22_CALS8          --PVKDMVKELALSGLLTSSCGG-GNVVRFAPPLIVQKEHIDKAIEIFKEVVKRYDNMGR
ARGD_YERPE            -GQAREFLAAAAANGLMILNAG--PDVLRLAPSLVIELEDIQQGMARLEKAMASVIKG--
ARGD_ECOLI            -GRARDFLYAGAEAGVMVLNAG--PDVMRFAPSLVVEDADIDEGMQRFAHAVAKVVGA--
ARGD_SHEON            -GRSRDFLVASVAEGLMSLMAG--ANVVRFAPSLVIPEADIAEGLARFERAVASIAAA--
ASTC_SALPC            -GKAKLIAQEAAKAGVMVLIAG--GDVVRFAPALNVSDEEIATGLDRFALACERLQTGGA
ASTC_SALNS            -GKAKLIAQEAAKAGVMVLIAG--GDVVRFAPALNVSDEEIATGLDRFALACERLQTGGA
ASTC_SHIB3            -GQAKQISQEAAKAGVMVLIAG--GNVVRFAPALNVSEEEVTTGLDRFAAACEHFVSRGS
ARGD_BUCAP            -EEIHNILNALFLEGVIVLTAG--KNVIRLAPSLIISKRDIVEGMKRFYCALEKCL----
ARGD_XANAC            -GQAGAILDLAAKHGLLLLQAG--PDVLRFVPALNLTDAELADGLARLRLATAEYVAQP-
ARGD_XYLFT            -GQASAILEVAAEHGVLLLQAG--PDVLRFVPALNVSDEELADGLVRLRAALGDYVSRCR
ARGD1_BRADU           ----GDLVAALRNEKLLTVGAG--DNVVRFLPPLIVTEAEIEDSVGRLERACAAISSSQT
ARGD1_CAUVC           ----RDVVAHLRDFGVMTVAAG--ADVVRLLPPLTISELEIAEAEARLLRAAEAWLPIAA
ARGD2_CAUVC           ----RDFMVLARDEKLLIAGGG--DNCVRLLPPLNLTIEEASEAIAKLEKACEAARAKAA
ARGD_MYXXA            ----APVIAQVHEEGLLVNPAG--DRTMLFAPPFIVTVRELD------------------
ARGD_CHLTE            --AKYYVEEAL-KRGVLVNATS--NNVIRLLPPLSISKEEAQLCLDTLDAIFTEEAKA--
B3EFM7_CHLL2          --AKAYVEKAL-QKQVLVNATS--QNVIRLLPPLCISENEAQRCITVLDEILTEENS---
I3ZFJ4_TERRK          --AKELADRMMFERHIILNRTS--ETVLRFLPPFLITKAHVDETIAALGSLLQEASAAQT
Q312C1_DESAG          --GREVWEELL-RRGFVLNLTQ--ERVLRLLPALTVPETYLQDFLTALEEILSERTV---
T2GCQ9_DESGG          --AGPVWTKLL-EAGFLCNVTQ--DKVLRLLPPLTITEADLEAFAKALEEALTDV-----
ARGD1_BORPE           ---CGILATRAMEAGLLINVTR--ERVVRLLPPLILSGEEADQIVRILVPLIKQFLAQQQ
F4GBM1_ALIDK          ---CGVLIDRAAQAGLLLSVTA--DRVIRLVPALTLTRAEADEIVALLTPLVQAFLAE--
N8SJL7_ACILW          --CGDLVAIARDEYKMIINVTA--GNVVRLLPTLNITQEQADQLIERLVKMIKAYLA---
N9GR10_ACIHA          --CAELVAIARDQYKLIINVTA--GSVVRLLPPLNMTQAQADELLQRLVPAIRNFLTA--
Q4FSU9_PSYA2          --CSNLVDRARDEQKLIINVTG--AHVIRLLPPLNMSRDESSQVVERLVNLLKPSF----
ARGD2_PSESM           --IPELTRIAAEQHGLLINVTR--GKVIRLLPPLVLEAAEVEQIVQGLAASLDSASYRAL
A0A2S6F968_LEGPN      ---ANDMRVLGLENQVLFNITA--ETVVRLLPPLIISEDEIDELVNRITRTINQFTNQ--
ARGD_LEPIN            ---SKPIAEACLSAGLVVNATA--DNVVRIMPPLTISTDFLNQGLDILESVLKQN-----
ARGD_BACSU            --PVADIIAELQTLGLLVLPAG--PNVIRLLPPLTVTKDEIAEAVSKLKQAIAHHSAVNQ
ARGD_BACCR            --EVASFIEQLENEGLLVLQAG--PNVIRLLPPLIVTNEELEQAVYIIKKVVCTKNVSII
ARGD_LACPL            --PVNQVITRLQVEGLLTLSAG--DNTLRLLPPIVMQPADLLAGIALIAKVLTTLTTEVT
I9L3N6_LACPE          --PVSQVITQLQAAGLLTLSAG--DNTLRLLPPIVMQPDDLLVGVATITQVLSALTTEV-
ARGD_LISIN            --SAAPVVTELRDKGLLILTAG--PNILRILPPLTVSYAEIDQAISILKSVLEKQLIGSE
ARGD_STRMU            --DLGQLVKATRDRGLIVLTAG--TNVIRLLPPLTLTKDEIDQGIMILQEVFEQHN----
ARGD_STAEQ            --DPSQVVREAKRMGLIILTAG--KNVIRLLPPLTITKKQLEKGIEILTEII--------
ARGD_LACLA            --KVPEVLALLRENGLLALSAG--HDVIRLLPPLVMTKVELQKGAELLEKIL--------
F2F8U6_SOLSS          --DVAPYVAALDEAGLLTVAAG--PKVIRLLPPLTVSEQEIDEAVNLLKGVLKEEQVSI-
D5EL86_CORAD          --LNLQVTTAARDKGLLIVPAG--HNVIRLLPALVATLKELAESIQILDEVFAELS----
D2R6P7_PIRSD          ----AQVVKSCLERKLLVNCTQ--GNVIRLLPAMNLPEEQAEEGCDILCDVIQSLPRA--
Q9RZC5_DEIRA          GALRDQASMMMFEKGLLNLDCG--EAVIRISPPLILTREEAATGLDIMRGVFQELK----
Q1IZP5_DEIGD          GQRRDRASLAMFERGLLNLDCG--EAVIRISPPLILTHEEAATGLAIMREALASLS----
                                      :            . *.:                          

ARGD_METTH            ---------
ARGD_METAC            ---------
ARGD_ARCFU            ---------
Q5SJU9_THET8          GLLG-----
ARGD_COREF            ---------
F8E0T1_CORRG          EET------
ARGD_MYCTU            ---------
C3JQR6_RHOER          PGEK-----
ARGD_STRCL            EGQTGE---
D7BYP9_STRBB          -GH------
J7LHM4_NOCAA          KEQ------
ARGD_BIFLO            ---------
K4IRC3_BIFAP          RQDDQ----
ARGD2_BORPA           ---------
ARGD_RALSO            ---------
ARGD2_BRADU           VA-------
D2BIK8_DEHMV          ---------
ARGD_PROMA            ---------
A2BY08_PROM5          ---------
ARGD_NOSS1            ---------
E6UBF2_RUMA7          ---------
D8IAY1_BRAP9          ---------
ARGD_HAEDU            ---------
Q187Z9_CLOD6          ---------
ARGD_WOLSU            ---------
A6Q3W6_NITSB          ---------
ARGD_CANGA            ---------
ARGD_YEAST            ---------
ARGD_NEUCR            ---------
ARGD_YARLI            ---------
ARGD_DEBHA            SSFSQS---
ARGD_SCHPO            ---------
ARGD_DICDI            ---------
ARGD_CAMJE            ---------
A4XM22_CALS8          A--------
ARGD_YERPE            ---------
ARGD_ECOLI            ---------
ARGD_SHEON            ---------
ASTC_SALPC            SCG------
ASTC_SALNS            PCG------
ASTC_SHIB3            S--------
ARGD_BUCAP            ---------
ARGD_XANAC            ---------
ARGD_XYLFT            G--------
ARGD1_BRADU           KRAAS----
ARGD1_CAUVC           ---------
ARGD2_CAUVC           A--------
ARGD_MYXXA            ---------
ARGD_CHLTE            ---------
B3EFM7_CHLL2          ---------
I3ZFJ4_TERRK          VLAGEQVHG
Q312C1_DESAG          ---------
T2GCQ9_DESGG          ---------
ARGD1_BORPE           ---------
F4GBM1_ALIDK          ---------
N8SJL7_ACILW          ---------
N9GR10_ACIHA          ---------
Q4FSU9_PSYA2          ---------
ARGD2_PSESM           ERSA-----
A0A2S6F968_LEGPN      ---------
ARGD_LEPIN            ---------
ARGD_BACSU            ---------
ARGD_BACCR            ---------
ARGD_LACPL            TNE------
I9L3N6_LACPE          ---------
ARGD_LISIN            ---------
ARGD_STRMU            ---------
ARGD_STAEQ            ---------
ARGD_LACLA            ---------
F2F8U6_SOLSS          ---------
D5EL86_CORAD          ---------
D2R6P7_PIRSD          ---------
Q9RZC5_DEIRA          ---------
Q1IZP5_DEIGD          ---------