CLUSTAL format seed alignment for MF_01114

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

RECX_PSEFL      -----------------------------------------MTVVLDTLVAVR-------
RECX_PSETO      -----------------------------------------MTVVLDTLVAVR-------
RECX_PSEF5      -----------------------------------------MTAVLDTLVAVR-------
RECX_PSE14      -----------------------------------------MPVVLDTPVAVR-------
RECX_PSEU2      -----------------------------------------MPAVLDTPVAVR-------
RECX_PSESM      -----------------------------------------MPAVLDTPVAIR-------
RECX_PSEPK      -----------------------------------------MSAVLDTPVAIR-------
RECX_PSEP1      -----------------------------------------MSAVLDTPVAIR-------
RECX_PSEPG      -----------------------------------------MSAVLDTPVAIR-------
RECX_PSEE4      -----------------------------------------MSAVLDTPVAVR-------
RECX_PSEAB      -----------------------------------------MATVLDTPVAVR-------
RECX_PSEAE      -----------------------------------------MAIVLDTPVAVR-------
RECX_PSEA7      -----------------------------------------MATVLDTPVAVR-------
RECX_HALHL      -----------------------------------------MSEAGAASEAVR-------
RECX_XANAC      -----------------------------------------MDEQEPAPKRGRRFKE---
RECX_XANCI      -----------------------------------------MDEQEPAPKRGRRFKE---
RECX_XANC5      -----------------------------------------MDEQEPAPKRGRRFKE---
RECX_XANOR      -----------------------------------------MNEQEPAPKRGRRFKE---
RECX_XANOM      -----------------------------------------MNEQEPAPKRGRRFKE---
RECX_XANCP      -----------------------------------------MSEQAPAPKRGRRFKE---
RECX_XANC8      -----------------------------------------MSEQAPAPKRGRRFKE---
RECX_SALTI      -----------------------------------------MSEPTSRRPAYARL-----
RECX_SALPB      -----------------------------------------MSEPTSRRPAYARL-----
RECX_SALPA      -----------------------------------------MSEPTSRRPAYARL-----
RECX_SALTY      -----------------------------------------MSEPTSRRPAYARL-----
RECX_SALCH      -----------------------------------------MSEPTSRRPAYARL-----
RECX_SALAR      -----------------------------------------MSEPTPRRPAYARL-----
RECX_ECOUT      -----------------------------------------MTESTSRRPAYARL-----
RECX_ECOK1      -----------------------------------------MTESTSRRPAYARL-----
RECX_ECO24      -----------------------------------------MTESTSRRPAYARL-----
RECX_SHIF8      -----------------------------------------MTESTSRRPAYARL-----
RECX_ECO57      -----------------------------------------MTESTSRRPAYARL-----
RECX_ECOL5      -----------------------------------------MTESTSRRPAYARL-----
RECX_SHIFL      -----------------------------------------MTESTSRRPAYARL-----
RECX_ECOL6      -----------------------------------------MTESTSRRPAYARL-----
RECX_SHIBS      -----------------------------------------MTESTSRRPAYARL-----
RECX_ECOLI      -----------------------------------------MTESTSRRPAYARL-----
RECX_ECOHS      -----------------------------------------MTESTSRRPAYARL-----
RECX_ECOLC      -----------------------------------------MTESTSRRPAYARL-----
RECX_SHISS      -----------------------------------------MTESTSRRPAYARL-----
RECX_SHIDS      -----------------------------------------MTESTSRRPAYARL-----
RECX_ENT38      -----------------------------------------MSESKPRRPAYARL-----
RECX_KLEP7      -----------------------------------------MTEPSSRRSGYARL-----
RECX_CROS8      -----------------------------------------MTDATPRRSAYSRL-----
RECX_YERPS      ---------------------------------------------------MNDQ-----
RECX_YERP3      ---------------------------------------------------MNDQ-----
RECX_YERPP      ---------------------------------------------------MNDQ-----
RECX_YERPA      ---------------------------------------------------MNDQ-----
RECX_YERPE      ---------------------------------------------------MNDQ-----
RECX_YERPN      ---------------------------------------------------MNDQ-----
RECX_YERE8      ---------------------------------------------------MNDL-----
RECX_SERP5      ---------------------------------------------------MNDL-----
RECX_PECAS      ---------------------------------------------------MNKP-----
RECX_VIBC3      -----------------------------------------------MSFDLATC-----
RECX_VIBCH      -----------------------------------------------MSFDLATC-----
RECX_VIBVU      -------------------------------------------MHHRFTPPMMSC-----
RECX_VIBVY      -------------------------------------------MHHRFTPPMMNC-----
RECX_VIBPA      -------------------------------------------MYQKRQAPTLSS-----
RECX_HAEIE      -------------------------------------------------------MS---
RECX_HAEIN      -------------------------------------------------------MS---
RECX_HAEIG      -------------------------------------------------------MS---
RECX_HAEI8      -------------------------------------------------------MS---
RECX_MANSM      -------------------------------------------------------MT---
RECX_PASMU      ------------------------------------------MISKHCKEAGNHRMS---
RECX_ACTP2      ------------------------------------------------------MTN---
RECX_HAEDU      ------------------------------------------------------MPK---
RECX_LEGPN      --------------------------------------------------------M---
RECX_LEGPC      --------------------------------------------------------M---
RECX_LEGPA      --------------------------------------------------------M---
RECX_LEGPL      --------------------------------------------------------M---
RECX_ACIAD      ------------------------------------------MIFKHTQTSRAELSG---
RECX_NEIMF      ----------------------------------------------------MKPQ----
RECX_NEIMA      ----------------------------------------------------MKPQ----
RECX_NEIG1      ----------------------------------------------------MKPQ----
RECX_NEIMB      ----------------------------------------------------MKPQ----
RECX_CHRVO      ----------------------------------------------------MAAEG---
RECX_HERSE      ----------------------------------------------------MPRPP---
RECX_RALSO      --------------------------------------------------MALPRQP---
RECX_THET2      -------------------------------------------------------MG---
RECX_THET8      -------------------------------------------------------MG---
RECX_MYCSS      ------------------------------------------MTSFPHPSTSESGPDPDS
RECX_MYCSK      ------------------------------------------MTSFPHPSTSESGPDPDS
RECX_MYCSJ      ------------------------------------------MTSFPHPSTSESGPDPDS
RECX_MYCS2      ------------------------------------------MTSSRPRLTSEPSDVPDG
RECX_MYCVP      ------------------------------------------MTLFPLPSTSDPAEADES
RECX_MYCA1      -----------------------------------------MTASCPPPSTSEPS-----
RECX_MYCUA      -----------------------------------------MTVSFPPPSTSEPS-----
RECX_MYCBP      -----------------------------------------MTVSCPPPSTSE-------
RECX_MYCBO      -----------------------------------------MTVSCPPPSTSE-------
RECX_MYCTA      -----------------------------------------MTVSCPPPSTSE-------
RECX_MYCTU      -----------------------------------------MTVSCPPPSTSE-------
RECX_MYCLE      -----------------------------------------MTTSCPPPSISD-------
RECX_STRLI      ------------------------------------------MEPSAEDGGATSSSRAEK
RECX_STRCO      ------------------------------------------MEPSAEDGGATSSSRAEK
RECX_THEFY      ------------------------------------------MPDRAADGRDGPPGGS--
RECX_AMYMU      ------------------------------------------MPPAEL------------
RECX_COREF      ----------------------MTDPITPHPGENQAAKLEKLRTALEEFSRRQEEGAASS
RECX_CORGL      -------------------------------MDIQAEKIEKLRKALDNFERAHARGE-SD
RECX_CORDI      ---------------------------------MQSEKIAQLKAALQNFSASN-----SD
RECX_CLOPE      ------MGKITSIEVQKRNVNRVNVYVDE-----AFTFACDAELIYKQGIQKDSIIDIEA
RECX_CLOP1      ------MGKITSIEVQKRNVNRVNVYVDE-----AFTFACDAELIYKQGIQKDSVIDVEA
RECX_CLOPS      ------MGKITSIEVQKRNVNRVNVYVDE-----AFTFACDAELIYKQGIQKDSLIDVEE
RECX_CLOB8      ------MAKMTKIEIQKRNKERVNLFLDG-----EYAFSISAELVYKESLKVNSEINPEK
RECX_CLOAB      ----MEENTITKIEAQKKKKDRVNVYIDN-----EYSFSCNTELIYIHGLKKGKVVDLDY
RECX_CLOTE      MDNTSKINKITKIEVQKRNKKRVNLYIND-----EYAMAFSTELAFKHNLKIGQEVDYKE
RECX_CLOD6      ------MGIITKIEQQKRNDDRVNIYVDD-----KFFIAIFKELVYTFNLKKGNEINEEE
RECX_BACSU      ------MPFITKISTQKKNTERFNIFLDD-----KYAFSVDADVLVKFELKKGKELDDLD
RECX_BACVZ      ------MPFITKISTQKKNTERFNIFLDE-----KYAFSVDADVLVRFDLKKGKELDELD
RECX_BACLD      ------MPYITKISAQKNNEERVNIFLDE-----KYAFSVDLDVLVKFDLRKGKELDELD
RECX_BACP2      ------MPYITKISAQKNNTERVNIFLDE-----KYAFSVDLDVLVQHDLKKGKELDEAD
RECX_LISMO      -------MKITSISVQQKNKERYNIFIDE-----KYNFSVDEEVLARYQLMKGKVLTEAD
RECX_LISMF      -------MKITSISVQQKNKERYNIFIDE-----KYNFSVDEEVLARYQLMKGKVLTEAE
RECX_LISW6      -------MKITSISVQQKNKERYNIFIDE-----KYNFSVDEEVLARFQLMKGKVLTEAE
RECX_LISIN      -------MKITSISVQQKNKERYNIFIDE-----KYNFSVDEEVLARYQLMKGKTLTEAD
RECX_ENTFA      ------MTTITRISKDKG--EFYLLWLSS-----GEKLRVSEDILVRQRLLKGQELSDTL
RECX_LACPL      -----MTKKVTKIVAQKR-AGRYNIYLDE-----QYAFPISESVMIKFRVFKGMEVDEQL
RECX_LACBA      ------MAVITMIEAQKR-SGRYNVYLDG-----AYAFPVSESVLVDFRLAKGMEVDKAL
RECX_LACRD      ------MAKISKIEAQKR-KGRYNIYLDG-----KYAFPVAESVLIQFRLMKGTELDEKQ
RECX_LEUMM      ------MKKITKISIQKK-AGRYNIDLDN-----QFAFGVAESVLIKFGLAKGRELDDEL
RECX_LACJO      ------MPIITKISTQKR-KGRYNIFIDN-----EYAFSVSERTLAEKRLLKGTELSLED
RECX_LACGA      ------MPIITKISTQKR-KGRYNIFIDN-----EYAFSVSERTLAERRLLKGTELSNED
RECX_LACDA      ------MAIITKVSAQKR-QGRYNIFLDQ-----EYAFSVSEKTLAEFVLLKGQELSPQK
RECX_LACDB      ------MAIITKVSAQKR-QGRYNIFLDQ-----EYAFSVSEKTLAEFVLLKGQELSPQK
RECX_BACCZ      ------MAVITKIEVQKRSKERFNIYIDK-GQGEEYGFSVNEVILIKHGLQKGLEIDEIA
RECX_BACAH      ------MAVITKIEVQKRSKERFNIYIDK-GQGEEYGFSVNEVILIKHGLQKGLEIDEIA
RECX_BACC1      ------MAVITKIEVQKRSKERFNIYIDK-GQGEEYGFSVNEVILIKHGLQKGLEIDEIA
RECX_BACAN      ------MAVITKIEVQKRSKERFNIYIDK-GQGEEYGFSVNEVILIKHGLQKGLEIDEIA
RECX_BACHK      ------MAVITKIEVQKRSKERFNVYIDK-GQGEEYGFSVNEVILIKHGLQKGLEIDEIA
RECX_BACCR      ------MAVITKIEVQKRSKERFNIYIDK-GQGEEYGFSVDQVILIKHGLQKGLEIDEIE
RECX_BACCN      ------MAVITKIEVQKRTKERFNIYIDK-GQGEEYGFSVNQAVLIKHGLQKGLEIDEVE
RECX_BACHD      ------MAIITRIEVQKRNNERYNIFIHQ-NGQDVYAFSVDEQVLIKQGLRKGLDIDAEQ
RECX_GEOKA      ------MGTIADIAATEQNAERFWIVVHR-DGAPSLRLTVDQDVLLQFRLKKGMEISDDL
RECX_GEOTN      ------MGTIVDITVTKENAERFWIVIHR-DNESALKLTVDQDVLLKFRLKKGMIIDDAL
RECX_OCEIH      ------MKKIARITTQKKHKNRYNIFLQTPDGGDAYGFSVDEAILIEYRLSKGMELEDEM
RECX_LACLS      ------MGKITAIKKLKRLYRVDLSDLDE-----E-KIYLCEDTIIHFFITIDKEVSETD
RECX_LACLM      ------MGKITAIKKLKRLYRVDLSDLDE-----E-KIYLCEDTIIHFFITIDKEVSETD
RECX_LACLA      ------MGKITAIKKLKRLYRVDLSGFDD-----EDKIYLSEDTIVHFFLNVDKELDDAD
RECX_STRA1      -------MKITKIEKKKRLYTLEL---DN-----TENLYITEDTIVHFMLSKGMIVNAEK
RECX_STRA3      -------MKITKIEKKKRLYTLEL---DN-----TENLYITEDTIVHFMLSKGMIVNAEK
RECX_STRA5      -------MKITKIEKKKRLYTLEL---DN-----TENLYITEDTIVHFMLSKGMIINAEK
RECX_STRGC      -------MKITKIEKKKRLYLLEL---DD-----SEKLYITEDTIVHFMLSRGMEITDQE
RECX_STRSV      -------MKITKIEKKKRLYLLEL---DD-----SEKLYITEDTIVRFMLSKGMEITEQE
RECX_STRP2      -------MKITKLEKKKRLYLMEL---DN-----GDKCYITEDTIVRFMLSRDKVISEEE
RECX_STRR6      -------MKITKLEKKKRLYLMEL---DN-----GDKCYITEDTIVRFMLSRDKVISEEE
RECX_STRPN      -------MKITKLEKKKRLYLMEL---DN-----GDKCYITEDTIVRFMLSRDKVISEEE
RECX_STRT1      -------MKITKIEKKKRLYLVEI---DK-----KESLYVTEDTIVKYMLTKEMALSKDQ
RECX_STRT2      -------MKITKIEKKKRLYLVEI---DK-----KESLYVTEDTIVKYMLTKEMALSKDQ
RECX_STRTD      -------MKITKIEKKKRLYLVEI---DK-----KESLYVTEDTIVKYMLTKEKALSKDQ
RECX_STRMU      -------MKITKIEKKKRLYLIEI---DE-----AEHFYITEDTIVHFMLSKNKEILPEQ
RECX_STRPC      -------MKITKIEKKKRLYLIEL---DN-----DESLYVTEDTIVRFMLSKDKVLDNDQ
RECX_STRPB      -------MKITKIEKKKRLYLIEL---DN-----DESLYVTEDTIVRFMLSKDKVLDNDQ
RECX_STRPF      -------MKITKIEKKKRLYLIEL---DN-----DESLYVTEDTIVRFMLSKDKVLDNDQ
RECX_STRP8      -------MKITKIEKKKRLYLIEL---DN-----DESLYVTEDTIVRFMLSKDKVLDNDQ
RECX_STRPG      -------MKITKIEKKKRLYLIEL---DN-----DDSLYVTEDTIVRFMLSKDKVLDNDQ
RECX_STRPM      -------MKITKIEKKKRLYLIEL---DN-----DDSLYVTEDTIVRFMLSKDKVLDNDQ
RECX_STRP1      -------MKITKIEKKKRLYLIEL---DN-----DESLYVTEDTIVRFMLSKDKVLDNDQ
RECX_STRP3      -------MKITKIEKKKRLYLIEL---DN-----DDSLYVTEDTIVRFMLSKDKVLDNDQ
RECX_STRPD      -------MKITKIEKKKRLYLIEL---DN-----DDSLYVTEDTIVRFMLSKDKVLDNDQ
RECX_STAA2      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAAN      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAAB      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAA1      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAA9      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAAR      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAAM      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAA8      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAA3      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAAE      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAAT      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAAC      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAAS      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAAW      ------MPKITKIEVQKKNKERFNLFLDE-----QFEMGIDIDTLVKFNLKKGQQLEAAD
RECX_STAEQ      ------MPKVTKIEVQKKNKERFNLFLDG-----EFEMGIDIDTLVKFNLKKDQILEPSD
RECX_STAES      ------MPKVTKIEVQKKNKERFNLFLDG-----EFEMGIDIDTLVKFNLKKDQILEPSD
RECX_STAHJ      ------MTKITKIEVQKNNKERFNLFLDE-----VFEMGIDIDTLVRFNLKKGQILEPSD
RECX_STAS1      ------MPKITKIEVQKKNKERFNLYLDE-----EFEMGIDMDTYVHFNLKKGQIVDAAD
RECX_THEMA      --------------------------------------------MDYYQWRKKN------
RECX_THEP1      --------------------------------------------MDYYQWRKKN------
RECX_CHLTE      -------------------------------------------------MDEGKK-----
RECX_DEIRA      ------MPVCGRRPWQVKRSSSGGILPVMYRPRRRSSTPASEGEAEPRPRRPKTREE---
RECX_CALS4      --------MLITRIIKREKSSKYDVFIDG-----EYAFTCDAETFFMLGIEEGKEITSEQ
RECX_PELCD      ------------------------------------------------------------
RECX_TREPA      ---------------------------------------MGTRPTDEQYGAVCFACR---
RECX_FUSNN      -----------MMQLMKITIKGNKLILDN-----DKIIYLTKEMFSKFDLKDKTSLDDET
RECX_AGRFC      ---------------------------------------MEFDGEAQAVEPTSRMLS---
RECX_MYXXD      --------------------------------------MDEARGGPDKKKERGPKRP---
                                                                            

RECX_PSEFL      --------------RTAMDLLARREHGRVELTRKLRQRGA--------------------
RECX_PSETO      --------------RTAMDLLARREHGRVELTRKLRQRGA--------------------
RECX_PSEF5      --------------RTAMDLLARREHGRVELTRKLRQRGA--------------------
RECX_PSE14      --------------RTAMDLLARREHGRVELTRKLRQRGA--------------------
RECX_PSEU2      --------------RTAMDLLARREHGRVELTRKLRQRGA--------------------
RECX_PSESM      --------------RTAMDLLARREHGRVELTRKLRQRGA--------------------
RECX_PSEPK      --------------RTAMDLLARREHGRVELTRKLRQRGA--------------------
RECX_PSEP1      --------------RTAMDLLARREHGRVELTRKLRQRGA--------------------
RECX_PSEPG      --------------RTAMDLLARREHGRVELTRKLRQRGA--------------------
RECX_PSEE4      --------------RTAMDLLARREHGRVELTRKLRQRGA--------------------
RECX_PSEAB      --------------RAAMDLLARREHGRAELSRKLRQRGA--------------------
RECX_PSEAE      --------------RAAMDLLARREHGRAELSRKLRQRGA--------------------
RECX_PSEA7      --------------RAAMDLLARREHGRAELSRKLRQRGA--------------------
RECX_HALHL      --------------DAALRLLARREHTRRELAQKLARRGH--------------------
RECX_XANAC      ----------QTPVQRALGLLVRREHSRKELNRKLLARGI--------------------
RECX_XANCI      ----------QTPVQRALGLLVRREHSRKELNRKLLARGI--------------------
RECX_XANC5      ----------QTPVQRALGLLVRREHSRKELNRKLLARGI--------------------
RECX_XANOR      ----------QTPVQRALGLLVRREHSRKELNRKLLARGI--------------------
RECX_XANOM      ----------QTPVQRALGLLVRREHSRKELNRKLLARGI--------------------
RECX_XANCP      ----------QTPVQRALGLLVRREHSKKELNRKLQARGI--------------------
RECX_XANC8      ----------QTPVQRALGLLVRREHSKKELNRKLQARGI--------------------
RECX_SALTI      -------------LDRAVRILAVRDHSEQELRRKLSAPVMGKNGPE--------------
RECX_SALPB      -------------LDRAVRILAVRDHSEQELRRKLSAPVMGKNGPE--------------
RECX_SALPA      -------------LDRAVRILAVRDHSEQELRRKLSAPVMGKNGPE--------------
RECX_SALTY      -------------LDRAVRILAVRDHSEQELRRKLSAPVMGKNGPE--------------
RECX_SALCH      -------------LDRAVRILAVRDHSEQELRRKLSAPVMGKNGPE--------------
RECX_SALAR      -------------LDRAVRILAVRDHSEQELRRKLSAPVMGKNGPE--------------
RECX_ECOUT      -------------LDRAVRILAVRDHSEQELRRKLAAPIMGKNGPE--------------
RECX_ECOK1      -------------LDRAVRILAVRDHSEQELRRKLAAPIMGKNGPE--------------
RECX_ECO24      -------------LDRAVRILAVRDHSEQELRRKLAAPIMGKNGPE--------------
RECX_SHIF8      -------------LDRAVRILAVRDHSEQELRRKLAAPIMGKNGPE--------------
RECX_ECO57      -------------LDRAVRILAVRDHSEQELRRKLAAPIMGKNGPE--------------
RECX_ECOL5      -------------LDRAVRILAVRDHSEQELRRKLAAPIMGKNGPE--------------
RECX_SHIFL      -------------LDRAVRILAVRDHSEQELRRKLAAPIMGKNGPE--------------
RECX_ECOL6      -------------LDRAVRILAVRDHSEQELRRKLAAPIMGKNGPE--------------
RECX_SHIBS      -------------LDRAVRILAVRDHSEQELRRKLAAPIMGKNGPE--------------
RECX_ECOLI      -------------LDRAVRILAVRDHSEQELRRKLAAPIMGKNGPE--------------
RECX_ECOHS      -------------LDRAVRILAVRDHSEQELRRKLAAPIMGKNGPE--------------
RECX_ECOLC      -------------LDRAVRILAVRDHSEQELRRKLAAPIMGKNGPE--------------
RECX_SHISS      -------------LDRAVRILAVRDHSEQELRRKLAAPIMGKNGPE--------------
RECX_SHIDS      -------------LDRAVRILAVRDHSEQELRRKLVAPIMGKNGPE--------------
RECX_ENT38      -------------LDRAVRILGVRDHSEQELRRKLAAPVIGKNGPE--------------
RECX_KLEP7      -------------LDRAIRILAMRDHSEQELRRKLVAPVMSKNGPE--------------
RECX_CROS8      -------------LDRAMRILAMRDHSEQELRRKLGAVLPGKNEEE--------------
RECX_YERPS      -------------LSRAMRLLSQRDHSESELRRKLAAPPFSAKGNWGKRSGAKSS-----
RECX_YERP3      -------------LSRAMRLLSQRDHSESELRRKLAAPPFSAKGNWGKRSGAKSS-----
RECX_YERPP      -------------LSRAMRLLSQRDHSESELRRKLAAPPFSAKGNWGKRSGAKSSDVVES
RECX_YERPA      -------------LSRAMRLLSQRDHSESELRRKLAAPPFSAKGNWGKRSGAKSSDVVES
RECX_YERPE      -------------LSRAMRLLSQRDHSESELRRKLAAPPFSAKGNWGKRSGAKSSDVVES
RECX_YERPN      -------------LSRAMRLLSQRDHSESELRRKLAAPPFSAKGNWGKRSGAKSSDVVES
RECX_YERE8      -------------LSRAMRLLSQRDHSESELRRKLASQPFSAKGHWGKQTG---------
RECX_SERP5      -------------LSRAMRLLSQRDHSEAELRRKLAAQPFMAKARFGTKTPS--------
RECX_PECAS      -------------LRYAMNVLSVRDYSEVEIRRKCAAYLYKSEGTE--------------
RECX_VIBC3      -------------RQSALQLLSRRDHSEYELHQKLALKGH--------------------
RECX_VIBCH      -------------RQSALQLLSRRDHSEYELYQKLALKGH--------------------
RECX_VIBVU      -------------KDTAIQLLSRRDHGQYELRQKLTVKGY--------------------
RECX_VIBVY      -------------KDTAIQLLSRRDHGQYELKQKLTLKGY--------------------
RECX_VIBPA      -------------KEAAIQLLSRRDHGLYELHQKLAMKGY--------------------
RECX_HAEIE      ----------SLAFNYIVNLLSRREYSEFELRNKMQEKNFS-------------------
RECX_HAEIN      ----------SLAFNYIVNLLSRREYSEFELRNKMQEKNFS-------------------
RECX_HAEIG      ----------SLAFNYIVNLLSHREYSEFELRNKMQEKNFS-------------------
RECX_HAEI8      ----------SLAFNYIVNLLSRREYSEFELRNKMQEKNFS-------------------
RECX_MANSM      ----------TLAFSYAVNLLSRREYSEFEIRCKMQEKAFS-------------------
RECX_PASMU      ----------SPALNYVVGLLARREYSEFELRCKMQEKGFS-------------------
RECX_ACTP2      ----------YTAINYLLYLLSKRDYSEQDLRRKLVQKEYS-------------------
RECX_HAEDU      ----------YTAVNYLIYLLSKRDYSEYDLRNKLIQKQYD-------------------
RECX_LEGPN      ----------TKAFDSALRLLTRREYSAMELCDKLKQKGFS-------------------
RECX_LEGPC      ----------TKAFDSALRLLTRREYSAMELCDKLKQKGFS-------------------
RECX_LEGPA      ----------TKAFDSALRLLTRREYSAMELCDKLKQKGFS-------------------
RECX_LEGPL      ----------TKAFDSALRLLSRREYSAMELCDKLKQKGFN-------------------
RECX_ACIAD      ----------TKLRSLAFALLTRKEYSKSELIEKLKLYAVD-------------------
RECX_NEIMF      ----------KSLRARAMDILSRQEVSRIGLKRKLAPHAES-------------------
RECX_NEIMA      ----------KSLRARAMDILSRQELSRIGLKRKLAPHAES-------------------
RECX_NEIG1      ----------KSLRARAMDILSRQEVSRIGLKRKLAPHAES-------------------
RECX_NEIMB      ----------KSLRARAMDILSRQELSRIGLKRKLAPHAES-------------------
RECX_CHRVO      ----------KSLKARAAELLSRREYTRQELVRRLAPFADS-------------------
RECX_HERSE      ----------ISLKARALKYLSSREHSRLELARKLAPYAQE-------------------
RECX_RALSO      ----------LSLKARALGYLSRREHSRAELRRKLAPHAES-------------------
RECX_THET2      ----------SEALAYALRLLARKGYSRAALRAKLAARFG--------------------
RECX_THET8      ----------SEALAYALRLLARKGYSRAVLRAKLAARFG--------------------
RECX_MYCSS      E----P-NREEQAHAYCLRLLTARARTRAELAGKLTQRGYD-------------------
RECX_MYCSK      E----P-NREEQAHAYCLRLLTARARTRAELAGKLTQRGYD-------------------
RECX_MYCSJ      E----P-NREEQAHAYCLRLLTARARTRAELSGKLTQRGYD-------------------
RECX_MYCS2      EQAQDPRTREEQAKNVCLRLLTVRARTRAELETQLTKRGYP-------------------
RECX_MYCVP      T------KRGEQARALCLRLLTARARTRAELEAALAKRGYP-------------------
RECX_MYCA1      --------REEQARALCLRLLTARARTRAELHGRLAKRGYP-------------------
RECX_MYCUA      --------REEQARALCLRLLTARSRTRAELAGQLAKRGYP-------------------
RECX_MYCBP      --------REEQARALCLRLLTARSRTRAELAGQLAKRGYP-------------------
RECX_MYCBO      --------REEQARALCLRLLTARSRTRAELAGQLAKRGYP-------------------
RECX_MYCTA      --------REEQARALCLRLLTARSRTRAELAGQLAKRGYP-------------------
RECX_MYCTU      --------REEQARALCLRLLTARSRTRAELAGQLAKRGYP-------------------
RECX_MYCLE      --------REEQARILCLRLLTARSRTRAQLFGQLAKRGYA-------------------
RECX_STRLI      G--EPPRDPVEQARAICLRLLTGTPRTRRQLADALRKREIP-------------------
RECX_STRCO      G--EPPRDPVEQARAICLRLLTGTPRTRRQLAEALRKREIP-------------------
RECX_THEFY      ---AAPEDLYARARAICLRLLTRAPRTRAQLTDALRRREIP-------------------
RECX_AMYMU      ----PPEERYKKAKEICFDLLAVRARTQEELRQALRRKGFD-------------------
RECX_COREF      LFDREAEEKKAEVRRRALLLLDQRARSRSELQGRLGALDFD-------------------
RECX_CORGL      FFDHEKEEKKANVRRRALLLLNQRARSVNELSTRLKALEFE-------------------
RECX_CORDI      LFDYALEEEKAKVRKRALLLLDQRARSVYELTNRLISADFD-------------------
RECX_CLOPE      IKEIVKEDEFIKCKNSALRTVEKTYKTEKELRDKLAEKGFE-------------------
RECX_CLOP1      IKEIVKEDEFIKCKNSALRTVEKTYKTEKELRDKLTEKGFE-------------------
RECX_CLOPS      IKEIVKEDEFIKCKNSALRTVEKTYKTEKELRDKLTEKGFE-------------------
RECX_CLOB8      LRTLAESENFMRCKESALRIIEKTYKTEKEVRDKLKLKEYD-------------------
RECX_CLOAB      LQDIIEEDNYLYAKSRALSFIEKTFKTEKEIRVKLREKEFN-------------------
RECX_CLOTE      LKVIAEEDNYIKCKGDALKFIEKSYKTERQVYDKLLSKGYD-------------------
RECX_CLOD6      LKPILDDEMYIKAKNKALNILSHADQSEKKLKEKL-SSEFD-------------------
RECX_BACSU      IIEIQYGDEVKKGFNRALDFLSYRMRSTKEVEDHLKKKETS-------------------
RECX_BACVZ      ILEIQYGDDVKKAFNRAVEFLSYRMRSEKEVRDHLKKKETP-------------------
RECX_BACLD      IIEIQYGDDVKKGFKKALDYLSYRMRSTKEVQDHLKKKGVA-------------------
RECX_BACP2      IIDIQFGDAVKKGFQQAVDYLSYRMRSVKEVTDYLTKKEIP-------------------
RECX_LISMO      IEEIKQADMVRKGLNKAINFLSHRVRSEKEIRDYLRKQEME-------------------
RECX_LISMF      IEEIKQADMVRKGLNKAINFLSHRVRSEKEIRDYLRKQEME-------------------
RECX_LISW6      IEEIKQADMVRKGLNKAINFLSHRVRSEKEIRDYLKKQEME-------------------
RECX_LISIN      IEEIKQADMVRKGLNKAINFLSHRVRSEKEIRDYLRKQEME-------------------
RECX_ENTFA      IEEIKKASSYDVGLQMAMNYLSYQLRSKKEIFTYLKEKEIV-------------------
RECX_LACPL      QAAMIAADDVSKAYTRALDYLSHQLRTEKEVHDKLRDEEID-------------------
RECX_LACBA      TAQLIDADNVAKAYNRALDYLSQQLRTEKEVRDKLADLEIP-------------------
RECX_LACRD      IAAIATADQQAKAYSRMLDYLSYQMRTESDIVKKLKEIDTP-------------------
RECX_LEUMM      IAEIKHNDSIAKALSIALNFLSHSLHTVKQVKQKMSEKEVS-------------------
RECX_LACJO      IEKIKKAEADSHALQLAMSYLSYQPRSVYEVLTYLNKQGIS-------------------
RECX_LACGA      IEEIKKAEADSHAIQLAMSYLSYQPRSVYEVLEYLNKHEIS-------------------
RECX_LACDA      INEILDYEASAKASDLAARYLSYQPRTIKEVTDYLSQHEIS-------------------
RECX_LACDB      INEILDYEASAKASDLAARYLSYQPRTIKEVTDYLSQHEIS-------------------
RECX_BACCZ      LGNILYNEEVQKAYLQAISYLSYQMRTKLEIEDFLRKKEVG-------------------
RECX_BACAH      LGNILYNEEVQKAYLQAISYLSYQMRTKLEIEDFLRKKEVG-------------------
RECX_BACC1      LGNILYNEEVQKAYLQAISYLSYQMRTKLEIEDFLRKKEVG-------------------
RECX_BACAN      LGNILYNEEVQKAYLQAISYLSYQMRTKLEIEDFLRKKEVG-------------------
RECX_BACHK      LGNILYNEEVQKAYLQAISYLSYQMRTKLEIEDFLRKKEVG-------------------
RECX_BACCR      LGNILYNEEVQKAYLQAISYLSYQMRTKQEIEDFLRKKEVG-------------------
RECX_BACCN      IANILYNEEVQKAYLQAISYLSYQMRTKQEVEEYLRKKEVG-------------------
RECX_BACHD      MKQILYEDEVQKTFNLALHYLSYRMRSVHEVRTYLKKKDRE-------------------
RECX_GEOKA      LQHIVYADEVKKAYQQALYFLAHRMRSEHEVAAHLRKKGAP-------------------
RECX_GEOTN      LRDIVYADGIKKAYQQALYFLAHRMRSEQEIVEHLRKKGVV-------------------
RECX_OCEIH      ISILEQKDTLHKAYTLTIHFLSYRMRSEKEVSDYLQKKEVD-------------------
RECX_LACLS      LEEILAYDQFAQGKSLALYYISFKMRTGAEVRKYLLEHDIND------------------
RECX_LACLM      LEEILAYDQFAQGKSLALYYISFKMRTGAEVRKYLLEHDIND------------------
RECX_LACLA      LEEIQSYDQFAQGKSLALYYISFKMRTSSEVRKYLSEHEIDN------------------
RECX_STRA1      LENIKKFAQLSYGKNLGLYYISFKQRTEKELIKYLQQHDID-------------------
RECX_STRA3      LENIKKFAQLSYGKNLGLYYISFKQRTEKEVIKYLQQHDID-------------------
RECX_STRA5      LENIKKFAQLSYGKNLGLYYISFKQRTEKEVIKYLQQHDID-------------------
RECX_STRGC      LSEIQDYAQFSYGKNLALYHLSFKQRTTKEVKDYLTRHDIQ-------------------
RECX_STRSV      LSEIQDYAQFSYGKNLALYHLSFKQRTAKEVKDFLTQHDIQ-------------------
RECX_STRP2      LKEIQDFAQFSYGKNLALYHLSFKARTEKEVREYLKKYDID-------------------
RECX_STRR6      LKEIQDFAQFSYGKNLALYHLSFKARTEKEVREYLKKYDID-------------------
RECX_STRPN      LKEIQDFAQFSYGKNLALYHLSFKARTEKEVREYLKKYDIN-------------------
RECX_STRT1      LEDIKNFAQFSHGKNLALYFISFKQRTEKEVRDYLFKHEIN-------------------
RECX_STRT2      LEDIKNFAQFSHGKNLALYFISFKQRTEKEVRDYLFKHEIN-------------------
RECX_STRTD      LEDIKNFAQFSHGKNLALYFISFKQRTEKEVRDYLFKHEIN-------------------
RECX_STRMU      LEEIKTFAQFSYGKNLALYYLSFKQRTEKEVKDYLIRHDIN-------------------
RECX_STRPC      LEDMKHFAQLSYGKNLALYFLSFQQRSNKQVADYLRKHEIE-------------------
RECX_STRPB      LEDMKHFAQLSYGKNLALYFLSFQQRSNKQVADYLRKHEIE-------------------
RECX_STRPF      LEDMKHFAQLSYGKNLALYFLSFQQRSNKQVADYLRKHEIE-------------------
RECX_STRP8      LEDMKHFAQLSYGKNLALYFLSFQQRSNKQVADYLRKHEIE-------------------
RECX_STRPG      LEDMKHFAQLSYGKNLALYFLSFQQRSNKQVADYLRKHEIE-------------------
RECX_STRPM      LEDMKHFAQLSYGKNLALYFLSFQQRSNKQVADYLRKHEIE-------------------
RECX_STRP1      LEDMKHFAQLSYGKNLALYFLSFQQRSNKQVADYLRKHEIE-------------------
RECX_STRP3      LEDMKHFAQLSYGKNLALYFLSFQQRSNKQVADYLRKHEIE-------------------
RECX_STRPD      LEDMKHFAQLSYGKNLALYFLSFQQRSNKQVADYLRKHEIE-------------------
RECX_STAA2      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAAN      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAAB      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAA1      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAA9      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAAR      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAAM      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAA8      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAA3      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAAE      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAAT      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAAC      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAAS      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAAW      MAEIQKYDHYRIGLNKAIQYLSYKKRTEKEVIQYLQKEEIS-------------------
RECX_STAEQ      MQNIQEYDHYRRGVNLAIQYLSYKKRTEREVIQYLEKNDIQ-------------------
RECX_STAES      MQNIQEYDHYRRGVNLAIQYLSYKKRTEREVIQYLEKNDIQ-------------------
RECX_STAHJ      MENIQKYEHYRLGINMAIQYLSYKKRTEKEVRQHLQQNEIS-------------------
RECX_STAS1      MEKIQKYDQYRQAVNVAIQFLSYRKRTDHEVIQHLQKKEIS-------------------
RECX_THEMA      -RGKKRNLQAKKPLNYALRLLKYRVRFEDELRERLKKQGFA-------------------
RECX_THEP1      -RRRKRNLQTKKPLNYALKLLKYRVRFEDELRERLKKQGFA-------------------
RECX_CHLTE      ----------SSALDHALRLLAGRAHGRAELESKLKKKGFD-------------------
RECX_DEIRA      --------QREALLAYAFRALGARAITEAELRGKLERRSED-------------------
RECX_CALS4      YKYYVNYIEAKEAKNHAFRLLSRKMLTEKQLADKLKLKGFS-------------------
RECX_PELCD      ------MAPRTDAWSSALRLLSRREYSEAMLRERLQRKGFD-------------------
RECX_TREPA      ---------CYEAECVAVRLLARSETSAQQLGFKLLKRGFE-------------------
RECX_FUSNN      FYSLI----YFRIKLSAYTMLAKRDYFKKELKNKLIEKIGF-------------------
RECX_AGRFC      -----------WARNSALYRLQQRMMTEKQLRDAIMRKAREKFEDI--------------
RECX_MYXXD      -----RKVSPTYLENAALHYLKRYAATKSQLQRVLLRRVDRSIKFHGG------------
                                    :         :                             

RECX_PSEFL      ---------------------EPEMIETALDRLTEEGLLSEARYLESFVSYR-ARSGYGP
RECX_PSETO      ---------------------EPEMIETALDRLTEEGLLSEARYLESFVSYR-PRSGYGP
RECX_PSEF5      ---------------------PPEMIEAALDRLTEEGLLSESRYLESFVSYR-ARSGYGP
RECX_PSE14      ---------------------PPELIDAALDRLVEEGLLSESRYLESFVSYR-ARSGYGP
RECX_PSEU2      ---------------------PPELIDAALDRLVEEGLLSESRYLESFVSYR-ARSGYGP
RECX_PSESM      ---------------------PPELIEAALDRLVEEGLLSESRYLESFVSYR-ARSGYGP
RECX_PSEPK      ---------------------SDELIEPELDRLAEEGLLSEARYLESFIRYR-SGSGYGP
RECX_PSEP1      ---------------------SDELIEPELDRLAEEGLLSEARYLESFIRYR-SGSGYGP
RECX_PSEPG      ---------------------SDELIEPELDRLAEEGLLSEARYLESFIRYR-SGSGYGP
RECX_PSEE4      ---------------------PDELIEPALDRLAEEGLLSEARYLESFIRYR-SNAGYGP
RECX_PSEAB      ---------------------SAELIDPALDRLAEEGLLDESRYLESFIASR-ARSGHGP
RECX_PSEAE      ---------------------SAELIDPALDRLAEEGLLDESRYLESFIASR-ARSGHGP
RECX_PSEA7      ---------------------SPELIDPALDRLAEEGLLDESRYLESFIASR-ARGGHGP
RECX_HALHL      ---------------------DPGYVHPVLEALAEEGLLDEGRFAEVFVRSR-VERGQGP
RECX_XANAC      ---------------------EPDAAQAAVDRLTDEGWQDDTRFAAAVVRNR-AGSGYGP
RECX_XANCI      ---------------------EPDAAQAAVDRLTDEGWQDDTRFAAAVVRNR-AGSGYGP
RECX_XANC5      ---------------------EPDAAQATVDRLTDEGWQDDTRFAAAVVRNR-AGSGYGP
RECX_XANOR      ---------------------EPDAAQAAVDRLTGEGWQDDARFAAAVVRNR-AGSGYGP
RECX_XANOM      ---------------------EPDAAQAAVDRLTGEGWQDDARFAAAVVRNR-AGSGYGP
RECX_XANCP      ---------------------EPEAAQAAVERLAGEGWQDDVRFAASVVRNR-ASSGYGP
RECX_XANC8      ---------------------EPEAAQAAVERLAGEGWQDDVRFAASVVRNR-ASSGYGP
RECX_SALTI      -----------------EIDATADDYERVIAWCHEHHYLDDERFVMRFIASR-SRKGYGP
RECX_SALPB      -----------------EIDATADDYERVIAWCHEHHYLDDERFVMRFIASR-SRKGYGP
RECX_SALPA      -----------------EIDATADDYERVIAWFHEHHYLDDERFVMRFIASR-SRKGYGP
RECX_SALTY      -----------------EIDATADDYERVIAWCHEHHYLDDERFVMRFIASR-SRKGYGP
RECX_SALCH      -----------------EIDATADDYERVIAWCHEHHYLDDERFVMRFIASR-SRKGYGP
RECX_SALAR      -----------------EIDATPDDYERVISWCHEHHYLDDNRFVIRFIASR-SRKGYGP
RECX_ECOUT      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_ECOK1      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_ECO24      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_SHIF8      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_ECO57      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_ECOL5      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_SHIFL      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_ECOL6      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_SHIBS      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_ECOLI      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_ECOHS      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_ECOLC      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_SHISS      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_SHIDS      -----------------EIDATAEDYERVIAWCHEHGYLDDSRFVARFIASR-SRKGYGP
RECX_ENT38      -----------------AIDATEEDYDRVIAWCYEHSYLDDTRFVTRFIASR-SRKGYGP
RECX_KLEP7      -----------------ALDVTPDELEQVVAWCIENRYLDDNRFVGQFIASR-SRKGYGP
RECX_CROS8      -----------------QEQATPEDIEKVIAWCHEQHYLDDARFAERYIASR-GRKGYGP
RECX_YERPS      NLVESNPVESNLAESNAIEESDPQVIEQVIDYCYQHNWLDDSRFAASYINSR-SRKGYGV
RECX_YERP3      NLVESNPVESNLAESNAIEESDPQVIEQVIDYCYQHNWLDDSRFAASYINSR-SRKGYGV
RECX_YERPP      NLVESNPVESNLAESNAIEESDPQVIEQVIDYCYQHNWLDDSRFAASYINSR-SRKGYGV
RECX_YERPA      NLVESNPVESNLAESNAIEESDPQVIEQVIDYCYQHNWLDDSRFAASYINSR-SRKGYGV
RECX_YERPE      NLVESNPVESNLAESNAIEESDPQVIEQVIDYCYQHNWLDDSRFAASYINSR-SRKGYGV
RECX_YERPN      NLVESNPVESNLAESNAIEESDPQVIEQVIDYCYQHNWLDDSRFAASYINSR-SRKGYGV
RECX_YERE8      -----------RSDNEPVADIDPKVIEQVIAYCYQHNWLDDARFATSYINSR-SRKGYGA
RECX_SERP5      -----------SSAPLPEEPVDPAVIEQVIAYCYQHNWLDDQRFARSYIGSR-SRKGYGA
RECX_PECAS      -----------SEADEAIAQATAEDVEAAIAYCKEHGWLDDARYARRYISSR-SRKGYGV
RECX_VIBC3      ---------------------PTEVIDEVVKYVLELGYLSDARYAASQARQI-VHKGYGE
RECX_VIBCH      ---------------------PAEVIDEVVKYVLELGYLSDARYAASQARQI-VHKGYGE
RECX_VIBVU      ---------------------ASQDIESAMHFCLEHGYLDDLRYAKSQIRQH-VGKGHGE
RECX_VIBVY      ---------------------ASQDIESAMHFCLEHGYLDDLRYAKSQIRQH-VGKGHGE
RECX_VIBPA      ---------------------EEADIEAAINFCLEHNYLDDLRYAKSQVRQH-VYKGHGE
RECX_HAEIE      ----------------------EEEIDEALSRCQAKNWQSDRRFSENYLNSR-VQKGYGV
RECX_HAEIN      ----------------------EEEIDDALSRCQAKNWQSDRRFSENYLNSR-VQKGYGV
RECX_HAEIG      ----------------------EEEIDEALSRCQAKNWQSDRRFSENYLNSR-AQKGYGV
RECX_HAEI8      ----------------------EEEIDDALSLCQAKNWQSDRRFSENYLNSR-SQKGCGV
RECX_MANSM      ----------------------EQEIEDTLAQLQQKNWQSDKRFTENYLRAR-AQRGYGV
RECX_PASMU      ----------------------EQEIDDTLAFCQQKNWQNDRRFAENYLTFR-AQRGYGF
RECX_ACTP2      ----------------------QEEIEQAIERAQANNWQSDERYCAGFIRYR-SQQGIGP
RECX_HAEDU      ----------------------TDEIEHAIQQAQLNNWQNDERYCASFIRYR-SQQGIGP
RECX_LEGPN      ----------------------TNDVQNALYECQRLGYQSDVRFVENYIRVR-IHQGYGP
RECX_LEGPC      ----------------------TNDVQNALYECQRLGYQSDVRFVENYIRVR-IHQGYGP
RECX_LEGPA      ----------------------TNDVQNALYECQRLGYQSDVRFVENYIRVR-IHQGYGP
RECX_LEGPL      ----------------------LHDVQNALNECKRLGYQSDERYVESYIRAR-IHQGYGP
RECX_ACIAD      ----------------------ENEVIQLVDELSDQHYQSDQRVAELVLSSQ-LRKGKGP
RECX_NEIMF      ----------------------EEELENVLNEFAERNWQSDLRYAEAYIRSK-SRK-HGS
RECX_NEIMA      ----------------------EEELENVLNEFAERNWQSDLRYAEAYIRSK-SRK-HGS
RECX_NEIG1      ----------------------EEELENVLNEFAERNWQSDLRYAEAYIRSK-SRK-HGS
RECX_NEIMB      ----------------------EEELENVLNEFAERNWQSDLRYAEAYIRSK-SRK-HGS
RECX_CHRVO      ----------------------EDELNAALDELAASNWQSDDRFARQFASSK-GTK-FGS
RECX_HERSE      ----------------------GDDIEALLQWLEQSRFLSQERFSESLVHRR-AAR-YGN
RECX_RALSO      ----------------------VDEVEALLDWLEGENWLSNTRFAESVVHRR-ASR-YGT
RECX_THET2      ----------------------EAEAEAALGRLEAMGYLDDRAYARAFVETR-ARR-YGP
RECX_THET8      ----------------------EAEAEAALGRLEAMGYLDDRAYARAFVETR-ARR-YGP
RECX_MYCSS      ----------------------EPVVARVLDRLVDVGLVDDEDFAEQWVRSRHLYAGKGK
RECX_MYCSK      ----------------------EPVVARVLDRLVDVGLVDDEDFAEQWVRSRHLYAGKGK
RECX_MYCSJ      ----------------------EPVVARVLDRLVEVGLVDDEDFAEQWVRSRHLYAGKGK
RECX_MYCS2      ----------------------DDVSARVLDRLTEVGLIDDEDFAEQWVRSRHLNAGKGK
RECX_MYCVP      ----------------------DDIAAAVLDRLTQVGLVDDEDFAEQWVRSRRLNAGKGK
RECX_MYCA1      ----------------------DDVSTAVLDRLAAVGLIDDADFAQQWVQSRRAHAGKSK
RECX_MYCUA      ----------------------EDVGDRVLDRLTAVGLVDDADFAADWVQSRRANAGKSR
RECX_MYCBP      ----------------------EDIGNRVLDRLAAVGLVDDTDFAEQWVQSRRANAAKSK
RECX_MYCBO      ----------------------EDIGNRVLDRLAAVGLVDDTDFAEQWVQSRRANAAKSK
RECX_MYCTA      ----------------------EDIGNRVLDRLAAVGLVDDTDFAEQWVQSRRANAAKSK
RECX_MYCTU      ----------------------EDIGNRVLDRLAAVGLVDDTDFAEQWVQSRRANAAKSK
RECX_MYCLE      ----------------------DHVSERVLDRLAAVGLLDDNDFAEQWVRSRRANVGKSK
RECX_STRLI      ----------------------EEAAEEVLSRFEEVGLINDGAFAQAWVESRHHGRGLAR
RECX_STRCO      ----------------------EEAAEEVLSRFEEVGLINDGAFAQAWVESRHHGRGLAR
RECX_THEFY      ----------------------DEVIEAVLDRFGEVGIVDDAVFAEAWVDSRHAGRGLAR
RECX_AMYMU      ----------------------EETSETLLGKLDRAGLVNDAEFAELWVKSRHTTQGLSR
RECX_COREF      ----------------------HDIIEEVLDDLTRANLINDESFAQEWVRQRAQRRGKST
RECX_CORGL      ----------------------EDIINEVIGDLTRSKLLDDEVFATEWVRQRAARRGKSS
RECX_CORDI      ----------------------PNIVEYVVEDLVRANLLNDENFSREWVRQRRQRRGKSR
RECX_CLOPE      ----------------------EDTIKRAIEFLKEYNLLNDEKYAEMYIKDRLR--SQGR
RECX_CLOP1      ----------------------EDTIKRAIEFLKEYNLLNDEKYAEMYIKDRLR--SQGR
RECX_CLOPS      ----------------------EDTIKRAIEFLKEYNLLNDEKYAEMYIKDRLR--SQGR
RECX_CLOB8      ----------------------ESSIDKAIEFLKKYNFINDGNYTKIFIKDKLR--SMGS
RECX_CLOAB      ----------------------EKIIERVIEFLRKYDFVDDSRYAELYIKERIN--KQGK
RECX_CLOTE      ----------------------NKTIERVIDFLTEYKFIDDWRFGELYIEERLK--REGR
RECX_CLOD6      ----------------------ENIIERVIDFLKSYNLVNDSVLAQKIVNTNVNLNKCGK
RECX_BACSU      ----------------------PPVIAEVIHRLNDYKYLNDQEFAAAYVSTHKKTNGKGP
RECX_BACVZ      ----------------------DMVISEVIHKLYDYRYLNDKEFAEAYASTHKKTNGKGP
RECX_BACLD      ----------------------DSAITEILHMLKGYKYLDDREFAAAYVSTHRKTSGKGP
RECX_BACP2      ----------------------APAISEIIHKLKHYKYVNDLEFAEAYVSTHRKTNSKGP
RECX_LISMO      ----------------------PFAIDEILKKLANMDYINDFEFAELYTKTQIKTTLKGP
RECX_LISMF      ----------------------AFAIDEILKKLADMDYINDLEFAELYTKTQIKTTLKGP
RECX_LISW6      ----------------------PFAIDEILKKLADMDYINDVEFAELYTKTQIKTTLKGP
RECX_LISIN      ----------------------PFAVDEILKKLADMDYINDVEFAELYTKTQIKTTLKGP
RECX_ENTFA      ----------------------PEDRVKIVQRLEELRLLDDAIFSESYVRTAMRTSDKGP
RECX_LACPL      ----------------------ESVIDATMQQLRDMRLLNDQQYADAFVRTAKRTSDKGP
RECX_LACBA      ----------------------AETIAATLQRLRSLALVDDAHYAASYVRTMMHTGDKGP
RECX_LACRD      ----------------------EEFVESILKKLRGQQLIDDHAYAASYVRTMINTDLKGP
RECX_LEUMM      ----------------------ESIQDEVVAQLYEQKYIDDLNYAQHYVSTKKIISPKGP
RECX_LACJO      ----------------------PEASQSAIENLIELNYLDDNNFARLFIQNNLRVGKDGP
RECX_LACGA      ----------------------QDASQAAVQNLIELNYLNDNNFARLFIKNNLRVGKDGP
RECX_LACDA      ----------------------RSAAKRAVNELTHLGYLDDAAYARLFVKNNLQVGKNGP
RECX_LACDB      ----------------------RSAAKRAVNELTHLGYLDDAAYARLFVKNNLQVGKNGP
RECX_BACCZ      ----------------------QAIISEVVSKLLHDRYINDKEYAILYTRTQSNVNRKGP
RECX_BACAH      ----------------------QAIISEVVSKLLHDRYINDKEYAILYTRTQSNVNRKGP
RECX_BACC1      ----------------------QAIISEVVSKLLHDRYINDKEYAILYTRTQSNVNRKGP
RECX_BACAN      ----------------------QAIISEVVSKLLHDRYINDKEYAILYTRTQSNVNRKGP
RECX_BACHK      ----------------------QAIISEVVSKLLHDRYINDKEYAILYTRTQSNVNRKGP
RECX_BACCR      ----------------------QAIISEVVSKLLHDRYINDKEYAVLYTRTQSNVNRKGP
RECX_BACCN      ----------------------QAIISEVISKLLHDRYINDKEYAVLYVRTQSNVNQKGP
RECX_BACHD      ----------------------EPIIEHVLHRLTEQRLLDDHAFAEAFIQTKRATTSKGP
RECX_GEOKA      ----------------------DSVIDEVLKKLRAERYVDDEAFAAAYVRTQKKTAAKGP
RECX_GEOTN      ----------------------DPVIEEVLEKLRAERYVDDEAFAAAYVRTQKNTSTKGP
RECX_OCEIH      ----------------------EEHIAEIIKRLKKEKWVDDQQFAEMFVRSRINSSSKGP
RECX_LACLS      ----------------------TDQIEQVLSVLTENNLINDKSYAENFIEGKISMGSSGP
RECX_LACLM      ----------------------TDQIEQVLSVLTENNLINDKSYAENFIEGKISMGSSGP
RECX_LACLA      ----------------------TDQIDEVINILTKNNLINDKAYAENFIEGKISMGSAGP
RECX_STRA1      ----------------------SKIIPQIIDNLKSENWINDKNYVQSFIQQNLNTGDKGP
RECX_STRA3      ----------------------SKIIPQIIDNLKSENWINDKNYVQSFIQQNLNTGDKGP
RECX_STRA5      ----------------------SKIIPQIIDNLKSENWINDKNYVQSFIQQNLNTGDKGP
RECX_STRGC      ----------------------PETISQVLDNLKKDNWVNDRKYANSFIQSNLLTGDKGT
RECX_STRSV      ----------------------PEIISQVLDNLKKDNWINDRKYAHSFIQSNLLTGDKGA
RECX_STRP2      ----------------------KNIVSQVIANLKEDKWINDGQYAYAIINTNQLSGDKGP
RECX_STRR6      ----------------------KNIVSQVIANLKEDKWINDGQYAYAIINTNQLSGDKGP
RECX_STRPN      ----------------------ENIVSQVIANLKEEKWINDSQYAYAIINANQLSGDKGP
RECX_STRT1      ----------------------PHIIPQIIDNLKKDHWIDDYKLLESLAQQNLNSGDKGA
RECX_STRT2      ----------------------PHIIPQIIDNLKKDHWIDDYKLLESLAQQNLNSGDKGA
RECX_STRTD      ----------------------PHIIPQIIDNLKKDHWIDDYKLLESLAQQNLNSGDKGA
RECX_STRMU      ----------------------TTVISQILTQLKEEKWLDDSKYIDNILQQNLHSGDKGA
RECX_STRPC      ----------------------EHIIPDIITQLQEEQWIDDTKLADTYIRQNQLNGDKGP
RECX_STRPB      ----------------------EHIIPDIITQLQEEQWIDDTKLADTYIRQNQLNGDKGP
RECX_STRPF      ----------------------EHIIPDIITQLQEEQWIDDTKLADTYIRQNQLNGDKGP
RECX_STRP8      ----------------------EHIIPDIITQLQEEQWIDDTKLADTYIRQNQLNGDKGP
RECX_STRPG      ----------------------EHIIPDIITQLQEEQWIDDTKLADTYIRQNQLNGDKGP
RECX_STRPM      ----------------------EHIIADIITQLQEEQWIDDTKLADTYIRQNQLNGDKGP
RECX_STRP1      ----------------------EHIIADIITQLQEEQWIDDTKLADTYIRQNQLNGDKGP
RECX_STRP3      ----------------------EHIIADIITQLQEEQWIDDTKLADTYIRQNQLNGDKGP
RECX_STRPD      ----------------------EHIIADIITQLQEEQWIDDTKLADTYIRQNQLNGDKGP
RECX_STAA2      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAAN      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAAB      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAA1      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAA9      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAAR      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAAM      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAA8      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAA3      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAAE      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAAT      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAAC      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAAS      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAAW      ----------------------EQAISEVIEYCYREKLIDHQDYAESLKNTMIRTTDKGP
RECX_STAEQ      ----------------------SNAIQDVIDYCYKEKFIDHEDYAESLKNTMIHTTDKGP
RECX_STAES      ----------------------SNAIQDVIDYCYKEKFIDHEDYAESLKNTMIHTTDKGP
RECX_STAHJ      ----------------------DIAIQQVIDYCYRESYINHEDYAESLKNTMINTTDKGP
RECX_STAS1      ----------------------ESVIASVIDYCHEQRLIDHEDYANSLKNTMILTTDKGP
RECX_THEMA      ----------------------DEEVESTITTLKKQGYLDDEKAAYLFALDEMRLKLFGP
RECX_THEP1      ----------------------DEEVESTINTLKKQGYLDDEKAAYLFALDEMRLKLFGP
RECX_CHLTE      ----------------------SESIAKALARLDELNLTDDRAFAQSCTASMARRKPEGR
RECX_DEIRA      ----------------------PELVEEVLRRVQELGYQNDAEVARAENKRR----GVGE
RECX_CALS4      ----------------------EEAIGEAVSKAKEYDYVNDENYAKFFVEEKMQSLYSRR
RECX_PELCD      ----------------------SDQIEHALERCRSYNYVNDERFARIRARQLLASGRAVG
RECX_TREPA      ----------------------KRVVESVFPVLKRYSWLDDTRFARAWLRNRVDSRPASR
RECX_FUSNN      ----------------------ADIVKDVVEDFEEKGYLDDYEKAKSYAAQH---SNYGT
RECX_AGRFC      -----------------GPAQVKALGEFAVTFAYGIKALDDTAYAEITVRSG-QRSGKSK
RECX_MYXXD      -----------------ERGEALAWVEALVAKLVRNGLLNDEAYAQMKAHSL-RASGRST
                                             .         ..                   

RECX_PSEFL      ARIREELS-QRGLQRADIDLALRECGISWQS---QLEDTWRRKFAG-HLPIDA-------
RECX_PSETO      ARIREELS-QRGLQRADIDLALRECGISWQS---QLEDTWRRKFSG-HLPIDA-------
RECX_PSEF5      MRIREELG-QRGLQRSDIDLALRECGIDWQE---QLRDVWQRKFAG-RFPADA-------
RECX_PSE14      VRIREELN-QRGLQRADIEQALRECGIDWQE---KLHELWQRKFAG-ALPVDA-------
RECX_PSEU2      VRIREELG-QRGLQRADIEQALRDCGIDWQE---KLYELWQRKFAG-ALPVDA-------
RECX_PSESM      ARIREELN-QRGLQRADVERALKECGVNWQE---KLQEVWQRKFAG-ELPVDA-------
RECX_PSEPK      ARIREELC-QRGLARADIDQALRESEVNWSE---RMRDVWQRKFAG-QRPQDP-------
RECX_PSEP1      ARIREELC-QRGLARADIDQALRESEVNWGE---RMRDVWQRKFAG-QRPQDP-------
RECX_PSEPG      SRIREELG-QRGLARADIEQALRESEVDWRE---RMHDVWQRKFAG-QRPQDP-------
RECX_PSEE4      ARIREELG-QRGLDRGDIDQSLRESEVDWAA---RLEEVWQRKFAG-QRPQDP-------
RECX_PSEAB      LRIREELA-QRGLPRADIERALGACEVDWSA---QLREVWRRKFA--RLPQDA-------
RECX_PSEAE      LRIREELA-QRGLPRADIERALGACEVDWSA---QLREVWRRKFA--RLPQDA-------
RECX_PSEA7      LRIREELA-QRGLPRADIERALNACDIDWSA---QLREVWRRKFA--RLPLDA-------
RECX_HALHL      VRIAQELR-QRGVADGVIDEVLEDAEVDWLA---QARAVRERRFGA-GVPADR-------
RECX_XANAC      LHIRAELG-THGLDSEAISAALAAFEGDWTE---NARDLIRRRFGE-QGPTDL-------
RECX_XANCI      LHIRAELG-THGLDSEAISAALAAFEGDWTE---NARDLIRRRFGE-QGPTDL-------
RECX_XANC5      LHIRAELG-THGLDSEAISAALATFEGDWTE---NARDLIRRRFGE-QGPTDL-------
RECX_XANOR      LHIRAELG-THGLDSEAISAAMATFQGDWTE---NARDLIHRRFGE-QGPIDL-------
RECX_XANOM      LHIRAELG-THGLDSEAISAAMATFQGDWTE---NARDLIHRRFGE-QGPIDL-------
RECX_XANCP      LHIRAELG-THGLDSDAVSAAMATFEGDWTE---NALDLIRRRFGE-DGPVDL-------
RECX_XANC8      LHIRAELG-THGLDSDAVSAAMATFEGDWTE---NALDLIRRRFGE-DGPVDL-------
RECX_SALTI      ARIRQELN-QKGISRESTEKAMRECEIDWSE---MAREQAVRKYGE-PLPSNF-------
RECX_SALPB      ARIRQELN-QKGISRESTEKAMRECEIDWSE---MAREQAVRKYGE-PLPSNF-------
RECX_SALPA      ARIRQELN-QKGISRESTEKAMRECEIDWSE---MAREQAVRKYGE-PLPSNF-------
RECX_SALTY      ARIRQELN-QKGISRESTEKAMRECEIDWSE---MAREQAVRKYGE-PLPSNF-------
RECX_SALCH      ARICQELN-QKGISRESTEKAMRECEIDWSE---MAHEQAVRKYGE-PLPSNF-------
RECX_SALAR      ARIRQELN-QKGIARESTEKAMRECDIDWSE---MAREQAVRKYGE-PLPSTF-------
RECX_ECOUT      ARIRQELN-QKGISREATEKAMRECDIDWCA---LARDQATRKYGE-PLPTVF-------
RECX_ECOK1      ARIRQELN-QKGISREATEKAMRECDIDWCA---LARDQATRKYGE-PLPTVF-------
RECX_ECO24      ARIRQELN-QKGISREATEKAMRECDIDWCA---LARDQATRKYGE-PLPTVF-------
RECX_SHIF8      ARIRQELN-QKGISREATEKAMRECDIDWCA---LARDQATRKYGE-PLPTVF-------
RECX_ECO57      ARIRQELN-QKGISREATEKAMRECDIDWCA---LARDQATRKYGE-PLPTVF-------
RECX_ECOL5      ARIRQELN-QKGISREATEKAMRECDIDWCA---LARDQATRKYGE-PLPTVF-------
RECX_SHIFL      ARIRQELN-QKGISREATEKAMRECDIDWCA---LARDQATRKYGE-PLPTVF-------
RECX_ECOL6      ARIRQELN-QKGISREATEKAMRECDIDWCA---LARDQATRKYGE-PLPTVF-------
RECX_SHIBS      ARIRQELN-QKGISREATEKAMRECDIDWCA---LARDQATRKYDE-PLPTVF-------
RECX_ECOLI      ARIRQELN-QKGISREATEKAMRECDIDWCA---LARDQATRKYGE-PLPTVF-------
RECX_ECOHS      ARIRQELN-QKGISREATEKAMRECDIDWCA---LARDQATRKYGE-PLPTVF-------
RECX_ECOLC      ARIRQELN-QKGISREATEKAMRECDIDWCA---LARDQATRKYGE-PLPTVF-------
RECX_SHISS      ARIRQELN-QKGISREATEKAMRECDIDWCA---LVRDQATRKYGE-PLPTVF-------
RECX_SHIDS      ARIRQELN-QKGISREATEKAMRECDIDWCA---LARDHATRKYDE-PLPTVF-------
RECX_ENT38      ARIRQELN-QKGIARDATEQAMRECDIDWGE---LARDQAVRKYGE-PLPSEF-------
RECX_KLEP7      ARIRQELS-QKGIARQVVDQAMRECDIDWVS---LAREQAQRKYGE-PLPSAF-------
RECX_CROS8      QRIRQELQ-QKGISRNACDSAFADCEVDWEQ---QARDQAERKFGA-PLPRTF-------
RECX_YERPS      QRIRSELM-QKGVDKERILAAFENSEIDWCQ---LAKEVAQRKFSE-TLPVEW-------
RECX_YERP3      QRIRSELM-QKGVDKERILAAFENSEIDWCQ---LAKEVAQRKFSE-TLPVEW-------
RECX_YERPP      QRIRSELM-QKGVDKERILAAFENSEIDWCQ---LAKEVAQRKFSE-TLPVEW-------
RECX_YERPA      QRIRSELM-QKGVDKERILAAFENSEIDWCQ---LAKEVAQRKFSE-TLPVEW-------
RECX_YERPE      QRIRSELM-QKGVDKERILAAFENSEIDWCQ---LAKEVAQRKFSE-TLPVEW-------
RECX_YERPN      QRIRSELM-QKGVDKERILAAFENSEIDWCQ---LAKEVAQRKFSE-TLPVEW-------
RECX_YERE8      QRIRSELM-QKGVDKELIQAAFEISEINWCL---LAKEVAQRKFSE-ILPIEW-------
RECX_SERP5      QRIRSELM-QKGVDKELTQAALADCEIDWCE---QAKQVAQRKFGD-QLPTDW-------
RECX_PECAS      QRIRMELS-QKGIDKTTLTTALNESDIDWCI---LAKSVVERKFGH-PLSDEW-------
RECX_VIBC3      QRLRQQLK-EKRVAEEVIEQALAEQTIDWFE---LAKEVAHKKFKS-GISHER-------
RECX_VIBCH      QRLRQQLK-EKRVAEEVIEQALAEQTIDWFE---LAKEVAHKKFKS-GISHER-------
RECX_VIBVU      RRIRQELS-LKQVSDSVVENAFAEEPQDWFE---LAKSVAMKKFNG-VKAKEQ-------
RECX_VIBVY      RRIRQELS-LKQVSDSVVENAFAEEPQDWFE---LAKSVAMKKFNG-VKAKEQ-------
RECX_VIBPA      RRIRQELN-QKRVAESVIEQAMAEEPQDWFE---LAKLAAEKKFKG-IKAKDQ-------
RECX_HAEIE      GRIRQELRQLKGVSSDIIDEVLMESEIDWYE---MAENLLRKKFPNYNEQQTP-------
RECX_HAEIN      GRIRQELRQLKGVSSDIIDEVLMESEIDWYE---MAENLLRKKFPNYNEQQTP-------
RECX_HAEIG      GRIRQELRQLKGVSSDIIDEVLMESEIDWYE---MAENLLRKKFPNYNEQQTP-------
RECX_HAEI8      GRIRQELRQLKGVSSDIIDEVLMESEIDWYE---MAENLLRKKFPNYNEQQTS-------
RECX_MANSM      NRIKQELRQLKGILPETVDEALMECDIDWSE---IALNVLAKKFPDYRARQDA-------
RECX_PASMU      ARIKQELQQLKGISSALISEAEQTLAPDWQH---HALTVLRKKFPQYAEITDL-------
RECX_ACTP2      RRLKQELK-LKGIKDWLINQELENAEIDWFI---LAEQVFEKKRPQ---VWDI-------
RECX_HAEDU      RRLKQELR-LKGIKDYLISEQLQNTEIDWFS---LAELLFEKKRPL---DWNI-------
RECX_LEGPN      LKIRQELK-NKGIDPDLIQSVLHQEKDNWVN---YALRAWEKKFKR-QDDFSY-------
RECX_LEGPC      LKIRQELK-NKGIDPDLIQSVLHQEKDNWVN---YALRAWEKKFKR-QDDFSY-------
RECX_LEGPA      LKIRQELK-NKGIDPDLIQSVLHQEKDNWVN---YALRAWEKKFKR-QDDFSY-------
RECX_LEGPL      LKIRQELK-NKGIDPDLIQSVLHQEKDNWVN---YALRAWEKKFKR-QDDFSY-------
RECX_ACIAD      NRIKQALK-NKELDTALINDEIQDI--DWLE---QAYQLKVKKFGT-DVETDA-------
RECX_NEIMF      LRLKQALA-QQGIDEETSRNLLP-DRSSEKQ---AAIDVLRKKFKH--PAADL-------
RECX_NEIMA      LRLKQALA-QQGIDEETSRNLLP-DRSSEKL---AAIAVLRKKFKH--PAADL-------
RECX_NEIG1      LRLKQALA-QQGIDEKTSRNLLP-DRSSEKQ---AAIAVLRKKFKH--PAANL-------
RECX_NEIMB      LRLKQALA-QQGIDEETSRNLLP-DRSSEKL---AAIAVLRKKFKH--PAADL-------
RECX_CHRVO      RRLAQEMR-QRGVDSDTIREALS-GQD-DLA---SAREQWRKKFGR--LPADA-------
RECX_HERSE      QRILSELH-GHGIEGEAIADLKADLAAGEAE---RAAQVLRRKFTA--PPADA-------
RECX_RALSO      ARLMQELK-THELGDDALGEVKAQLQASEMA---RAKAVWERRFGR--PPADM-------
RECX_THET2      RKLRALLL-ARGVPEEVVEEVLPEARVEEAL---AVLRRYRHREDK--------------
RECX_THET8      RKLRALLL-ARGVPEEVVEEVLPEARVEEAL---AVLRRYRHREDK--------------
RECX_MYCSS      RALAAELR-RKGVDDEVISSSLADIDAGAER---DRAERLVRDRLRREKLDD--EP-GSD
RECX_MYCSK      RALAAELR-RKGVDDEVISSSLADIDAGAER---DRAERLVRDRLRREKLDD--EP-GSD
RECX_MYCSJ      RALAAELR-RKGVDDEVISSSLADIDAGAER---DRAERLVRDRLRREKLDD--EP-GSD
RECX_MYCS2      RALAVELR-KKGVDDEVISSALADLDPAAER---QRAEQLVRDKLRRERLDG--TP-END
RECX_MYCVP      RALAAELR-KKGVDNEVIDGALAGIDAGAER---TRAEQLVRDKLRREKLGDPDDR-DAE
RECX_MYCA1      RALAAELH-TKGVDNDVITSVLAGIDAGAER---DRAEQLVRSKLRRETLAQD------D
RECX_MYCUA      RALAAELQ-AKGVDQDVIGTALAGLDAGAER---GRAEQLVRTKLRREKLTED------D
RECX_MYCBP      RALAAELH-AKGVDDDVITTVLGGIDAGAER---GRAEKLVRARLRREVLIDD---GTDE
RECX_MYCBO      RALAAELH-AKGVDDDVITTVLGGIDAGAER---GRAEKLVRARLRREVLIDD---GTDE
RECX_MYCTA      RALAAELH-AKGVDDDVITTVLGGIDAGAER---GRAEKLVRARLRREVLIDD---GTDE
RECX_MYCTU      RALAAELH-AKGVDDDVITTVLGGIDAGAER---GRAEKLVRARLRREVLIDD---GTDE
RECX_MYCLE      RALAADLR-AKGIDSEVITTVLAGIDPAVER---ERAEQLVRTRLRREVLSED------D
RECX_STRLI      RALARELR-TKGVEAALIDVAVSQLDTEQEE---ETARDLVARKLRATRGLDR-------
RECX_STRCO      RALARELR-TKGVEAALIDVAVSQLDTEQEE---ETARDLVARKLRATRGLDR-------
RECX_THEFY      RALAAELR-QRGVDEDTVRAAVDGLSPAQEE---ATARQLVRRRLAATRGKPT-------
RECX_AMYMU      TALMAELR-RKGVDDEVAAQAAGEVDRESEE---QMARELVRKRLGSLGNVDE-------
RECX_COREF      RVLDRELR-DKGVDAGIRARALEQIDPEDER---DTARAVAVKKARSESRIPA--DRSDY
RECX_CORGL      RALDRELQ-EKGVDKQTRAAALEQIDQADER---DTARAVAVKKARSETKIPQ--DRADY
RECX_CORDI      QALTRELR-DKGIKSEIIADVVGDIQPEDEQ---DIARELAYKKVRSLKKEPC--DYPEY
RECX_CLOPE      NKIKYALI-RKGVSEDILLDKLSNIDTEDE--NDTAFKLAEKKYNILKKKESDKYK----
RECX_CLOP1      NKIKYALI-RKGVSEDILLDKLSNIDTEDE--NDTAFKLAEKKYNILKKKESDKYK----
RECX_CLOPS      NKIKYALI-RKGVSEDILLDKLSNIDSEDE--NYTAFKLAEKKYNILKKKESDKYK----
RECX_CLOB8      QKIKYTLL-RKGICKEIIDEELLNLDKENE--KDVAFDIAQKKYNLIKNKETDTYK----
RECX_CLOAB      VKIKYGLI-KKGINDSIIDEKLSKYSANNENYIEAMREVALKKFNNIAKRETDKLK----
RECX_CLOTE      NKIKYSLM-QKGISESIIDEKLNCVDRDKE--KDALNKIAEKKYKSILKNEEDKTK----
RECX_CLOD6      NRIKQNLY-NKGINRSTINEAVSELDKDTE--FENAMYLAKKRYERVKK--EDKKK----
RECX_BACSU      DVLFRELR-AKGIDDDTIKEALS-SFSFEDQ-TREAVKHVEKLLKKD-KKLSTKE-----
RECX_BACVZ      DVLFRELK-AKGIDDDTIKETLS-AFTFDEQ-IQEALKHIGKILKKD-KKLSTKE-----
RECX_BACLD      DVLFRELK-LKGIDDELIHEALS-SFSFSDQ-VEAAVKHAEKVLKKE-KKLSSKE-----
RECX_BACP2      SVLKKELK-LKGIEDDHIEQALS-QYPDDLQ-LEEAVKQVQKLVRKE-KNRSTKE-----
RECX_LISMO      RTIERELV-EKGLTREIISRVIE-EYSDEAQ-LENATKQAMKIMKRN-NKSAKKM-----
RECX_LISMF      RTIERELV-EKGLTREIITQVIE-EYSDEAQ-LENATKQAIKIMKRN-NKSAKKM-----
RECX_LISW6      RTIERELV-EKGLTREIISQVIE-EYSDENQ-LENATKQAMKIMKRN-NKSAKKM-----
RECX_LISIN      RTIERELV-EKGLTREIISQVME-EYASDIQ-LENATKQAMKIMKRN-NKSAKKM-----
RECX_ENTFA      RNVAQQLK-QKGISEEDIQHGLT-FYTLDEQ-LNVATATAEKAMKRY-RTKSFKD-----
RECX_LACPL      RVIRQNLR-QKGVGEQLIDDALAGQFSAEEQ-IDNASELARKLAKRY-HRQAFKT-----
RECX_LACBA      RVIRQNLR-HKGVLEQPIDEALT-LYTTEEQ-LTVGTAVAAKLAKRY-QRQPFGT-----
RECX_LACRD      GVIRQHLR-QKGIGENDIDDALT-QFTPEVQ-AELAKKLAEKLFRRY-RNQPERR-----
RECX_LEUMM      NVIKMDLK-QAGVNDDDIETALS-DYTHEEQ-IEIAEKLALKSATTY-KRESTRA-----
RECX_LACJO      RSISSKLK-QKGVANDIIQDSLY-EVDDEEW-IEAGMRLIHSIGHQV-GKMSYKE-----
RECX_LACGA      RTVDRKLK-QKGLAADIIQEALY-EIEDEEW-VDAGLRVVHSLIHQA-GKLSYKE-----
RECX_LACDA      GAVRRDLK-KKGVDDDLIEAALA-DVTDEEW-AGVGKRLVKSLLGQQ-GKIAKRE-----
RECX_LACDB      GAVRRDLK-KKGIDDDLIEAALA-DVTDEEW-AGVGKRLVKSLLGQQ-GKIAKRE-----
RECX_BACCZ      TVIKRELL-NKGVQDLIITHSLQ-EYPKEKQ-IENALILIEKKKKSY-QKHSFLQ-----
RECX_BACAH      TVIKRELL-NKGVQDLIITHSLQ-EYPKEKQ-IENALILIEKKKKSY-QKHSFLQ-----
RECX_BACC1      TVIKRELL-NKGVQDLIITHSLQ-EYPKEKQ-IENALILIEKKKKSY-QKHSFLQ-----
RECX_BACAN      TVIKRELL-NKGVQDLIIMHSLQ-EYTKEKQ-IENALILIEKKKKSY-QKHSFLQ-----
RECX_BACHK      TVIKRELL-NKGVQDLIIMHSLQ-EYTKEKQ-IENALILIEKKKKSY-QKHSFLQ-----
RECX_BACCR      TVIKRELL-NKGVQDLIITHSLQ-EYPKEKQ-IENALFLIEKKKKSY-QKHSFLQ-----
RECX_BACCN      SVIRKELL-RKGVQEVIITHSLQ-EYPKEKQ-VDNAFMLIEKKKRSY-QKHSFLQ-----
RECX_BACHD      LKLKQELA-EKGVSEKTIEGALT-TFSYEEQ-VEQVKAWLEKQKGRT-FKGSSLA-----
RECX_GEOKA      LLVRAELE-RLGVPDRLIEQSLA-EYTLDEQ-MAIARSLYEKAKKQR-RDESARA-----
RECX_GEOTN      RLIQAELE-RLGVPASVIEQSLV-EYSFNEQ-VIAARSLYEKAKKQR-RAESARA-----
RECX_OCEIH      KMIQQELF-EKGVDGSKITSALE-QYPVEEQ-KQKVEKLISKKLQSK-SKDSHQK-----
RECX_LACLS      YQIKQKLL-TKGISNDVLSEALKEIYSEEKQ-IDVAYKLASKLSRTYGTRLTLKQ-----
RECX_LACLM      YQIKQKLL-TKGISNDVLSETLNEIYSEEKQ-IDVAYKLASKLSRTYGTRLTLKQ-----
RECX_LACLA      YQIKQKLI-TKGIDPLIIDQALSNIYDEEKQ-IDVAYKLAEKTNRTYGQRLTLKQ-----
RECX_STRA1      YVIKQKLL-QKGIKSKIIESELQAINFQD-----LASKISQKLYKKYQNKLPLKA-----
RECX_STRA3      YVIKQKLL-QKGIKSKIIESELQAINFQD-----LASKISQKLYKKYQNKLPLKA-----
RECX_STRA5      YVIKQKLL-QKGIKSKIIESELQAINFQD-----LASKISQKLYKKYQNKLPLKA-----
RECX_STRGC      FVLKQKLT-QKGISSTIIEEELSQFDFTE-----LTDKVAEKLLKKYQGKLPSKA-----
RECX_STRSV      FVLKQKLS-QKGISSTIIEEELSQFDFTE-----LTNKVAEKLLKKYQEKLPSKA-----
RECX_STRP2      YVLTQKLA-QKGISKSTIEENLKEFDFSE-----VAQRVANKLLKKYEGKLPARA-----
RECX_STRR6      YVLTQKLA-QKGISKSTIEENLKEFDFSE-----VAQRVANKLLKKYEGKLPARA-----
RECX_STRPN      YVLTQKLA-QKGISKSTIEEILNDFDFSE-----VAQRVANKLLKKYEGKLPARA-----
RECX_STRT1      YALKQKWL-QKGCEKQVIDEVLTQFDFSE-----VAIKVTSKLLRKYQGKLPTKS-----
RECX_STRT2      YALKQKWL-QKGCEKQVIDEVLTQFDFSE-----VAIKVTSKLLRKYQGKLPTKS-----
RECX_STRTD      YALKQKWL-QKGCEKQVIDEVLTQFDFSE-----VAIKVTSKLLRKYQGKLPTKS-----
RECX_STRMU      FVLKQKLL-QKGIESQLIEDMLKDFDFSS-----ICIKTAQKLLKKYQSKLPKRA-----
RECX_STRPC      QVLKQKLL-QKGIASHDIDPILSQTDFSQ-----LAQKVSQKLFDKYQEKLPPKA-----
RECX_STRPB      QVLKQKLL-QKGIASHDIDPILSQTDFSQ-----LAQKVSQKLFDKYQEKLPPKA-----
RECX_STRPF      QVLKQKLL-QKGIASHDIDPILSQTDFSQ-----LAQKVSQKLFDKYQEKLPPKA-----
RECX_STRP8      QVLKQKLL-QKGIASHDIDPILSQTDFSQ-----LAQKVSQKLFDKYQEKLPPKA-----
RECX_STRPG      QVLKQKLL-QKGIASHDIDPILSQTDFSQ-----LAQKVSQKLFDKYQEKLPPKA-----
RECX_STRPM      QVLKQKLL-QKGIASHDIDPILSQTDFSQ-----LAQKVSQKLFDKYQEKLPPKA-----
RECX_STRP1      QVLKQKLL-QKGIASHDIDPILSQTDFSQ-----LAQKVSQKLFDKYQEKLPPKA-----
RECX_STRP3      QVLKQKLL-QKGIASHDIDPILSQTDFSQ-----LAQKVSQKLFDKYQEKLPPKA-----
RECX_STRPD      QVLKQKLL-QKGIASHDIDPILSQTDFTQ-----LAQKVSQKLFDKYQEKLPPKA-----
RECX_STAA2      KIYQQKLY-QLGIEPNIIEMFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAAN      KIYQQKLY-QLGIEPNIIEMFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAAB      KIYQQKLY-QLGIEPNIIEMFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAA1      KIYQQKLY-QLGIEPNIIEMFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAA9      KIYQQKLY-QLGIEPNIIEMFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAAR      KIYQQKLY-QLGIEPNIIEMFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAAM      KIYQQKLY-QLGIEPNIIEMFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAA8      KIYQQKLY-QLGIEPNIIEIFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAA3      KIYQQKLY-QLGIEPNIIEIFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAAE      KIYQQKLY-QLGIEPNIIEIFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAAT      KIYQQKLY-QLGIEPNIIEIFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAAC      KIYQQKLY-QLGIEPNIIEIFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAAS      KIYQQKLY-QLGIEPNIIEIFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAAW      KIYQQKLY-QLGIEPNIIEIFTELYREQQ----ELDDIIQIAEKISKTKKGPQNK-----
RECX_STAEQ      EIYRQKLY-QLGIEVTIIEKYVEAYEQQQ----PLDDVIKVAEKVMKSKKGPEAK-----
RECX_STAES      EIYRQKLY-QLGIEVTIIEKYVEAYEQQQ----PLDDVIKVAEKVMKSKKGPEAK-----
RECX_STAHJ      EIFRQKLY-QVGIEPNIINTYVPIYEEEQ----SFEAVIEVAKKIMKTKKGPEIK-----
RECX_STAS1      GIFRQKLR-DAGVEQTIIDVYAERYENEQ----PMEDIIKVANKILKQKKGPTVK-----
RECX_THEMA      RVVKMKLK-SLGVDEEIIERAIE-------------KALEEIDFHEELKRLKGRFK----
RECX_THEP1      RVVRMKLK-SLGVDEEIIERAIE-------------KALEEIDFHEELKRLKGRFK----
RECX_CHLTE      LKTRARLK-QKGLPDNIIDEALNGCDQTELC-----RSAAEKKLRTLPASPDQ-------
RECX_DEIRA      LRVRQTLR-RRGLGADLIEETLQARDPEEEQ--QQAIDLLTKRWPALSRKRDP-------
RECX_CALS4      RIYYELLK--RGVEKEIIEKVLESIYPHEKE-----VEVIRQIVEKKKNSHRE-------
RECX_PELCD      PALMADLR-HQRIGDSIARKAINDLEEEFSQ-AEILKDLCQRRFPDFDFQTADDR-----
RECX_TREPA      AQLLGELK-RRGVSHADAEGALDLLFQEQDE-----ETLCLRLLEKLRRRGYG-------
RECX_FUSNN      KKLSFILY-QMGVDKEIVSEILEDEKDNQIE---KIKQLWIKLGNK--------------
RECX_AGRFC      RGLAQKLQ-IKGVARETATAALQETNDLVAA----VIFARKRAFGPYRRVEPDEK-----
RECX_MYXXD      RVIAQKLR-LKGVPAEVVAKKVADATHEVSEEDAARIWARKKRLGPFRTQPGTRE-----
                                                                            

RECX_PSEFL      -RERAKQGRFLSYRGFSMDMISRLLS--GRDMDD--------------------------
RECX_PSETO      -KERAKQGRFLSYRGFSMDMISRLLS--GRDLDD--------------------------
RECX_PSEF5      -RERAKQGRFLSYRGYSMDMISRLLS--GRGMDD--------------------------
RECX_PSE14      -RERARQGRFLSYRGYPLDMIGRLLS--GRGGDD--------------------------
RECX_PSEU2      -RERAKQGRFLSYRGYPLEMIGRLLS--GRGGDD--------------------------
RECX_PSESM      -RERARQGRFLSYRGYPLDMIGRLLS--GRGGDD--------------------------
RECX_PSEPK      -RSRAQQTRFLAYRGFPMDMIGRLLS--GRDLDDY-------------------------
RECX_PSEP1      -RSRAQQTRFLAYRGFPMDMIGRLLS--GRDLDDY-------------------------
RECX_PSEPG      -RSRAQQTRFLAYRGFPMDMIGRLLS--GRDLDDY-------------------------
RECX_PSEE4      -RSRAQQTRFLAYRGFSMEMIGRLLS--GRDLYD--------------------------
RECX_PSEAB      -REKAQQGRFLAYRGYSMESISRLLN--SRS-DD--------------------------
RECX_PSEAE      -REKAQQGRFLAYRGYSMESISRLLN--GRS-DD--------------------------
RECX_PSEA7      -REKAQQGRFLAYRGYSMESISRLLS--GRS-DD--------------------------
RECX_HALHL      -REALRQAQFLQRRGFTADQVRAAAA--AADEDDERGPYG--------------------
RECX_XANAC      -PQRRKAADLLARRGFEGNSIRAATR--FDLED---------------------------
RECX_XANCI      -PQRRKAADLLARRGFEGNSIRAATR--FDLED---------------------------
RECX_XANC5      -PQRRKAADLLARRGFDGNSIRAATR--FDLED---------------------------
RECX_XANOR      -PQRRKAADWLARRGFDGNSIRAATR--FDLED---------------------------
RECX_XANOM      -PQRRKAADWLARRGFDGNSIRAATR--FDP-----------------------------
RECX_XANCP      -AQRRKAADLLARRGFDGNSIRLATR--FDLED---------------------------
RECX_XANC8      -AQRRKAADLLARRGFDGNSIRLATR--FDLED---------------------------
RECX_SALTI      -SEKVKVQRFLLYRGYLMDDIQQIWR--NFAD----------------------------
RECX_SALPB      -SEKVKVQRFLLYRGYLMDDIQQIWR--NFAD----------------------------
RECX_SALPA      -SEKVKVQRFLLYRGYLMDDIQQIWR--NFAD----------------------------
RECX_SALTY      -SEKVKVQRFLLYRGYLMDNIQQIWR--NFAD----------------------------
RECX_SALCH      -SEKVKVQRFLLYRGYLMDDIQQIWR--NFAD----------------------------
RECX_SALAR      -SEKVKVQRFLLYRGYLMDDIQEIWR--NFAD----------------------------
RECX_ECOUT      -SEKVKIQRFLLYRGYLMEDIQDIWR--NFAD----------------------------
RECX_ECOK1      -SEKVKIQRFLLYRGYLMEDIQDIWR--NFAD----------------------------
RECX_ECO24      -SEKVKIQRFLLYRGYLMEDIQDIWR--NFAD----------------------------
RECX_SHIF8      -SEKVKIQRFLLYRGYLMEDIQDIWR--NFAD----------------------------
RECX_ECO57      -SEKVKIQRFLLYRGYLMEDIQDIWR--NFAD----------------------------
RECX_ECOL5      -SEKVKIQRFLLYRGYLMEDIQDIWR--NFAD----------------------------
RECX_SHIFL      -SEKVKIQRFLLYRGYLMEDIQDIWR--NFAD----------------------------
RECX_ECOL6      -SEKVKIQRFLLYRGYLMEDIQDIWR--NFAD----------------------------
RECX_SHIBS      -SEKVKIQRFLLYRGYLMEDIQDIWR--NFAD----------------------------
RECX_ECOLI      -SEKVKIQRFLLYRGYLMEDIQEIWR--NFAD----------------------------
RECX_ECOHS      -SEKVKIQRFLLYRGYLMEDIQEIWR--NFAD----------------------------
RECX_ECOLC      -SEKVKIQRFLLYRGYLMEDIQEIWR--NFAD----------------------------
RECX_SHISS      -SEKVKIQRFLLYRGYLMEDIQDIWL--NFAD----------------------------
RECX_SHIDS      -SEKVKIQRFLLYRGYLMEDIQDIWR--NFAD----------------------------
RECX_ENT38      -SEKVKIQRFLLYRGYLMEDIQAIWR--NFTD----------------------------
RECX_KLEP7      -TEKVKVQRFLLYRGYLMEDIQEIWR--NFAD----------------------------
RECX_CROS8      -PEKAKVQRFLLYRGYYMEDIQAIYR--NFE-----------------------------
RECX_YERPS      -KEKAKVQRYLLYRGFFQEEIQSIYT--DSVE----------------------------
RECX_YERP3      -KEKAKVQRYLLYRGFFQEEIQSIYT--DSVE----------------------------
RECX_YERPP      -KEKAKVQRYLLYRGFFQEEIQSIYT--DSVE----------------------------
RECX_YERPA      -KEKAKVQRYLLYRGFFQEEIQSIYT--DSVE----------------------------
RECX_YERPE      -KEKAKVQRYLLYRGFFQEEIQSIYT--DSVE----------------------------
RECX_YERPN      -KEKAKVQRYLLYRGFFQEEIQSIYT--DSVE----------------------------
RECX_YERE8      -KEKVKVQRYLLYRGFFQEEIQSIYN--DFVE----------------------------
RECX_SERP5      -KEKAKVQRYLLYRGFFQEEIQSIYR--DFAQ----------------------------
RECX_PECAS      -KDKVKHQRYLLYRGFFHEEIQSIYT--NFSD----------------------------
RECX_VIBC3      -SQYAKQVRYLQYRGFNFEQIRYALQ--ASESDE--------------------------
RECX_VIBCH      -SQYAKQVRYLQYRGFNFEQIRYALQ--ASESDE--------------------------
RECX_VIBVU      -KEYAKQVRFLQYRGFSFEQIRYALS--DEA-----------------------------
RECX_VIBVY      -KEYAKQVRFLQYRGFSFEQIRYALN--DKA-----------------------------
RECX_VIBPA      -KEYAKQVRFLQYRGYSFDQISYALS--FEDED---------------------------
RECX_HAEIE      -KMKQKIWQYMLSHGFRSDEFADLIG--QNQSEWD-------------------------
RECX_HAEIN      -KMKQKIWQYMLSHGFRSDEFADLIG--QNQSEWD-------------------------
RECX_HAEIG      -KMKQKIWQYMLSHGFRSDEFADLIG--QNQSEWD-------------------------
RECX_HAEI8      -KMKQKIWQYMLSHGFRSDEFADLIG--QNQSEWD-------------------------
RECX_MANSM      -KNKQKIWRYMLSHGFFAEDFADFIG--NGTEDEFY------------------------
RECX_PASMU      -KLKQKVWRYMLSHGFKPEQFAHYVG--HTEYEE--------------------------
RECX_ACTP2      -KAKQKMWRFMLSRGFYNDHFSHLMD--IDYNDTEYE-----------------------
RECX_HAEDU      -KVKQKMWRFMLSRGFYNEHFSHLMD--LEEVSKEYE-----------------------
RECX_LEGPN      -SEIQKQQRFLLYRGFDRDVISKVFK--EVKSSYLI------------------------
RECX_LEGPC      -SEIQKQQRFLLYRGFDRDVISKVFK--EVKSSYLI------------------------
RECX_LEGPA      -SEIQKQQRFLLYRGFDRDVISKVFK--EVKSSYLI------------------------
RECX_LEGPL      -SEMQKQHRFLLYRGFDRDVISKVFK--EVKSSYLI------------------------
RECX_ACIAD      -KLKAKQIRFLQYRGFDMDIIMKAIH--RIEEE---------------------------
RECX_NEIMF      -KEKQKQARFLAYRGFDADTVQTALK--HAWDENWEDGC---------------------
RECX_NEIMA      -KEKQKQARFLAYRGFDADTVQTALK--HAWDENWEDGC---------------------
RECX_NEIG1      -KEKQKQARFLAYRGFDADTVQTALK--HAWDENWEDSC---------------------
RECX_NEIMB      -KEKQKQARFLAYRGFDADTVQTALK--HAWDDGWEEDC---------------------
RECX_CHRVO      -AEKARQYRFLAQRGFPADVIRQVLA--GGADDDFYED----------------------
RECX_HERSE      -ETRAKQMRFLQQRGFSHRSIREAFQ--TAWLDE-DDPS---------------------
RECX_RALSO      -AERAKQVRFMVARGFSRAVVSRIIQGADALLDDGDEPV---------------------
RECX_THET2      ----ARAVRFLEGRGFPLGVALEAWRLAQEEGEGYK------------------------
RECX_THET8      ----ARAVRFLEGRGFPLGVALEAWRLAQEEGEGYK------------------------
RECX_MYCSS      LKVKRRLAGMLARRGYSQSMALDVVTVELAGERERRRV----------------------
RECX_MYCSK      LKVKRRLAGMLARRGYSQSMALDVVTVELAGERERRRV----------------------
RECX_MYCSJ      LKVKRRMAGMLARRGYSQSMALDVVTVELAGERERRRV----------------------
RECX_MYCS2      VKVTRRLVGMLARRGYNQSMAYDVVSVELANERERRRV----------------------
RECX_MYCVP      NKVARRLVGMLARRGYNQTMAFDVVTAELANERERRKV----------------------
RECX_MYCA1      ARVTRRLVGMLARRGYSQNLACEVVLAELAAERERRRV----------------------
RECX_MYCUA      ARVTRRLVAMLARRGYSQTVACEVVIAELAAERDRRRV----------------------
RECX_MYCBP      ARVSRRLVAMLARRGYGQTLACEVVIAELAAERERRRV----------------------
RECX_MYCBO      ARVSRRLVAMLARRGYGQTLACEVVIAELAAERERRRV----------------------
RECX_MYCTA      ARVSRRLVAMLARRGYGQTLACEVVIAELAAERERRRV----------------------
RECX_MYCTU      ARVSRRLVAMLARRGYGQTLACEVVIAELAAERERRRV----------------------
RECX_MYCLE      ARVSRRLMAMLARRGYSQTTICEVVVAELAAERERRRV----------------------
RECX_STRLI      DKRLRRLAGMLARKGYSEGMALRVVRQALEEEGEDTEHLG-DEGF---------------
RECX_STRCO      DKRLRRLAGMLARKGYSEGMALRVVRQALEEEGEDTEHLG-DEGF---------------
RECX_THEFY      EVRVRRLMGMLARRGYSAGLAYRLVREELEAEGVEVDFPSPEEG----------------
RECX_AMYMU      QTALRRLLGFLARKGYPQGLAYTVIKEELREYGAESTLLDDAVID---------------
RECX_COREF      DKALRRVVGALARRGFPAGMSMDLAREALDERIEDLRQH---------------------
RECX_CORGL      DKALRRVVGALARRGFPAGMSMDLAREALDARIEDLKN----------------------
RECX_CORDI      QKVLRRTVGVLARRGFSQSMALEIAREAIDARIDEIRR----------------------
RECX_CLOPE      --LSQKLFRFLLSKGYDYDCCNSIVRRLTNNEYME-------------------------
RECX_CLOP1      --LSQKLFRFLLSKGYDYDCCNSIVRRLTNNEYME-------------------------
RECX_CLOPS      --LSQKLFRFLLSKGYNYDCCNSIVRRLTNNEYME-------------------------
RECX_CLOB8      --ISGKLYRYLISKGYNTEVTSQVIKKVMAVDVDDF------------------------
RECX_CLOAB      --IKRKLSSYLLGRGYSWSEIGEVLKEIFSENN---------------------------
RECX_CLOTE      --IYNKLGRFLMSKGYLWEDVKSVLNKLLYSDG---------------------------
RECX_CLOD6      --IYQKISQHLSYKGFDYDIIKRVLNKLLNFDEYDI------------------------
RECX_BACSU      --LKQRAQLQLQRKGFSFDVISAAMDQIEYENDEDTEKEALRLHAEKAFRKYR-YDGSYE
RECX_BACVZ      --IRQRAQMQLQRKGFPFDVINAALEQTEYENDDEAEMEALKAHAEKAIRKYR-YDGSYE
RECX_BACLD      --TKQAIEQHLVRKGFSFDVISAALQETDYENDDGAEREALEKQGEKAMKRYG-YDGSYE
RECX_BACP2      --IEQRIKLQLQRKGFSFEIIDKALQEAYDGQEEEKEEEALLYMMEKAKRKVG-YDGSFE
RECX_LISMO      --LQQKIITDLIQKGFTSELAKAAATEATSELDVADEAEILQKQIEKTMRKNK-RYKPSI
RECX_LISMF      --LQQKIITDLIQKGYTSELAKVAATEATSELDVADEAEILQKQIEKTMRKNK-RYKPSI
RECX_LISW6      --LQQKITTDLIQKGYSSEVAKAASLEATNELDMADEADILQKQIEKTMRKNK-RYKPSV
RECX_LISIN      --LQQKIITDLIQKGYSSEVAKMAAIEATSELDVADEADILQKQVEKTIRKNK-RYKPSI
RECX_ENTFA      --ALQKMRLHLMQKGFTNEIIDLALESLAFEKDEEQEQQALDKEGERLWRANQ-RFDFSK
RECX_LACPL      --MQQKVRQGMMTKGFDNDTITAAIASLALEPDEDEQWEALVAQGTKLWQRNR-KYAFRE
RECX_LACBA      --QQQKIRQGLLTRGFDNDLATKMLATLDLTPDEDEQWALLVKQGEKLWHRYR-TLSMRE
RECX_LACRD      --REQKVQQGLMTKGFSSSVYEMIKDEVVPQPDLEQENDLLAKEAAKQWRRVR-CYQGYE
RECX_LEUMM      --KKQKIVQALATKGFSFDIAEIVVDRVITENDDEIELENIKRQAEKSWRRYR-NEVPSQ
RECX_LACJO      --IKQKALKKLQTHGFNQELGELVVDQLDLESTEDDQLEALKKQGIKAWRRYR-RDDDFK
RECX_LACGA      --IKQKAWTKLRAHGFDQELSELVLEKLDLEKDEDEQIEALKKQGSKAWRRYR-KDEDFK
RECX_LACDA      --VDRKMQTKLLSHGFSGSLAQAVTQDLVPEADEDQERAALVKQVLKAYKRFK-RYEPGV
RECX_LACDB      --VDRKMQTKLLSHGFSGSLAQAVTQDLVPEADEDQERAALVKQGLKAYKRFK-RYEPGV
RECX_BACCZ      --MKLKLDEMLVRKGYSRDVIQICLEELKDEKDDEKQQEALHYHGNKYYEKYK-KYDGWT
RECX_BACAH      --MKLKLDEMLVRKGYSRDVIQICLEELKDEKDDEKQQEALHYHGNKYYEKYK-KYDGWT
RECX_BACC1      --MKLKLDEMLVRKGYSRDVIQICLEELKDEKDDEKQQEALHYHGNKYYEKYK-KYDGWT
RECX_BACAN      --MKLKLDEMLVRKGYSRDVIQICLEELKDEKDDEKQQEALHYHGNKYYEKYK-KYDGWT
RECX_BACHK      --MKLKLDEMLVRKGYSRDVIQICLEELKDEKDDEKQQEALHYHGNKYYEKYK-KYDGWT
RECX_BACCR      --MKLKLDEMLVRKGYSREVIQICLEELKDEKDDEKQQEALHYHGNKYYEKYK-KHDGWT
RECX_BACCN      --MKQKLEDMLIRKGFSRDVIQICLEELKEEKDDSKQQEALYYHGNKYYEKYK-KYDGWT
RECX_BACHD      --WKQKLSRQLLAKGYTSPVIEEAFADVPIKQEEEEEWEALKAFGEKAMRKYAGKKTGWE
RECX_GEOKA      --FLERVRQQLMRKGFPHEVIAAVLADGG-THTEQEEREALSVQAEKAHRRYA-HHPRPL
RECX_GEOTN      --FLERVKQQLMRKGFSHEVIAIVLADGS-GHTEEEEREALHVQAEKIRRRYA-HHPRPL
RECX_OCEIH      --RIDQIKQNLMQKGFDSGVISMVIQQMDTTEDTDREWEVLQLQGEKLLYKYQKKHSGFA
RECX_LACLS      --LKDKIIQNLMNKGFSYSVSSIALDSLELEADEENEMDLLYSELDKVAKRYTKNYEGYE
RECX_LACLM      --LKDKIIQNLMNKGFSYSVSSIALDSLELEADEENEMDLLYSELDKVAKRYTKNYEGYE
RECX_LACLA      --LKDKIIQNLMNKGFTYSISSIALESLELETDEENETQLLYTALEKVAKRYSKNYEGYE
RECX_STRA1      --LKDKLMQSLTTKGFDYQIAHTVIQNLEIEKDQELEEDLIYKELDKQYQKFSKKYDQYE
RECX_STRA3      --LKDKLMQSLTTKGFDYQIAHTVIQNLEIEKDQELEEDLIYKELDKQYQKLSKKYDQYE
RECX_STRA5      --LKDKLMQSLTTKGFDYQIVHTVIQNLEIEKDQELEEDLIYKELDKQYQKLSKKHDQYE
RECX_STRGC      --LQDKLLQSLINKGFSYSQAKTAYQHLDIEEDQENQEELLYKELDKQYRKYSKKYDGYD
RECX_STRSV      --LQDKILQSLINKGFSYSQAKTAYQHLEIEEDQENQQELLYKELDKQYRKYSKKYDGYD
RECX_STRP2      --LQDKIIQNLTNKGFSYSDAKIAFDDLDSQVDQETTQELIFKELDKQYTKYARKYEGYE
RECX_STRR6      --LQDKIIQNLTNKGFSYSDAKIAFDDLDSQVDQETTQELIFKELDKQYTKYARKYEGYE
RECX_STRPN      --LQDKIIQNLTNKGFSYFDAKIAFDELDSQVDEETTQELIFKELDKQYTKYARKYEGYE
RECX_STRT1      --LKDKLIQNLINKGFSFQESKNAINQLELEADEENEQALLYKEIEKQYQKFSKKYDGYE
RECX_STRT2      --LKDKLIQNLINKGFSFQESKNAINQLELEADEENEQALLYKEIEKQYQKFSKKYDGYE
RECX_STRTD      --LKDKLIQNLINKGFSFQESKNAINQLELEADEENEQALLYKEIEKQYQKFSKKYDGYE
RECX_STRMU      --LKDKLKQALTTKGFSYQEAQIALEDLDIENNSENEEELIYKELDKQYRKYSKKYENYE
RECX_STRPC      --LKDKITQALLTKGFSYDLAKHSLNHLNFDQDNQEIENLLDKELDKQYRKLSRKYDGYT
RECX_STRPB      --LKDKITQALLTKGFSYDLAKHSLNHLNFDQDNQEIENLLDKELDKQYRKLSRKYDGYT
RECX_STRPF      --LKDKITQALLTKGFSYDLAKHSLNHLNFDQDNQEIENLLDKELDKQYRKLSRKYDGYT
RECX_STRP8      --LKDKITQALLTKGFSYDLAKHSLNHLNFDQGNQEIENLLDKELDKQYRKLSRKYDGYT
RECX_STRPG      --LKDKITQALLTKGFSYDLAKRSLNHLNFDQDNQEIEDLLDKELDKQYRKLSRKYDGYT
RECX_STRPM      --LKDKITQALLTKGFSYDLAKHSLNHLNFDQDNQEIEDLLDKELDKQYRKLSRKYDGYT
RECX_STRP1      --LKDKITQALLTKGFSYDLAKHSLNHLNFDQDNQEIEDLLDKELDKQYRKLSRKYDGYT
RECX_STRP3      --LKDKITQALLTKGFSYDLAKHSLNHLNFDQNNQEIEDLLDKELDKQYRKLSRKYDGYT
RECX_STRPD      --LKDKITQALLTKGFSYDLAKHSLNHLNFDQDNQEIEDLLDKELDKQYRKLSRKYDGYT
RECX_STAA2      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAAN      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAAB      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAA1      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAA9      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAAR      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAAM      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAA8      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAA3      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAAE      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAAT      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAAC      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAAS      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAAW      --VKEKVMQSLIQKGFEMETIHAVLNEMDFTQDEAVLDDLLQRDLEKIYNKNRKKYTQQK
RECX_STAEQ      --VKQKVTQSLLQKGYKFETIQLVMNEIDFSQDEETLDHLLQRDLEKVYNKNCRKYDSDK
RECX_STAES      --VKQKVTQSLLQKGYKFETIQLVMNEIDFSQDEETLDHLLQRDLEKVYNKNCRKYDSDK
RECX_STAHJ      --IRQKVLQSLIQKGYSMDVVQQAIAELNFEQDENILDDLLQKDLEKVYTKQRRKYDGQQ
RECX_STAS1      --RKEKLSQALMQKGYSFEIIKVVMDEMDFSQPEAELDGLLQQELEKVYNKYSRKFSGRK
RECX_THEMA      --DRWELRDYLYRRGFDSSLIEEILNKIDGGEE---------------------------
RECX_THEP1      --DRWELRDYLYRRGFDPSLIEEILNKIDGGEE---------------------------
RECX_CHLTE      --KKKKLITFLKNRGFDWETIRETVKLVLGEESARSDQLD--------------------
RECX_DEIRA      ---RASAYAFLARRGFGGSVIWPAIREVAELFPPDEAEE---------------------
RECX_CALS4      ---IQKLKKYLYTNGFEIENIEKALNLT--------------------------------
RECX_PELCD      --SRRRVFNYLRRRGFASAVLFQYFSEER-------------------------------
RECX_TREPA      ---PHTLQRALQRRQFSPSLVRRCLAVETEGA----------------------------
RECX_FUSNN      --EYKKKIESILRKGFLYGDIKKAISSLEEEEE---------------------------
RECX_AGRFC      --RKAKEFSAFARNGFSFEIGAKVMAMTTEEAEDILSDAPL-------------------
RECX_MYXXD      -ENRKRDLAALARAGFSFGIAKKVIDSNPA------------------------------
                          :    :                                            

RECX_PSEFL      ------------------------------------
RECX_PSETO      ------------------------------------
RECX_PSEF5      ------------------------------------
RECX_PSE14      ------------------------------------
RECX_PSEU2      ------------------------------------
RECX_PSESM      ------------------------------------
RECX_PSEPK      ------------------------------------
RECX_PSEP1      ------------------------------------
RECX_PSEPG      ------------------------------------
RECX_PSEE4      ------------------------------------
RECX_PSEAB      ------------------------------------
RECX_PSEAE      ------------------------------------
RECX_PSEA7      ------------------------------------
RECX_HALHL      ------------------------------------
RECX_XANAC      ------------------------------------
RECX_XANCI      ------------------------------------
RECX_XANC5      ------------------------------------
RECX_XANOR      ------------------------------------
RECX_XANOM      ------------------------------------
RECX_XANCP      ------------------------------------
RECX_XANC8      ------------------------------------
RECX_SALTI      ------------------------------------
RECX_SALPB      ------------------------------------
RECX_SALPA      ------------------------------------
RECX_SALTY      ------------------------------------
RECX_SALCH      ------------------------------------
RECX_SALAR      ------------------------------------
RECX_ECOUT      ------------------------------------
RECX_ECOK1      ------------------------------------
RECX_ECO24      ------------------------------------
RECX_SHIF8      ------------------------------------
RECX_ECO57      ------------------------------------
RECX_ECOL5      ------------------------------------
RECX_SHIFL      ------------------------------------
RECX_ECOL6      ------------------------------------
RECX_SHIBS      ------------------------------------
RECX_ECOLI      ------------------------------------
RECX_ECOHS      ------------------------------------
RECX_ECOLC      ------------------------------------
RECX_SHISS      ------------------------------------
RECX_SHIDS      ------------------------------------
RECX_ENT38      ------------------------------------
RECX_KLEP7      ------------------------------------
RECX_CROS8      ------------------------------------
RECX_YERPS      ------------------------------------
RECX_YERP3      ------------------------------------
RECX_YERPP      ------------------------------------
RECX_YERPA      ------------------------------------
RECX_YERPE      ------------------------------------
RECX_YERPN      ------------------------------------
RECX_YERE8      ------------------------------------
RECX_SERP5      ------------------------------------
RECX_PECAS      ------------------------------------
RECX_VIBC3      ------------------------------------
RECX_VIBCH      ------------------------------------
RECX_VIBVU      ------------------------------------
RECX_VIBVY      ------------------------------------
RECX_VIBPA      ------------------------------------
RECX_HAEIE      ------------------------------------
RECX_HAEIN      ------------------------------------
RECX_HAEIG      ------------------------------------
RECX_HAEI8      ------------------------------------
RECX_MANSM      ------------------------------------
RECX_PASMU      ------------------------------------
RECX_ACTP2      ------------------------------------
RECX_HAEDU      ------------------------------------
RECX_LEGPN      ------------------------------------
RECX_LEGPC      ------------------------------------
RECX_LEGPA      ------------------------------------
RECX_LEGPL      ------------------------------------
RECX_ACIAD      ------------------------------------
RECX_NEIMF      ------------------------------------
RECX_NEIMA      ------------------------------------
RECX_NEIG1      ------------------------------------
RECX_NEIMB      ------------------------------------
RECX_CHRVO      ------------------------------------
RECX_HERSE      ------------------------------------
RECX_RALSO      ------------------------------------
RECX_THET2      ------------------------------------
RECX_THET8      ------------------------------------
RECX_MYCSS      ------------------------------------
RECX_MYCSK      ------------------------------------
RECX_MYCSJ      ------------------------------------
RECX_MYCS2      ------------------------------------
RECX_MYCVP      ------------------------------------
RECX_MYCA1      ------------------------------------
RECX_MYCUA      ------------------------------------
RECX_MYCBP      ------------------------------------
RECX_MYCBO      ------------------------------------
RECX_MYCTA      ------------------------------------
RECX_MYCTU      ------------------------------------
RECX_MYCLE      ------------------------------------
RECX_STRLI      ------------------------------------
RECX_STRCO      ------------------------------------
RECX_THEFY      ------------------------------------
RECX_AMYMU      ------------------------------------
RECX_COREF      ------------------------------------
RECX_CORGL      ------------------------------------
RECX_CORDI      ------------------------------------
RECX_CLOPE      ------------------------------------
RECX_CLOP1      ------------------------------------
RECX_CLOPS      ------------------------------------
RECX_CLOB8      ------------------------------------
RECX_CLOAB      ------------------------------------
RECX_CLOTE      ------------------------------------
RECX_CLOD6      ------------------------------------
RECX_BACSU      SAMKVKQFLFRKGFSLDLIEQLLQEEEY--------
RECX_BACVZ      SGMKVKQYLFRKGFSIDDIDQFLQEEE---------
RECX_BACLD      TKMKVKQYLFRKGFSIDLIDQFLDEKG---------
RECX_BACP2      KKMKVKQFLFRKGFDLDTIDHVLDKGE---------
RECX_LISMO      AKQKTITSLMQKGFSYDTIQSYLTENEISFEEEE--
RECX_LISMF      AKQKTITSLMQKGFSYDTIQSYLTENEISFEEEE--
RECX_LISW6      AKQKTITSLMQKGFSYDTIQSYLTENEISFEEEE--
RECX_LISIN      AKQKTITSLMQKGFSYDTIQSYLTENEISFEEEE--
RECX_ENTFA      KVQKVKQSLFQKGFDYDLIQQFISEKEVEHDE----
RECX_LACPL      RMMRTKRSLFQKGFMMDDINRFIDEQVADE------
RECX_LACBA      RQYKTKQALYRKGFNLDDISRWLADLGESAQ-----
RECX_LACRD      REQHFKQAMYRKGFDLDDVQSWLDAQDFQ-------
RECX_LEUMM      RIYKTKNSLYTKGYNAELINVVIHELEVSADD----
RECX_LACJO      RRQKVKRYLFQHGFSSGEIDSFLSGEVVNLEEIDEY
RECX_LACGA      RKQKVKRYLFQHGFSSGEIDSFLNGEIVDLEEIDEY
RECX_LACDA      REQKMRQYLYSHGFSGDEISAFLVGEIIPLEELEEY
RECX_LACDB      REQKMRQYLYSHGFSGDEISAFLVGEIIPLEELEEY
RECX_BACCZ      FENKMKQALYRKGFSIDEIEIFLQMKREEG------
RECX_BACAH      FENKMKQALYRKGFSIDEIEIFLQMKREEG------
RECX_BACC1      FENKMKQALYRKGFSIDEIEIFLQMKREEG------
RECX_BACAN      FENKMKQALYRKGFSIDEIEIFLQMKREEG------
RECX_BACHK      FENKMKQALYRKGFSIDEIEIFLQMKREEG------
RECX_BACCR      FENKMKQALYRKGFSIDEIEIFLQMKREEE------
RECX_BACCN      FENKMKQALYRKGFSIDEIEGFLQMKCEEG------
RECX_BACHD      LQQKVKQALYRKGFSLEMIERYLND-----------
RECX_GEOKA      YEQKMRQALYRKGFALDLINEWLRMHGNDE------
RECX_GEOTN      YEQKMRQALYRKGFSLALIDEWLRRQDDDG------
RECX_OCEIH      LKQKVMEGLYRKGFSFDMINQFIDQSLQDE------
RECX_LACLS      RKQKITQALARKGFSYDDISSALRDYTFPE------
RECX_LACLM      RKQKITQALARKGFLYDDISSALRDYTFPE------
RECX_LACLA      RKQKVTQALARKGFSYDDISSALRDYTFPE------
RECX_STRA1      LKQRIINALMRKGYQYEDIKSALREYL---------
RECX_STRA3      LKQRIINALMRKGYQYEDIKSALREYL---------
RECX_STRA5      LKQRIINALMRKGYQYEDIKSALREYL---------
RECX_STRGC      LKQRLTQALARKGYDYSDISSVLRDYF---------
RECX_STRSV      LKQRLTQALARKGYDFSDIASALREYL---------
RECX_STRP2      LKQRLTQVLARKGYDFSDIASALREYL---------
RECX_STRR6      LKQRLTQVLARKGYDFSDIASALREYL---------
RECX_STRPN      LKQRLTQVLARKGYDFSDIASALREYL---------
RECX_STRT1      LKQHLTQSLFRKGYDFDAIASALREYF---------
RECX_STRT2      LKQHLTQSLFRKGYDFDAIASALREYF---------
RECX_STRTD      LKQHLTQSLFRKGYDFDAIASALREYF---------
RECX_STRMU      LRQRLTQSLARKGFAFDAIKNALREYL---------
RECX_STRPC      LKQKLYQALYRKGYNSDDINCKLRNYL---------
RECX_STRPB      LKQKLYQALYRKGYNSDDINCKLRNYL---------
RECX_STRPF      LKQKLYQALYRKGYNSDDINCKLRNYL---------
RECX_STRP8      LKQKLYQALYRKGYNSDDINCKLRNYL---------
RECX_STRPG      LKQKLYQALYRKGYNSDDINCKLRNYL---------
RECX_STRPM      LKQKLYQALYRKGYNSDDINCKLRNYL---------
RECX_STRP1      LKQKLYQALYRKGYNSDDINCKLRNYL---------
RECX_STRP3      LKQKLYQALYRKGYNSDDINCKLRNYL---------
RECX_STRPD      LKQRLYQALYRKGYNSDDINCKLRNYL---------
RECX_STAA2      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAAN      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAAB      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAA1      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAA9      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAAR      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAAM      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAA8      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAA3      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAAE      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAAT      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAAC      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAAS      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAAW      LISKTIEGLMRKGYKYDKIKAKLEESGIADGTEEIE
RECX_STAEQ      SVIKTIEALMRKGYNYDKIKSKLEESGISNE-----
RECX_STAES      SVIKTIEALMRKGYNYDKIKSKLEESGISNE-----
RECX_STAHJ      LVMKTIESLMRKGYKYDKIKSKLEESGILDE-----
RECX_STAS1      LINKTIEGLMRKGYKYDKIKAKLEESGIVDGTEEIE
RECX_THEMA      ------------------------------------
RECX_THEP1      ------------------------------------
RECX_CHLTE      ------------------------------------
RECX_DEIRA      ------------------------------------
RECX_CALS4      ------------------------------------
RECX_PELCD      ------------------------------------
RECX_TREPA      ------------------------------------
RECX_FUSNN      ------------------------------------
RECX_AGRFC      ------------------------------------
RECX_MYXXD      ------------------------------------