CLUSTAL format seed alignment for MF_01110

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ARGC2_NOSS1       ----------------MNKPKIFIDGEAGTTGLQIYSRLNERDDIELVSIAASKRKDADE
ARGC_TRIV2        ----------------MNKPKIFIDGEAGTTGLQIYSRLNERDDIELVSIAASKRKDADE
ARGC_CAUVC        ---------------MANAPKVFIDGEAGTTGLQIRERLVGRTDLQLISIDPDKRKDADA
D4Z0G3_SPHJU      -----------------MTQRIFIDGGVGTTGLEINERLAGRPELSIIALDADRRKDASA
ARGC_RHILO        -----------------MKPKIFIDGEHGTTGLQIRALLAERGDLEIISIPTERRKETAA
ARGC_CHESB        -----------------MTAKIFIDGEHGTTGLQIRARLGERRDIELLSIPVERRKDPAA
ARGC_BRUSU        -----------------MKPKIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDL
ARGC_BRUAB        -----------------MKPKIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDL
ARGC_BRUC2        -----------------MKPKIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDL
ARGC_BRUA2        -----------------MKPKIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDL
ARGC_BRUME        -----------------MKPKIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDL
ARGC_BRUO2        -----------------MKPKIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDL
ARGC_BRUSI        -----------------MKPKIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDL
ARGC_OCHA4        -----------------MKPKIFIDGEHGTTGLQIRTRLAERDDLEVISIPEAERRNKDL
ARGC_RHIEC        -----------------MAPKIFIDGEHGTTGLQIRTRMAGRRDVELLSIPEAERRNAAM
ARGC_RHIET        -----------------MAPKIFIDGEHGTTGLQIRTRMAGRRDVELLSIPEAERRNAAM
ARGC_RHIL3        -----------------MAPKIFIDGEHGTTGLQIRTRMAGRRDVELLSIPEAERRNAAM
ARGC_AGRFC        -----------------MTAKIFIDGEHGTTGLQIRTRLAGRRDIELLSIPETERRNAAM
ARGC_SINMW        -----------------MKPKIFIDGEHGTTGLQIRTRMAGRTDLELLSIPEAERRNAAM
ARGC_RHIME        -----------------MKPKIFIDGEHGTTGLQIRVRMAGRTDLELLSIPEAERRNAAM
E6YI22_BARC7      -----------------MATKIFIDGEHGTTGLQIQKRLAKRSDLELLSIPHEDRHKLDS
ARGC_DEIRA        ----------------MNKPKIFIDGEAGTTGLQIRERLAGRSDLELLSIDPVRRKDSAA
ARGC_DEIGD        ----------------MTPPRIFIDGEAGTTGLQIRARLEGREDLELLSIDPARRKDPEA
ARGC2_PSEPK       ----------------MHTPVVFIDGDQGTTGLQIHARLQGRSDLRLLTLPEAERKDPQR
B2AIM2_CUPTR      ----MFNPNVRGGQPPMSSPVVFIDGDQGTTGLQIHERLRHRTDIRLVTLPAAERKDPRR
A1WGS9_VEREI      ------------------MTRIFIDGEAGTTGMKLAERVRASGRFELVTLTEAERKQTEA
Q0BTI7_GRABC      MRGGCLSCSGGWKGMIEMTHSIFIDGESGTTGLGIRERLGDLPGVSLRSLPAEHRKDPKA
D2TCA1_ERWP6      ---------------MSQKYRVFIDGQAGTTGLQIQQRLASHPQIEMLQIDEAQRKDAAA
F2JVR4_MARM1      ------------------MKKVFIDGETGTTGLQVRDRLLNHPHIEIISIDPAKKRDVEE
Q2STZ0_BURTA      -----------------MSTKVFVDGQEGTTGLKIFEYLSARSDIEILRIDEAKRKDVDE
B9BC02_9BURK      -----------------MSTKVFVDGQEGTTGLKIFEYLSARNDIEILRIDEAKRKDVDE
ARGC_RALSO        -----------------MAFKVFVDGQEGTTGLRLLDYLSQRDDIELLRIAEDRRKDPAE
C6D3J2_PAESJ      -----------------MNYTVFVDGQEGTTGLKLLDYLSRFSSIEVLKINPEKRKDPRE
B8I8A4_RUMCH      -----------------MKYKIYVDGSEGTTGLKINERLEKRNDIEILKINPEKRKDINE
D1BNM9_VEIPT      ----------------MTPHRVFIVGHEGTTGLRIHERLSDRKDIELLATADEDRKNVEA
G4Q2H4_ACIIR      ------------------MIKVFIDGSQGTTGLRLKDRLMERKDIELLTISEEERKSLPA
B3H083_ACTP7      ----------------MSKYKIFVDGAVGTTGLRIFDRLASAEDIELLSLPEELRKDLNA
                                       ::: *  ****: :   :     . :       ::.   

ARGC2_NOSS1       RAKLLNSVDVAILCLPDDAAREAVSLVN---SSQVKILDASTAYRTAQGWVYGFPEMNPG
ARGC_TRIV2        RAKLLNSVDVAILCLPDDAAREAVSLVH---SSQVKILDASTAYRTAQGWVYGFPELNPG
ARGC_CAUVC        RAEMLNSADAVILCLPDDAAKEAVSLVS---NPNTVIIDASTAYRTAEGWAYGFAELDSE
D4Z0G3_SPHJU      RRDALNAADIVILCLPDDAAREAVALID---NGRTRVIDASTAHRVADGWAYGFAELEPG
ARGC_RHILO        RAEFLNAADIAILCLPDDAAKESVSLIT---NDTTKVIDASTAHRVAEGWAYGFAEMDKE
ARGC_CHESB        RAEFLNAADIAILCLPDDAARESVSLIA---NDTTRVIDASTAYRVSEGWAYGFPEMDKS
ARGC_BRUSU        RADYLRAADIAILCLPDDASKEAVSLLEG--HNSTRIIDTSTAHRVHPDWAYGFAELAKG
ARGC_BRUAB        RADYLRAADIAILCLPDDASKEAVSLLEG--HNSTRIIDTSTAHRVHPDWAYGFAELAKG
ARGC_BRUC2        RADYLRAADIAILCLPDDASKEAVSLLEG--HNSTRIIDTSTAHRVHPDWAYGFAELAKG
ARGC_BRUA2        RADYLRAADIAILCLPDDASKEAVSLLEG--HNSTRIIDTSTAHRVHPDWAYGFAELAKG
ARGC_BRUME        RADYLRAADIAILCLPDDASKEAVSLLEG--HNSTRIIDTSTTHRVHPDWAYGFAELAKG
ARGC_BRUO2        RADYLRAADIAILCLPDDASKEAVSLLEG--HNSTRIIDTSTAHRVHPDWAYGFAELAKG
ARGC_BRUSI        RADYLRAADIAILCLPDDASKEAVSLLEG--HNSTRIIDTSTAHRVHPDWAYGFAELTKG
ARGC_OCHA4        RADYLRAADIAILCLPDDASKEAVSLLEG--HNSTRIIDTSTAHRVHPDWAYGFAELAKG
ARGC_RHIEC        REDMLNSADIAMLCLPDDASKEAVQMVSA--NNNVRVIDTSTAFRVNPGWAYGFAEMDKE
ARGC_RHIET        REDMLNSADIAMLCLPDDASKEAVQMVSA--NNNVRVIDTSTAFRVNPGWAYGFAEMDKE
ARGC_RHIL3        REDMLNGADIAILCLPDDASKEAVQMVSA--NNNVRVIDTSTAFRVNPGWAYGFAEMDKQ
ARGC_AGRFC        REDLLNNADISILCLPDDASKEAVSMVAG--NNNVRIIDTSTAYRVHQDWAYGFAEMDRD
ARGC_SINMW        REDLLNSADIAILCLPDDASREAVAMVAG--NNRVRIIDTSTAHRVAPDWAYGFAEMDKA
ARGC_RHIME        REDLLNSADIAILCLPDDASREAVAMVAG--NNRVRIIDTSTAHRVAPDWAYGFAEMDKA
E6YI22_BARC7      RQDYLNQADIVILCLPDKAARETINLLKN--KKKIRIIDSSTAHRTAPDWVYGFPEMTAG
ARGC_DEIRA        RAELLNAADVSILCLHDDAAREAVSLTT---NPASRLLDASTAHRIHPDWVFGFPELSAE
ARGC_DEIGD        RRELLNAADIAVLCLHDDVAREAVAMIE---NPATRVLDASSAHRTAQGWAYGFPELTKQ
ARGC2_PSEPK       RCEAINSADIALLCLPDDAAREAVAAIH---NPQVRVIDASSAHRTTPGWVYGLPELDEQ
B2AIM2_CUPTR      RAEAINACDIAILCLPDAAAREAVGAIA---NPAVRVIDASSAHRTQPEWTYGFPEMAPG
A1WGS9_VEREI      RRAALDACDIAVLCLPDEAAREAVALVS---NPQVKLLDASVAHRVSPGWCYGFPEMTAG
Q0BTI7_GRABC      KRAILAEVDLAILCLPDEAAKETVALADSLGGNAPKLLDASTAHRVAEGWIYGFAELQAD
D2TCA1_ERWP6      RQALMKQADVSILCLPDAAARDAVALAN---EVGARVLDASSAHRVEAGWVYGLPELAPG
F2JVR4_MARM1      KRRLMKEADVTVLCLPDEAAKDSVILAK---EEGCRILDASSVHRVADGWVYGLPELDVS
Q2STZ0_BURTA      RRRLINASDVTFLCLPDVASRESATLVEN---TNTTLIDASTAFRTSADWAYGLPELSRA
B9BC02_9BURK      RRRLINASDVTFLCLPDVASRESASLVEN---PATTLIDASTAFRTHADWAYGLPELARG
ARGC_RALSO        RAKFLNAADVAFLCLPDVASREAVSLVDN---PNTCIIDASTAFRTSDDWAYGLPELAPG
C6D3J2_PAESJ      REKLLNEADLAFLCLPDSAAKESVSLIKN---EKTKIINASSLFRTDKNWIYGLPELKH-
B8I8A4_RUMCH      RKKYINEADIVFLCLPDAAAKEAITLVEN---SSTKIIDASTAHRINPDWAYGLPELGIE
D1BNM9_VEIPT      IKVVAKKADLVFLCLPDVASKEIMAAIGD---FPCKVIDTSTAFRTTAGWAYGFPELGES
G4Q2H4_ACIIR      RAQKVAEADVAFLCLPDAASRELVETVKD---VDTKIIDTSTAFRCDDRWAYGFPELGIS
B3H083_ACTP7      RVAKVAEADLTFLCLPDEASKELVAH-AP---ADARICDTSTAHRVNPNWTYGFAEFSGQ
                          *  .*** * .:::              : ::*  .*    * :*:.*:   

ARGC2_NOSS1       QREKIANAQFVSNPGCYPTGFLACVRPLIAQGILPSSFPITINAVSGYSGGGKSLIQKYD
ARGC_TRIV2        QREKIANAQFVSNPGCYPTGFLACVRPLIAQGILPSSFPITINAVSGYSGGGKSLIQKYD
ARGC_CAUVC        QRGKIAASKRISNPGCYPTGAIALTRPLVSAGILPAELPVSYNAVSGYTGGGKAMIAQFE
D4Z0G3_SPHJU      HRERLANSRFVANPGCWPTGFLALVRPLVLAGLLPVDWPVTVSGASGYSGGGKSMIAEYE
ARGC_RHILO        QAKAIATAKRVANPGCWPQGPIATLRPLVTSGLLPADFPITVNGISGYSGGGRPMIEDYV
ARGC_CHESB        QSKAIAQAKRVANPGCWPQGPIALLRPLVSAGLLPADFPVTINGITGYSGGGRSMIEDYE
ARGC_BRUSU        QRERIAEARLVANPGCYPTGAIALVRPLRDAGLLPADYPVSVNAVSGYTGGGKQLIAQME
ARGC_BRUAB        QRERIAEARLVANPGCYPTGAIALVRPLRDAGLLPADYPVSVNAVSGYTGGGKQLIAQME
ARGC_BRUC2        QRERIAEARLVANPGCYPTGAIALVRPLRDAGLLPADYPVSVNAVSGYTGGGKQLIAQME
ARGC_BRUA2        QRERIAEARLVANPGCYPTGAIALVRPLRDAGLLPADYPVSVNAVSGYTGGGKQLIAQME
ARGC_BRUME        QRERIAEARLVANPGCYPTGAIALVRPLRDAGLLPADYPVSVNAVSGYTGGGKQLIAQME
ARGC_BRUO2        QRERIAEARLVANPGCYPTGAIALVRPLCDAGLLPADYPVSVNAVSGYTGGGKQLIAQME
ARGC_BRUSI        QRERIAEARLVANPGCYPTGAIALVRPLRDAGLLPADYPVSVNAVSGYTGGGKQLIAQME
ARGC_OCHA4        QRERIAEARLVANPGCYPTGAIALVRPLRDAGLLPADYPVSVNAVSGYTGGGKQMIAQME
ARGC_RHIEC        QAEKIASARFVSNPGCYPTGAIGLIRPLRAAGILPDGYPVTVNAVSGYSGGGKQMIAQME
ARGC_RHIET        QAEKIASARFVSNPGCYPTGAIGLIRPLRAAGILPDGYPVTVNAVSGYSGGGKQMIAQME
ARGC_RHIL3        QADKIAAARFVANPGCYPTGAIGLIRPLRAAGILPDGYPITVNAVSGYTGGGKQMIAQME
ARGC_AGRFC        QGEKVRSARFVANPGCYPTGAIGLIRPLRASGILPDGYPVSVNAVSGYTGGGKQMIAQME
ARGC_SINMW        QPRKIRDARHVANPGCYPTGAIALIRPLRQAGILPDGYPVTVNAVSGYTGGGKQMIAQIE
ARGC_RHIME        QPQRIRDARHVANPGCYPTGAIALIRPLRQAGILPDGYPVTVNAVSGYTGGGKQMIAQME
E6YI22_BARC7      QKKRIQEARYVANPGCYPTGAISLIRPLREAGLIDSDYPISINAISGYTGGGKQLIAQME
ARGC_DEIRA        QPEKIRQARYVANPGCYSTGAIALLAPLTGRGLLPADFPVHIQGYSGYTGGGRALVDAHE
ARGC_DEIGD        SREEIRAARLVSNPGCYATGAVALLRPLTDAGLLPPDLPLSVQGFSGYSGGGRALVEAHE
ARGC2_PSEPK       QAERIAQSTRVSNPGCYPTGAIALLHPLVKAGLLPADYPLNIHAVSGYSGGGRAAVERHE
B2AIM2_CUPTR      QGEQIAKSSRVTNPGCYPTGAVGLLRPLAQAGLMPADYPISIHAVSGYSGRGRAGVEEYE
A1WGS9_VEREI      QRQRIAGAMRVTNPGCFATGALALLRPLVDAGLLAADTPLVLHGVSGYSGGGRQLIAAFE
Q0BTI7_GRABC      QEAQIRSAGKVANVGCYAVGSISLLRPLIDAGLIAPDQPLSINAISGYSGGGKNMIEAHE
D2TCA1_ERWP6      QREKISCASHVANPGCYATGAIALLAPLTRTGLLKADSQLAINAISGYSGGGNQMIEKYR
F2JVR4_MARM1      QRAKIADAQFVSNPGCYPTGAILLLKPLVEAGLLAANGNYSINAVSGYSGGGNALIDRYE
Q2STZ0_BURTA      QRERIRTAKRIAVPGCHASAFVLAMRPLVDAGVVAPDFAAHSYSITGYSGGGKKMIADYE
B9BC02_9BURK      QREKIRTSKRIAVPGCHASAFVLAMRPLVEAGIVAPTFAAHSYSITGYSGGGKSMIADYE
ARGC_RALSO        QRERLRNSKRIAVPGCHASAFVLLMRPLVEAGIVPADYPITAFSLTGYSGGGKKMIADYL
C6D3J2_PAESJ      QRERIQYSSRISVPGCHATGFILSVSPLIESGVLQKDYPVSCYSISGYTGAGKSGIDEYE
B8I8A4_RUMCH      LRKKIQSSKRVAVPGCYATGFISIVYPIVAANIIPKDYPLTCHALSGYSGGGKKLISQYE
D1BNM9_VEIPT      YKTAIATKKHIANPGCHASGMIACIAPLVKAGLVPVDYPFTITSLTGYSGGGKKMIGQYE
G4Q2H4_ACIIR      FLEKIRNGSRISVPGCHASGSIAVIAPLVQMGLVSPSRTLTITSLTGYSGGGKKMIAEYE
B3H083_ACTP7      F-EKIQNANRVAVPGCHATGYIALVRPLIEKGALSADYPLSCHSLTGYSGGGKAMIAEYQ
                      :     ::  ** . . :    *:   . :         . :**:* *.  :    

ARGC2_NOSS1       SFHEQQKGATSDYPFGIYGLQFGHKHVKEMHQHSGLASPPLFIPAVGDFEQGMLVQIPLP
ARGC_TRIV2        SFHEQQKGATSDYPFGIYGLQFGHKHVKEMHQHSGLASPPLFIPAVGDFEQGMLVQIPLP
ARGC_CAUVC        ---DESAADHTRAPYFIYGLSLSHKHVPEMQKHGGLLTRPIFTPAVGRYAQGMIVEMPLH
D4Z0G3_SPHJU      ---GAGGAPSAFRPY---GLGLAHKHVPEMQRYSGLRHPPLFAPAVANAYRGMIVEVPLQ
ARGC_RHILO        ---AKGEDASEFLPY---GLTLQHKHVPELRAYAKLSHDPIMQPAVGNFAQGMITVVPLQ
ARGC_CHESB        ---GKGEDAPEFFPY---GLTLSHKHLPELRTYAKLARDPLMQPVVGNFAQGMITMVPLQ
ARGC_BRUSU        ---DRNHPDYLAANNFLYGLPLKHKHVPELQLHGRLDRRPIFSPSVGRFPQGMIVQVPLF
ARGC_BRUAB        ---DRNHPDYLAANNFLYGLPLKHKHVPELQLHGRLDRRPIFSPSVGRFPQGMIVQVPLF
ARGC_BRUC2        ---DRNHPDYLAANNFLYGLPLKHKHVPELQLHGRLDRRPIFSPSVGRFPQGMIVQVPLF
ARGC_BRUA2        ---DRNHPDYLAANNFLYGLPLKHKHVPELQLHGRLDRRPIFSPSVGRFPQGMIVQVPLF
ARGC_BRUME        ---DRNHPDYLAANNFLYGLPLKHKHVPELQLHGRLDRRPIFSPSVGRFPQGMIVQVPLF
ARGC_BRUO2        ---DRNHPDYLAANNFLYGLPLKHKHVPELQLHGRLDRRPIFSPSVGRFPQGMIVQVPLF
ARGC_BRUSI        ---DRNHPDYLAANNFLYGLPLKHKHVPELQLHGRLDRRPIFSPSVGRFPQGMIVQVPLF
ARGC_OCHA4        ---DKSHPEHLAANNFLYGLPLKHKHVPELQLHGRLDRRPIFSPSVGRFPQGMIVQVPLF
ARGC_RHIEC        ---NPDHPDAITAPHFLYGLPLTHKHVPEMTVHGLLDRAPIFSPSVGKFAQGMIVQVPLH
ARGC_RHIET        ---NPDHPDAITAPHFLYGLPLTHKHVPEMTVHGLLDRAPIFSPSVGKFAQGMIVQVPLH
ARGC_RHIL3        ---NPDHPDAITAPHFLYGLPLTHKHVPEMTVHGLLDRAPIFSPSVGKFAQGMIVQVPLH
ARGC_AGRFC        ---DQSRDDAISANNFLYGLTLKHKHVPEMTIHGQLDRAPLFAPSVGRFPQGMIVQVPLF
ARGC_SINMW        ---DDKSPDHIRAPHFLYGLTLKHKHVPEMKMHGLLERAPVFSPSVGKFAQGMIVQVPLY
ARGC_RHIME        ---DDQNPDHIGAPHFLYGLTLKHKHVPEMKMHGLLERAPVFSPSVGKFAQGMIVQVPLY
E6YI22_BARC7      ---NQSRKDSLKENYFIYGLNLNHKHIPEIKIHGQISQTPVFVPSVGRFPQGMIVNIPLH
ARGC_DEIRA        ----QGSAHPSKGAFISYGLTLEHKHLPETMVYGGLTRKPVFTPNVGGWAQGMTVTVPLH
ARGC_DEIGD        ----GRGEHPMAGPFKSYALSLIHKHQPEMARHGGLKHAPLFTPHVGGWRQGMLVQIPLH
ARGC2_PSEPK       ----QPG-AAKAPALQLYGLELAHKHVPEIQQHAGLSARPMFMPGYGAYRQGIALSIPLQ
B2AIM2_CUPTR      ----GPG-AAEAPAYQVYGLQLAHKHAPEIQQHACLAQRPIFIPAYGAFRQGIVLTVPLS
A1WGS9_VEREI      ----GDGPDAIRSNHYLYSLEQPHKHLPEIVLHSGLASAPVFIPSVGRYRQGMLVSLVLH
Q0BTI7_GRABC      --------KEGGPAFELYALGLEHKHLPEIMAYAGLTRRPIFVPSVGHFPQGMLVSVPLH
D2TCA1_ERWP6      -------HAGNG--YAAYGLGFDHKHIKEIEAWGGLSSRPILQPAVGDYAQGMLVFIPLN
F2JVR4_MARM1      -------NGNDAPVFGAYGLNFNHKHLPELKVWSGLEKAPIFAPSVGDFRQGMLTFLPMH
Q2STZ0_BURTA      ------AGGAKLASPRPYALGLAHKHLPEMAAHTGLASAPIFTPIVGPFYKGLAVTTYF-
B9BC02_9BURK      N----AAPGGKLASPRAYALGLTHKHLPEMAAHTGLANPPIFTPIVGPFLKGLAVTTYF-
ARGC_RALSO        -----AADNPKLQSPRPYALALTHKHLPEMRVQSKLALPPIFTPVVGNFLKGLAVTIGL-
C6D3J2_PAESJ      HA--DSASINKLNVPRPYSLLHKHKHLPEMAMFSGLDYEPLFTPIKANYPQGLAMTVPL-
B8I8A4_RUMCH      -----SPQGHNFESPQLYALGLSHKHIPEMTVISGLEFPPIFSPIVCSYFKGMSVCVPL-
D1BNM9_VEIPT      SN----PKDYFLYAPRQYGLGQEHKHLPEVQHVCGIIEAPIFMPIVDDYYSGMEVTVGI-
G4Q2H4_ACIIR      G-----PHDHEVDAPRIYALGQTHKHLPEIKKYTGLASLPIFLPIVAPYYSGMLVTVGI-
B3H083_ACTP7      NP----DREQKFSAPRVYGLALKHKHLPEMQALTGSNHPPIFTPVVADYYSGMLVTVPLP
                                    .*   ***  *          *:: *       *:     : 

ARGC2_NOSS1       LWT-LDNPPSGEEIHQAIAQYYQG--EKFVQVAPFKDPSLLRDGTFLDATAVNGTNIVQV
ARGC_TRIV2        LWT-LDNPPSGEEIHQAIAQYYQG--EKFVQVASFKDPSLLRDGTFLDATAVNGTNIVQV
ARGC_CAUVC        LST-LNGAPSLADIHAALVKHYKG--EAFVEVASLDEAKAL---TTLDPEGLNGTNRLKL
D4Z0G3_SPHJU      LRA-LPGAPSAADVHGALAAAYAG--SPIVGVEALEDSAAM---TQVRLEHVGATDRLAL
ARGC_RHILO        LGG-LDSVPTGAELHAAIADHFAAIKGGVVEVAPYAHLERM---PEIDPEIYNGTNRMKV
ARGC_CHESB        LGH-LPRVPKGEELHAAIADHYAGIEGSAVEVAPFQAIERS---PEIEPERYNDTNTMRL
ARGC_BRUSU        LSE-LEGSPSLAKVHAVLTEHYAG--QDIVEVVPLEESAKL---PRVDAEELAGKDGMKL
ARGC_BRUAB        LSE-LEGSPSLAKVHAVLTEHYAG--QDIVEVVPLEESAKL---PRVDAEELAGKDGMKL
ARGC_BRUC2        LSE-LEGSPSLAKVHAVLTEHYAG--QDIVEVVPLEESAKL---PRVDAEELAGKDGMKL
ARGC_BRUA2        LSE-LEGSPSLAKVHAVLTEHYAG--QDIVEVVPLEESAKL---PRVDAEELAGKDGMKL
ARGC_BRUME        LSE-LEGSPSLAKVHAVLTEHYAG--QDIVEVVPLEESAKL---PRVDAEELAGKDGMKL
ARGC_BRUO2        LSE-LEGSPSLAKVHAVLTEHYAG--QDIVEVVPLEESAKL---PRVDAEELAGKDGMKL
ARGC_BRUSI        LSE-LEGSPSLAKVHAVLTEHYAG--QDIVDVVPLEESAKL---PRVDAEELAGKDGMKL
ARGC_OCHA4        LTG-LEGTPSLAKVHSVLTDHYAG--QDIVEVAPLEESAKL---ARVDAEELAGKDGMKL
ARGC_RHIEC        LDD-LAEGTTMESIHAALVAHYAG--QEIVTVVPLSDSKAL---ARVNAVELEGKDTMKL
ARGC_RHIET        LDD-LAEGTTMESIHAALVAHYAG--QEIVTVVPLSDSKAL---ARVNAVELEGKDTMKL
ARGC_RHIL3        LDD-LAEGTTMESIHAALVAHYAG--QDIVSVVPLAESKAL---PRVNAIELEGKDTMKL
ARGC_AGRFC        AAD-LAEGTTIETIHAALTAHYAG--QDIVSVVPLAESKGI---SRIDAEELAGKDTMKL
ARGC_SINMW        VDD-LAAGATIESIHRALVDHYAG--QSIVEVVPLEESAKL---ARIDATELAGKDTMKL
ARGC_RHIME        LED-LAAGATLETIHRALVDHYAG--QSIVEVVPLDESAKL---ARIDATELAGSDAMKL
E6YI22_BARC7      RNL-FTKSASCSNLREILHIHYNE--QNAISVASKEETETL---TKLDPESLAHKDSMKL
ARGC_DEIRA        LAE-L--GVSAEALHAALKEHYAG--QQYVKVFELADNPE-----ILDPQTLNGTNNLEL
ARGC_DEIGD        LGL-L--GVTAAQLHEALADHYAG--ERFVRVMPFEHGQPADP--ILDPQTLNGTNELEL
ARGC2_PSEPK       LRL-LPGQVSAEHLQACLEQHYQG--ARHVQVMPLHQCGAAA---NLDPEALNGSNDLRL
B2AIM2_CUPTR      LRQ-LAPGVDGATLHACLARHYAE--ATHVRVLPLHESGALT---HLDPQALNGTNDMQL
A1WGS9_VEREI      AGL-LRAGPHGDVPDTLLSTYRQH--YSASEDIAVRATVPGG---RLDPEALNDTNRMEI
Q0BTI7_GRABC      LDD-LPGRPSASDLEAALRTHYSA--ARQVRVLDVV--------STLRAEDASGSDHLEL
D2TCA1_ERWP6      ----DIDGEP---LQQALADYYAG--QQFIQVNPLNALDEDS-APYLLPESLNNTNNLEL
F2JVR4_MARM1      LEG-DTTMAQ---LHAKLTETYDN--EAFVAVNELNLIADDA-APFLTPHGVDNTNNVEL
Q2STZ0_BURTA      TPGQLAKRVTPQDVQRVFAEHYAG--EAFVRVAPYDAAENLDD-GFFDVQANNDTNRVDL
B9BC02_9BURK      TPEQLAKRATPQDVQRVFAEYYAD--EPFVRVAPFNADANLDG-GFFDVQANNDTNRVDL
ARGC_RALSO        HPQHLASKVSPADIAKVFADYYQG--EQFIRVAPADNVETLDN-GFFDVQGANDTNRADL
C6D3J2_PAESJ      IGRSMVKKASAKTVHEILAAYYES--ERFVQVIPYDSEAYLED-GHFLIDECKNTNRLEI
B8I8A4_RUMCH      HRRLLPDNLSMEKIHEFISDYYSN--EEFIKVMPLGMEKEFPN-SFLGATRVNDTNYLEI
D1BNM9_VEIPT      HSRLCHKPVCIDKVQQTLEYFYKD--STIVTVAPF--TENSNS-GMLNANQLSNTDSMKI
G4Q2H4_ACIIR      ENR---DHQRLEDIRQGYREFFGP--SPFISVAG----EEENP-VMLGSNTLSGKDSMRL
B3H083_ACTP7      VSALSQAVNSAEKIANLFSEYYQN--SKLITVHPA--CSLPED-GMLAANTFSGKDSLEI
                                                                .       .:   :

ARGC2_NOSS1       FVFGNDNTKEALLVARLDNLGKGASGAAVQNLNIMLGLPEELGL----------------
ARGC_TRIV2        FVFANDNTKEALLVARLDNLGKGASGAAVQNLNIMLGLPEELGL----------------
ARGC_CAUVC        FVFGSDAGGQARLVALLDNLGKGASGAAVQNLNIALGLDEAAGL----------------
D4Z0G3_SPHJU      FVFGNEATGQARLVAALDNLGKGAAGAAVQNLNILAGLPETAGLRL--------------
ARGC_RHILO        YVFANDKRAQALLLAVYDNLGKGASGAAVQNMDLMLGL----------------------
ARGC_CHESB        YVFANDARAQALLLAVYDNLGKGASGAAVQNLDLMLSGLR--------------------
ARGC_BRUSU        FVFGTEDHGQVNLVALLDNLGKGASGAAVQNMNLMLGK----------------------
ARGC_BRUAB        FVFGTEDHGQVNLVALLDNLGKGASGAAVQNMNLMLGK----------------------
ARGC_BRUC2        FVFGTEDHGQVNLVALLDNLGKGASGAAVQNMNLMLGK----------------------
ARGC_BRUA2        FVFGTEDHGQVNLVALLDNLGKGASGAAVQNMNLMLGK----------------------
ARGC_BRUME        FVFGTEDHGQVNLVALLDNLGKGASGAAVQNMNLMLGK----------------------
ARGC_BRUO2        FVFGTEDHGQVNLVALLDNLGKGASGAAVQNMNLMLGK----------------------
ARGC_BRUSI        FVFGTEDHGQVNLVALLDNLGKGASGAAVQNMNLMLGK----------------------
ARGC_OCHA4        FVFGTEGDGEVNLVALLDNLGKGASGAAVQNMNLMLGKV---------------------
ARGC_RHIEC        FVFGTPGGSQVNLVALLDNLGKGASGAAVQNMDLMLAS----------------------
ARGC_RHIET        FVFGTPGGSQVNLVALLDNLGKAPRG--VQNMDLMLAS----------------------
ARGC_RHIL3        FVFGTPGASQVNLVALLDNLGKGASGAAVQNMDLMLAS----------------------
ARGC_AGRFC        FVFGTPGGEHINLVALLDNLGKGASGAAVQNMELMLSA----------------------
ARGC_SINMW        FVFGTDGGAHVNMVALLDNLGKGASGAAVQNMDLMLSA----------------------
ARGC_RHIME        FVFGTKGGAHVNLVALLDNLGKGASGAAVQNMDLMLSA----------------------
E6YI22_BARC7      FVFGNENEGIFNLCSILDNLGKGASASAVQNLDLMLSER---------------------
ARGC_DEIRA        FVYPAADGERALLAARLDNLGKGASGAAVQNLELMLGLS---------------------
ARGC_DEIGD        FVYAGPNGEHALLVSRLDNLGKGASGAAVQNLDVMLGLEGAGHSYRLAEGG---------
ARGC2_PSEPK       ALYANPEHGQVLLTAVFDNLGKGASGAAVQNLDLMLGALQAHG-----------------
B2AIM2_CUPTR      GVFHNVESGHVLLSAVFDNLGKGASGAAVQNLDLMLARRACY------------------
A1WGS9_VEREI      FVLADPGRRHVTAIARLDNLGKGSSGAALVNLELMARLRV--------------------
Q0BTI7_GRABC      RVFGNENRRQAVLVAKLDNLGKGASGSAIQNARLMLGLE---------------------
D2TCA1_ERWP6      FVFSHAQQRQCILAARLDNLGKGASGAAVQNLNLMLGLAEETCVNL--------------
F2JVR4_MARM1      SVLSAPDNQSGVIVAKLDNLGKGASGAAVQNLNIMLGFDEGIAVNL--------------
Q2STZ0_BURTA      FVFGTAE--RFVTVARLDNLGKGASGAAIQCMNLNIGAAEDTGLAR--------------
B9BC02_9BURK      FVFGNEE--RFVTVARLDNLGKGASGAAIQCMNINIGAAEDTGLKR--------------
ARGC_RALSO        FVFGSDE--RMVVTARLDNLGKGAAGAAVQCMNVHLGVDEATSLHVEAPVKAEGPAHPVR
C6D3J2_PAESJ      FVFGQDD--HITIVSRYDNLGKGASGAAIQNMNLMLGFDEASALVL--------------
B8I8A4_RUMCH      FVTGNEE--QIMLVSVLDNLGKGSSGAAIQNMNIMLGFDENTGL----------------
D1BNM9_VEIPT      YVTGNDE--RIMVHAIFDNLGKGASGAAVQCMNIALGLPEDTGLVLG-------------
G4Q2H4_ACIIR      YICGNMD--RITVSAQFDNLGKGASGAALESMNIALGLDPTTGLSL--------------
B3H083_ACTP7      FVYGNET--QLLLCARFDNLGKGASGAAVQCMNIMLGREETAGLDV--------------
                   :            :  *****.. .  :    :                          

ARGC2_NOSS1       --------
ARGC_TRIV2        --------
ARGC_CAUVC        --------
D4Z0G3_SPHJU      --------
ARGC_RHILO        --------
ARGC_CHESB        --------
ARGC_BRUSU        --------
ARGC_BRUAB        --------
ARGC_BRUC2        --------
ARGC_BRUA2        --------
ARGC_BRUME        --------
ARGC_BRUO2        --------
ARGC_BRUSI        --------
ARGC_OCHA4        --------
ARGC_RHIEC        --------
ARGC_RHIET        --------
ARGC_RHIL3        --------
ARGC_AGRFC        --------
ARGC_SINMW        --------
ARGC_RHIME        --------
E6YI22_BARC7      --------
ARGC_DEIRA        --------
ARGC_DEIGD        --------
ARGC2_PSEPK       --------
B2AIM2_CUPTR      --------
A1WGS9_VEREI      --------
Q0BTI7_GRABC      --------
D2TCA1_ERWP6      --------
F2JVR4_MARM1      --------
Q2STZ0_BURTA      --------
B9BC02_9BURK      --------
ARGC_RALSO        EAAPDFAT
C6D3J2_PAESJ      --------
B8I8A4_RUMCH      --------
D1BNM9_VEIPT      --------
G4Q2H4_ACIIR      --------
B3H083_ACTP7      --------