CLUSTAL format seed alignment for MF_01118

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

D8MPY7_ERWBE          ---------MSSTPALSN-----AQLNKRIISVVVFTFFCYLSIGLPLAVLPGYVHNQLG
A0A0J8YVF9_9GAMM      ---------MPQQSEPTR-----GQLNQRILSVMIFTFFCYLSVGLPLAVLPGFVHHQLG
A6T908_KLEP7          -----------MSTSVST-----TQLNLRIISIVVFTCICYLSIGLPLAVLPGYIHYQLG
V2TQX3_9GAMM          -------MDTQTAANTSN-----YELNKKIISVVIFTFFAYLSVGLPLAILPQLVSQQLQ
W0HTE3_9GAMM          -----MPTSDRPAASLTA-----PELNKRIIPIVFFTFICYLTIGIPLAILPGFTHTTLG
YHHS_ECOLI            ------MPEPVAEPALNG-----LRLNLRIVSIVMFNFASYLTIGLPLAVLPGYVHDVMG
H8KYX1_FRAAD          -------MMDHATTESST-----VSVTRKIVAAVVFNFLAYLVIGMQLSTLPGFVHGDLH
A0A023NW89_9GAMM      -------MSDRADTGLRG-----SRLTLRIVQIVCFTFLAYLVIGMQLAVLPPFVHDDLG
D4XDW7_9BURK          -------MSRTPHTTPDGAPISTFALTSRIVAIAFFTFICYLAIGLPLAVLPGYVHDKLG
A0A0F3L0U5_9GAMM      -------MSLPPLVPHRG---RRFAVTGRILSAVVFTFLCYLSIGIPLAVLPGYVHNELG
A4JBX7_BURVG          -------MSTDSATPPRS----GLAVTLQIVSVVCFTFVCYLTIGLPLAVLPGFVHDDLG
F2LAQ7_BURGS          -------MSSDSASTPRS----GASTMLQILSVVSFTFVCYLTIGLPLAVLPGFVHEELG
A0A0F5K360_9BURK      -------------MPPSS----SLPLTLQILSCTVFTFITYFSIGVPMAVIPGFVHNNLA
A0A0D6MNW3_9PROT      ------------MQAEGT---PVDSPTRRILLVVLFNLLIYIDIGLPMAVIPVFVHRTLL
A0A060QDB3_9PROT      -----------MGAGQAK---ATRSPLGIILPVVSLNLIIYVVIGLPMAVIPLFVHNVLH
K7SI25_GLUOY          ------------MGAEET---PVSSPTKRVLTVVLFNLLVYIVIGLPNAVLTIFVHHTLG
A9HEM1_GLUDA          --------MTSSRPGPAH---PAANPTLRILAVVLFNLICYVDIGLPLAVIPVFVHGTLG
A0A2Z5ZHW8_9PROT      ------------MTDNTP---PASSVVKTILAVVVFTLFCYCVIGLQMAVTPLFVREKLG
C7JH33_ACEP3          ------MNGDNDIEVASD---AAGKTLWSIFAIVVFTLLCYIEIGLQMAVVPLFVKEQLG
A0A0D6MWB3_ACEAC      ------------MTSPSS---RSSSVIARTYPVLLFTLACYTVIGLQMAVVPLFVHRTLG
K5ZLT8_9PROT          -------MTAPKPHPDSL---TKGQRTLRILPVALLNGINYLLIGLPLAVFPSLVHFKLG
Q1LFR8_CUPMC          --MTTPLSPEATPPHGDL---ASGNVTRRILGIVVFNFIAYLSVGLPIAVVPGFVHGDLG
G2J5J9_PSEUL          --MPDNTSATAATPAAPA---TTGSATGPIIAIVFFNLVAYLAVGLPMAMVPGYVHGPLG
B9J7I9_AGRRK          -----------MNTASQT---IQSNSALTLISIVALTFFGYLAIGLPLAVLPTHVDSGLG
B2IB62_BEII9          ----------------MS---PSLIGTLRLVSVVAFTFLGFLAVGLPLAVLPTYVDRNLG
A0A1E4N2A6_9SPHN      ----------------MT---QDS-PARSIFLCAGCTALAYFAVGLPLAVLPGWA-LKLG
A0A0G3EXH1_9BURK      ----------MTAPTAQT---PGISVFGTLASLAAIIFFGFMTIGMPLPVIPVYVNKTLG
Y1993_PSEAE           MSVDIRPTPPAQDSARQNVT-------LQIVSVVMFTFIGYLTIGIPLAVLPGYVHDDLG
C1DLY1_AZOVD          ------MSRTHATAPVRSET-------LQILSIVCFSFLGFMSIGIPMAVMPGLIHHELG
F6AFK5_PSEF1          --------MTARKPQAPGQT-------ARILAVVFFTFIGFLCVGLPLAVLPGFVLNDLG
A0A1E5XAK4_9PSED      --------MSQAAQPTPAVN-------LQIISIVTVTFVSFLCIGLPLAVLPRYVLNDLG
A0A1A9F370_9GAMM      --------MNVSTKPLPA-G-------LSIMSIVCFNFVSYIGNGLPLAVLPGHVLNTLG
A0A0B3BPS5_9PSED      --------MSAVRLRDPA----------QVLALIVFTALIYFCTGLPLAVLPGYVHDSLG
Q88IR4_PSEPK          ----MTAQQPAPASHTLHIT-------LQILSIVFYTFIAFLCIGLPIAVLPSYVHDQLG
M4XCK7_9PSED          --------MSSSEQRTASVT-------LRILATVVFTFILFLSIGLLLPVLPGFVHEGLG
W8R6U6_PSEST          --------MPAAKTPAANDT-------LFILSLVVFNFISFISIGIPLASLPGYVHENLG
A0A172YKP0_9GAMM      ------MTNNKRPDASMTAQSPPRHYKPLVLSIISATFLCYLCVGMSLVVLPLYVSQVLG
N2IRF8_9PSED          --------MNASESVAITLR---------IASIVVFSFLTFLAIGLPLAILPGYVHDTLG
A0A191THH5_9BACT      -----MLGATVSKSDYKSIQ-------LKIINYVLFTFLGYVCIGLPLAILPIFITKNLG
A0A085BDM2_9FLAO      ------MDATIEQS--KNIS-------YSLISYVFFTFIGYFIIGLSLSVLPIFISKGLG
A0A0J0Y6C8_9SPHI      ------MPSESEKSVIENIN-------LTIVSYVAFTFLGYFTIGLTLAVLPQYLHANLA
A0A0M2XZ79_9SPHI      -----------MTITLREVN-------QKILGYVSLTFLGYLTIGLSLATLPIFIHQTLG
F4C5X0_SPHS2          --------------MSQKPS-------FIIANYVLLTFYGYFSIGLTLAVLPIFIHQQLG
A0A088EZ27_9SPHI      ------MLSKSLQKTALDYR-------FQIASYAILTFYGYFTIGLSLAVLPIFIHETLG
                                                              :   *:     .      : 

D8MPY7_ERWBE          YSSFMAGLIISLQYFATLISRPQSGRYADLLGPKKVVLVGLLLCGTSGLF-TLLAVMYES
A0A0J8YVF9_9GAMM      YSPFIAGLIISLQYFSTLISRPQSGRLADHFGPKKVVMLGMVLCGLSGAM-TVIAALSAS
A6T908_KLEP7          YSTFVAGIVISLQYISTLISRPHAGRYTDIWGPKKVVSLGIVCCLLSGAF-TLLAVVLQA
V2TQX3_9GAMM          YSSFIAGGIISIQYLATLLTRPKAGQLADMLGARKVVLMGLGCCGMSGVF-SILAVFCMD
W0HTE3_9GAMM          FSPLIAGIAISVQYFSTLASRPYAGRCADLLGAKKIVLIGLLCCALSGAC-YLLARATSV
YHHS_ECOLI            FSAFWAGLVISLQYFATLLSRPHAGRYADSLGPKKIVVFGLCGCFLSGLG-YLTAGLTAS
H8KYX1_FRAAD          SGAVLAGLVISVQYVATLLSRGFAGRTSDTAGPRYTVQIGLLACGLSAGL-VAVAAELWR
A0A023NW89_9GAMM      LGAVIAGLVISTQYVATLLSRGFAGRTSDTAGPKRAAWIGLLACAVSGLL-MTAAALLRA
D4XDW7_9BURK          YGTVLAGLAISVQYVATLLSRSHAGRMADTVGPKQTVVIGMAACAASGVF-LLLAYAFER
A0A0F3L0U5_9GAMM      YSTVIAGLAVSTQYVATLLSRPYAGRMADAMGPKRAVTAGLIVLALAGLF-LALGALAPG
A4JBX7_BURVG          YSAIVAGAAISVQYFATLASRPLAGRFADTLGPKQTVLRGLIGCGVSGVL-LLVALLLAR
F2LAQ7_BURGS          LSAVIAGAAISVQYLATLASRPLAGRCADTLGPKRTVLRGLLGCGASGAL-LLVALLFAH
A0A0F5K360_9BURK      FSSVIAGLAISIQYIGTFITRPSAGRVVDSIGARRTVQIGMAGCAASGAL-LLLAACLTH
A0A0D6MNW3_9PROT      YSATVAGLAISLQYFATFAFRPSAGQRTDRIGPKPVVVAGLALGVVSGTL-LMLAGFLAA
A0A060QDB3_9PROT      CNTVIAGFAVSLQYFATFASRASAGKRIDTQGPKPVAVLGLALGVFSGLL-LLVAGLGKS
K7SI25_GLUOY          YSTAIAGMAFSLQYLATFAARPSAGRLVDSIGPKPVVLGGLVTCFISGVL-MFGAGWAGE
A9HEM1_GLUDA          YNTVVAGLAVSLQYLATFASRAQAGRFVDGRGAKPAVMIGLATCVAAGVA-LMLAGLLSG
A0A2Z5ZHW8_9PROT      FNSAIAGFAVSVQYLATFATRAGAGHRIDHKGPKYVVLVGLYAGIACGVF-IAVSAYLTH
C7JH33_ACEP3          FSSALAGFAVSVQYLATFVSRIGAGRRIDTRGPKKVVIAGLCLGALSGLL-IMLAPSVAA
A0A0D6MWB3_ACEAC      YSAALAGFAVSAQYLATLATRTWAGNRLDTSGARPVVTIGLIVGALSGVM-LAVSALFAS
K5ZLT8_9PROT          YSAALAGAIISLQYAATLVSRSLAGRISDTRGAKTIVIFGLVFGALNGLC-ILIASF-CH
Q1LFR8_CUPMC          YSAVLAGLAVSIQYLATLLSRPWAGSLCDMKGPKRSVLTGLLLCAGSGLL-MLVAAQFAG
G2J5J9_PSEUL          YGEVVAGFAVSIQYLATLLSRAYAGRLCDNHGPKRSVLSGMALCCASGVC-LWIAGLSGL
B9J7I9_AGRRK          FGVVWAGIAISTQYVATIVSRAQVGRLCDQYGPRRSVFLGFFAYGLCGTL-TLASALVTD
B2IB62_BEII9          LGAFWAGLAVSTLYISTIASRTHIGQMTDRFGPKPAVIIGFLAYVVGGLL-TAASVPTQS
A0A1E4N2A6_9SPHN      FGPVMAGFLISAQYVATVLSRIVVGPMIDRSGPRRAIVLGFVCCLGAGAT-TIAALWITA
A0A0G3EXH1_9BURK      YGSLMVGIAVGIQSVVTLSLRSFAGHTVDTRGAKRAVLTGLCGCATAGVLYRISAAFAEV
Y1993_PSEAE           YGSVLAGLVISLQYLATLLARPYAGRVIDGLGPKRAVLYGMAGSAASGLFMLLSVAIQGW
C1DLY1_AZOVD          FSTLVAGLVIGLQYLVTLLVRPFSCRVIDSAGPRQGVVYGLAGCALGGLLMLLATLWLAL
F6AFK5_PSEF1          YGSVMAGLVISLQYLVTLVSRPITGILIDRIGPKRAVVYGLAGTLGSGVLTLAATSLHEA
A0A1E5XAK4_9PSED      YSAVITGIVIGTQYFSTLLSRPMSGSLADRAGPKQAVLYGLMGCIVSGLLTLLSTSLQSM
A0A1A9F370_9GAMM      FGSTMAGLVIGVQYLTTLLSRPLAGQLADRFGAKRTVMTGLAILTGSGLLTAVAIILPTS
A0A0B3BPS5_9PSED      YSSAVAGLVISAQYLTTLLARPLTSSLCDRLGSRRAVTYGLLACALSGLLTWLAISLDNL
Q88IR4_PSEPK          FGAVIAGVTIGLQYLATLLSRPFAGRVADTLGGKQAIRFGLLGIAGCGVLTLLSAWTLTL
M4XCK7_9PSED          YSTVVAGVVIGLQYIATLVSRPLAGYLTDTCGARRAVLYGLVVLGAGGLLVLASTALASV
W8R6U6_PSEST          FSTAVAGIVIGAQYLTTLLCRPLAGRLADERGAKKTVLIGMASGLASGLLLLISALLESW
A0A172YKP0_9GAMM      QGAVMVGIVISLQFLATLCARPLAGRIADRVGAKQSVVAGLVGCALSGMLVWLSMLLVG-
N2IRF8_9PSED          FGSVMAGLTISIQYIATLFTRPIAGKIADSIGPKKGVIAGLFGCGICGILTFISTLLQDF
A0A191THH5_9BACT      YSALVAGVVISLQYATTFVTRGISGNMIDKYGPKLSVYISMICFMLNGILLYAVYLLRAN
A0A085BDM2_9FLAO      FSMLVAGIVISLQYVMTFLMRAYSGKIIDSKGPKPAVLVSMLSFAFTGLVLIMAYYFKFS
A0A0J0Y6C8_9SPHI      YSTMVAGVVISIQYAATFLFRGFAGKIVDKKGPKPAVLMSMAGFILSGVVLLAVAFLSEY
A0A0M2XZ79_9SPHI      FNTIIAGLVISVQYIATFLLRGYAGKIVDTKGPKISVLRSMLFFALSGLLLLLVFLFRSQ
F4C5X0_SPHS2          FNTVIAGAVISIQYIMTFLMRAYAGHIVDNRGPKPAVIASMICFLLTGILLITSFTLADK
A0A088EZ27_9SPHI      YNTIIAGAVIGSQYIMTFFMRAYAGTIVDKKGPKPAVIISMICFMITGILLWAAFYTSAS
                       .   .*  ..     *.  *       *  * :     .:      .            

D8MPY7_ERWBE          TPLTSLILLAIGRIFLGLGESLTATGSILWGINIVGTVQSARVISWNGVATYLAMAVGAP
A0A0J8YVF9_9GAMM      HPMSSLLLLALGRICLGIGESFSSTGATLWGMNLVGSVHTARVISWNGVATYFAMAVGAP
A6T908_KLEP7          TPMLAIAALLAGRVFLGVGESFTATGATLWGIKTVGAIHTSRVISWNGVATYVAMAVGAP
V2TQX3_9GAMM          KPSLSLILFALGRLCLGAGESFASTGSTLWGMNLVARTETSRVISWNGVATYSAMAFGAP
W0HTE3_9GAMM          DPALSLGCLFAGRLLLGVGESFASTGSMLWGIGAVGQRHTGRVISWNGVATYGAIAIGAP
YHHS_ECOLI            LPVISLLLLCLGRVILGIGQSFAGTGSTLWGVGVVGSLHIGRVISWNGIVTYGAMAMGAP
H8KYX1_FRAAD          LPWVCIGLLLVGRLALGFGESCIGTGCIIWGIGRVGAGQTARVISWSGVATYSALAAGAP
A0A023NW89_9GAMM      WPMASLGTMLLARLALGMGESCVATGCIMWGIGRVGSEHTAKVISWNGIATYGALAVGAP
D4XDW7_9BURK          SAWLSLSAIIVSRLALGFGESWVGTGSATWAIARVGPLHTARVISWNGICTYGGLALGAP
A0A0F3L0U5_9GAMM      MPGLSLALILMSRLGLGFAESWIGTGSITWGIAGIGGEHTARVISWNGIATYGGIALGAP
A4JBX7_BURVG          WPAASLVLLIGSRLVLGVGESLCGTGAILWGIGRVGIAHNAKVISWNGIATYGALALGAP
F2LAQ7_BURGS          WPAVSLVLLVASRLVLGVGESLVGTGAILWGIGRVGVSNNARVISWNGIATYGALAIGAP
A0A0F5K360_9BURK      FPVYSLIAMMIGRLLLGAAESFGSTGATLWGIGRVGQSNNAKVISWNGVATYGALAVGAP
A0A0D6MNW3_9PROT      WPVLSLALLAGSRVILGWAESWTATAVIYWNIRRVGSANTAQAISWNGVCSYGGIALGAP
A0A060QDB3_9PROT      VIPLSLICLFASRLALGWAESWASTAAIVWNIRRAGAANTAQVISWNGITSYGGIALGAT
K7SI25_GLUOY          TPALSLGILLLSRLFLGWAESWAATGVIVWNIRRAGAENTAIAISWNGICSYGGIALGAP
A9HEM1_GLUDA          HAVPSVLLLITSRILMGVGESWTATGAILWNIGRVGAERTAQVISWNGITSYGGIAFGAP
A0A2Z5ZHW8_9PROT      WPVLALLCVLAGRITLGFAESWVATAVIVWNIRRVGAAHTAQVISWNGVCSYGGIALGAP
C7JH33_ACEP3          WPVGALLVVLLGRIFLGVSESWVATGVIVWNIQRVGAAGTARVISWNGVCSYGGIALGAP
A0A0D6MWB3_ACEAC      ESALSLGLLLVGRILLGFSESWVAVGVIIWNMHRAGAENSAAVISWNGVCSYGGIALGAP
K5ZLT8_9PROT          TPLVILLWLGASRLLLGIAESGTGTGCVTWNIGRVGSAATAEVISWNGVSSYGGIAAGAP
Q1LFR8_CUPMC          NDWLALGWLLSSRLMLGAGESLVTTGTIAWGIGSVGARHTAKVISWNGVTTYGALAVGAP
G2J5J9_PSEUL          APVGSLASLIVGRLLLGTGESLVTTGTITWGIARAGSAHTGKVISWNGMTSYGGMAIGAP
B9J7I9_AGRRK          IPAASLSLLLAGRLALGIGESLVSTAAITWAIGLMGSRETVRIISWNGIATYGGIALAAP
B2IB62_BEII9          LPVLSLCLLLAGRLALGIGESAVSTGAISWAMALFGAKETVRIIAWNGIATNASLAAAAP
A0A1E4N2A6_9SPHN      -PMAAMAVMMASRILLGFSESLVSTSAMAWGIMRLGAHQSARMISWNGIATYAAIAGGAP
A0A0G3EXH1_9BURK      HPGTALGVLLAGRATLGFAESLILTGGMSWGIGLLGPAHANKAISWQGVSMYTAIALGAP
Y1993_PSEAE           PA-LSLASLLVGRLVLGAAESLVGSAAIGWGIGRVGAPHTAKVISWNGIASYGAIALGAP
C1DLY1_AZOVD          PA-LSLLILVLSRLVLGMAHSVLGSSAIAWGIGQVGIAGTARVISWNGIASYGAIGLGAP
F6AFK5_PSEF1          SGEIGLGLLLAGRVALGISQALIGTGSITWGIGRVGAENTARVISWNGIASYGAIAIGAP
A0A1E5XAK4_9PSED      PA-LSLGLLLAGRVVLGVAQGLVGTGSISWAIGRFGSDYTAKVISFNGIASYGGIAIGAP
A0A1A9F370_9GAMM      PW-GCLALLMAGRILQGIASALISTPSCSWAIGLHGPSRTAQVMSWNGIAAYGGTAIGAP
A0A0B3BPS5_9PSED      PI-VTLGALLLGRVLLGAAQGLMGTGALSWAIARAGVEHTARVISWNGVAVYGAIAIGAP
Q88IR4_PSEPK          PL-LSLALLLGGRLLLGIAQGLIGVATLSWGISQVGPVHTARVISWNGIASYGAIAIGAP
M4XCK7_9PSED          AW-LSLVLLLGSRLLFGLAQGLLGIGTASWGIALVGTQNTARVISWNGIVSYGGIAIGAP
W8R6U6_PSEST          PM-AGISVMLMSRLILGFAQSLIGISAITWGISRLGPESTARMISWNGVAAYGGVGIGAP
A0A172YKP0_9GAMM      HA-ASIVLLLIGRVVLGFSQGLIGTGTLSWTIGIAGSRRMGKVISWNGIAAYGSMAVGAP
N2IRF8_9PSED          QV-ASLVLLIIGRVFLGCAQALIGTGSLSWGMGSVGMQHVSKVISWNGIAAYGALAIGAP
A0A191THH5_9BACT      PS-LSLITLVVVRLITGCGEGFIGASPIAWAMMIVGQKHTATVISYNGIASYGALAVGAP
A0A085BDM2_9FLAO      PI-VSLSFLIITRLFTGCAEGMIGASPINWAIMAFGEKHTANIISYNGVACYGALALGAS
A0A0J0Y6C8_9SPHI      RM-LSLILLVIMRLVTGFAEGLVGASPINWAILKVGPAHTARAISYNGIGNYGALAAGAP
A0A0M2XZ79_9SPHI      PL-LSLGLLLITRLFTGIGEGLVGASPINWALMELGDEHAAKAISFNGIASYGALAIGAP
F4C5X0_SPHS2          PL-LSLSILIISRLVTGCGEGMVGASPVNWAMLRTGEKHTATAISYNGIANYSSMAIGAP
A0A088EZ27_9SPHI      PL-LSISLLALSRLLTGCGEGMVGASPVNWAILRVGDQHTSTAISYNGIFNYSSMAIGAP
                           :  .   *   * . .        * :   .       :::.*:    . . .*.

D8MPY7_ERWBE          LGVILNSM------FGIPGFAVLIMLMAIFGFWLATRRPAVVVAV----GQRIPFNQVFS
A0A0J8YVF9_9GAMM      FGVMLNQW------FGISGFAGLITLMGVIGFLIARHKASITISLT---APRLPFRQVLG
A6T908_KLEP7          LGVTLNHY------FGISGFATVVVLVAAIGLLFARTRQDVKVTA----GARAPFHAVVR
V2TQX3_9GAMM          LGVYLNNH------FSTYAFAATTLLLAVIGFVLAYRKPTVRVKV----DTKIAFLKVAS
W0HTE3_9GAMM          LGVFLNSL------GGLALAGGFILLAGVCAWGVALRRPAVSVST----GKRIPFTAVVG
YHHS_ECOLI            LGVVFYHW------GGLQALALIIMGVALVAILLAIPRPTVKASK----GKPLPFRAVLG
H8KYX1_FRAAD          LGVLIQRQ------AGMSMIGVIGLVVMALAFWQARRQSDVHVIA----GERMPMSHVFG
A0A023NW89_9GAMM      LGVVLVSI------GGFVMIGVSAVALMLLALLLAWRRPAVRVEA----GERLPLHRVFG
D4XDW7_9BURK          LGVTLERE------WSMGALGGAVLLLGLAGLGLAVSRAAVAIVG----GHRMAFKSVVL
A0A0F3L0U5_9GAMM      LGVVLTHH------YGIIALGVVGFALGAIALPLALLKAHVPPTH----GERLPFKSVLS
A4JBX7_BURVG          VGVAIAHA------LNPALIGVLVIALAAAGFYLARLIDAVPLVH----GERMSYASVFT
F2LAQ7_BURGS          LGVAIAHT------LNAALLGVLMVALAALGYWFALRLAPVPVVH----GERMSYASVFT
A0A0F5K360_9BURK      LGVLLDGA------AGLWALGVLITAVAVGGYFLAQRTPDAAVIV----GERMSFFSVFT
A0A0D6MNW3_9PROT      VGELLSHL--SHPFGGVTTVGLLSLLLPAFGLSVIWAYDNVQPTVSKR--PLMKFTDVFK
A0A060QDB3_9PROT      IGEQLSHL--GGGWGGLVSLGVLSTLLPAIGTALASTYPAVAPIRHDA--PAMSFAKVFR
K7SI25_GLUOY          IGAKLSLL--PHPYGGIVSVGILSAILPLIGLALIGFYKGVKPVATTE--KPIPFSRALR
A9HEM1_GLUDA          VGALLSQL--APPMGGLAGVGLLSAVLPAAGLVLATRYAPVPPMT-KG--ETMPFSQVFW
A0A2Z5ZHW8_9PROT      IATVLYQAGGTSVLTGFSGVGLLCAALMAIGLPLALKQPAVAPLPAS---QPVSFMQTLN
C7JH33_ACEP3          IAMMIYQS--HAALGGFGGIGLCCMLMLLLGVPWAWRQVAVKPLSPAT-GKRHSFMTVFG
A0A0D6MWB3_ACEAC      IAAMIFSS--HAMFGGLVGVGLLSTLLFAVCIPHALRQQTTRPAPQTG--PKPGFATIFR
K5ZLT8_9PROT          LGVLLAGW------GGLHLLGAVAVVLPLVGLYFTGRIPAVPPLVGAV---RMSAWRVVR
Q1LFR8_CUPMC          VGVLLAGH------GGLTAIGIVTSVIAGASWLLARRQAAVPILKGER----LPFRSVFR
G2J5J9_PSEUL          LGVVLAER------WGFGALGLTTVAMTLASWFLAWRKPAVAPSSGER----LPFSQVFR
B9J7I9_AGRRK          FGAWLEGQ------YGFVAIGAVTIGLAIAGLMLAQTRPPVPGIKEKG----IGTGQVLG
B2IB62_BEII9          IGAWIASR------YGFVAIGLVTVAVALLGLILGLARPTVEIKVGAG----MGAGHVFK
A0A1E4N2A6_9SPHN      AGVWIFEL------GGVTALGLALLLLGAGGLAFVWPQPAARVPAAQR----WPMRTVFG
A0A0G3EXH1_9BURK      AGATLLQQ------WGFTAVAYVVIALPLVAGLLPWRLPAAAITNGKR----LPFHKVVG
Y1993_PSEAE           LGVLLVQW------LGLWSMGASIVLLGALGFALAWPKLPAPLVHGE----RLPFHHVLG
C1DLY1_AZOVD          FGVWLVER------FGLPGMGASVLLIALFGLAMAWRKAGVPVVAGE----RLGFLEVLG
F6AFK5_PSEF1          LGVLMAST------MGLWSIGAAITLLSLGALWVAQDKPAIPVIQGK----RLPFHNVFL
A0A1E5XAK4_9PSED      LGVAMVSA------VGLWSIGALTMLLSAVALAFAWPKQPAPILSGS----RMPFARVFL
A0A1A9F370_9GAMM      LGVLIRDH------LGLAGIGVCITLLGFMPLLFARTRRPAPLLPGV----RLPFRSVFM
A0A0B3BPS5_9PSED      LGMALAER------FGVGSLGAVTLALALGGLLLIRRQATLPVSSEA----RLPFRRVFG
Q88IR4_PSEPK          VGVLAVDG------LDFSVLGPALLVLATLALLVLRKRPDVVVVRGE----RLPFWSAFG
M4XCK7_9PSED          LGVSMSAS------LGLWSLGMSILLLTALGLLAARGREEVPIIPGA----RMAFHAVLG
W8R6U6_PSEST          LGVFLEQS------LGLWSLGVVTMLLAATGLALAWRRGDAPLNPGE----RLPFGKVLW
A0A172YKP0_9GAMM      LGMSLVGL------FGYWSLGVATTLATGLGALFVCRLKAAPLVPGK----RLSFLSVFA
N2IRF8_9PSED          LGVAMVSS------LGLWSLGVSIVLLAAIGLALAWNKEPAPVIPGE----RLPFLRVFW
A0A191THH5_9BACT      LGVLLNEQ------FGLNAVSILILLIAVFGFFLATKKEKIVSAKQDNNASHVPFFSVLR
A0A085BDM2_9FLAO      LGVTIVKH------FNFYGLGILIVILGILGFFLANTKENKTGELSE--GEPTSFWKVLS
A0A0J0Y6C8_9SPHI      LGVLISSA------FGIEYIAIFIILIGIAGLAYANSKLNIIGMSKE---APQSFLHVLK
A0A0M2XZ79_9SPHI      LGVLLVDH------INYEALALLTSAIGLLGYFYCRAKTPYQVAGKK--AEKVSFKRVLL
F4C5X0_SPHS2          LGVWMAGY------VGNWSLGALTIATAIIGLLTAVRKPALKGDQDTP---RKPFLKVLC
A0A088EZ27_9SPHI      LGVILSQQ------FGNWTIAALTLFIGSVGLASTLNKKALSSVSKEI---RNSFFTVLK
                       .             .    .                                       

D8MPY7_ERWBE          RIWVYGLCLGLGTVGFGTIATFITLYFASHDWSGAAFSLTLFSLGFIAMRLVFSSYIGRF
A0A0J8YVF9_9GAMM      LVSPYGMGLALGTLGFGVIATFITLYFSSLGWQGAAMTLSLYSLGFVLSRFLFSHMITRF
A6T908_KLEP7          KIWPYGLGLAFGTVGFGVIATFITLYFAAHSWQGAAFTLSLFSVGFICVRLVLGNTITRF
V2TQX3_9GAMM          KVWVFGAALALGTVGFGVISTFITLYFDERHWPNAAYALSVFSIGFVFIRLIFGKMIPKF
W0HTE3_9GAMM          KVWLFGLVLGLGTLGFGVIVSFITLYYADRGWQGAAFALTLMSCAFVGVRLVLGNVISRF
YHHS_ECOLI            RVWLYGMALALASAGFGVIATFITLFYDAKGWDGAAFALTLFSCAFVGTRLLFPNGINRI
H8KYX1_FRAAD          RVLPYGIGLALGAIGFGVIATFITLYYAWLHWSGAALTLSVFGLTFVGIRLLFGPSIARY
A0A023NW89_9GAMM      RVAPYGMGLALGSVGFGVIATFITLYYASQGWAGAALTLSAFGVCFVGIRLLLGWTIAHF
D4XDW7_9BURK          RVFPHGMALGLGSVGFGTLAAFVALYYTSMSWEGAAHALSAFGCAFIGVRLLFAGTITRF
A0A0F3L0U5_9GAMM      RVYAYGAGLALGSIGFGCLSTFVALYYASRGWEGAALSLSVFGSCFIGVRLVFGNAINRF
A4JBX7_BURVG          RVLPHGLGLALGSAGFGSIATFVTLYYAARHWPNAALSLTVFGTLFIGARLLFANMIKTY
F2LAQ7_BURGS          RVLPHGIGLALGSAGFGSISTFIALYYAARHWPNAALSLTVFGLLFIGSRLLFANTIKNY
A0A0F5K360_9BURK      RVVPHGMGLALGSAGFGSLSTFITLYYATQRWPHAELTLSVFGIMFVGSRLLFSNLIKTH
A0A0D6MNW3_9PROT      RVFPHGAALALGSIGFGAISSYLALYYAAMRWGGAADALAAFGAVFVLVRFVLSRQIGRF
A0A060QDB3_9PROT      LVLPHGCALAAGSVGFGAISSCLALYFAAEHWPDAAQALAVFGMVFVIVRFVFARQIGRI
K7SI25_GLUOY          LVLPHGMALAAGSIGFGAISSFLALYYAVLHWEGAATALSVFGIVFVVIRFFFASQIARR
A9HEM1_GLUDA          RVLPYGIVLACGSVGFGAISACLSLYFADRHWDGAALALMMFGVVFVMVRLLFSRQIGLR
A0A2Z5ZHW8_9PROT      KVWPFGMALAAGSVGFGAISALLTLYFSDQHWGGAALALTLFGTVFVLTRFGFTRQIMRR
C7JH33_ACEP3          QVAPYGMALAAGSIGFGAISSLLTLYFADQNWNGAATALSIFGCVFVLTRFGFTTQITKR
A0A0D6MWB3_ACEAC      AIMPYGCALGAGSVGFGAIVSCLTLYFNDRNWSGAAIALAVFGGFFVLTRFVFSSTIRKI
K5ZLT8_9PROT          QMTPYGLALAGGSFGFGIIVAFMALYYVAHGWEGASLALTAFGVSFVLVRIVLAGAIGRF
Q1LFR8_CUPMC          AMSPFGLCLGLGSVGFGAITAFITLYYAGHGWDHAALALTALGTCFVLTRLIMADSITRF
G2J5J9_PSEUL          RMVPFGLCLALGSVGFGAISTFVTLFFASRHWPDAALALTLLGVFFIAARLLFAGSINRF
B9J7I9_AGRRK          RILPYGVALALASSGFGVVMAFVALFFHNRGWDGASLALSAFGLAFMGIRLGLAQAVARF
B2IB62_BEII9          IIAPYGFTLALAGAGFGVIMTFIVLYFESRDWPHAPLALTTFSVAFMSLRFFLARAVTRF
A0A1E4N2A6_9SPHN      AVLPFGAALAMATVGFGVITSFVTLYFNAFGWGDAWMALTAFGCAFIASRLLFVRSVARH
A0A0G3EXH1_9BURK      RVWRPGLAMTLGSIGYAVIAAFIMLFYASRHWDGAAYALTAYSVTFIGVRVLLGHSVERF
Y1993_PSEAE           RVTPHGMGLALGAIGFGTIATFITLYYASRGWANAVLCLSAFGGCFIGARLLFANSINRL
C1DLY1_AZOVD          RVSPHGLAMALGTLGYGTIAAFITLYYGSRGWAWAEYAMTAFGLSFIAARLLFAQAIDRL
F6AFK5_PSEF1          AIAPNGLALALGSIGFGTLATFVTLYYASLGWEHAAYCLTAFGLAFIAARLLFAGAIERR
A0A1E5XAK4_9PSED      SIAPHGTVLALGSIGFGTLATFITLYYDSLGWVDAEYCLTAFGIAFIVSRLLFAGVIKRF
A0A1A9F370_9GAMM      AVLPNGLAVACSSAGFGSLTAFIALYFDSLGWDNAAYCLSAFGVAFILTRLASPNALPRF
A0A0B3BPS5_9PSED      RVLPGGLTLALGTLGYGTLSTFVALYFTSRGWDGAGYALSAFGAAFIGARLVFSGTIGRW
Q88IR4_PSEPK          RVAPCGLGLTLASIGYGTLTTFVTLYYLERGWAGAAWCLSAFGVCFIISRLLFVNAVNRF
M4XCK7_9PSED          RVLPYGMCVMLGSIGFGTLATFITLYYGSQGWANPAWCLTAFGVCFIGARLLFSGMVNRF
W8R6U6_PSEST          KVAPPGLSLSLATIGYGTLTAFIALYYSSRGWEGAAWCLTAFAFAFIGTRLLFPNLINRV
A0A172YKP0_9GAMM      RIAPYGLALGLSNIGFGVIATFITLYYASQGWEHAAWGLTAFSLAFVAARLLLAGVIERF
N2IRF8_9PSED          RISPYGLGLLLSSIGFGTIATFITLYYGSHGWPNAAYSLTAFGAAFICARLLFAGTVNRF
A0A191THH5_9BACT      KVAPYGICLMLAGLGFGTISNFITLYYDHFHWANAALCLSVFSILFIVGRLFFSNAINQH
A0A085BDM2_9FLAO      KVAPYGLGLALGGLGFASISTFITLYYDYYHWQNGAMCLSVFGILFVAGRLVFSNAINRF
A0A0J0Y6C8_9SPHI      KVTPYGLCLAAGGIGFGAISTFITIYYSYLHWAGAVFCLSIFSVMFVLGRLIFARAIDQY
A0A0M2XZ79_9SPHI      LVAPFGICLALGGLGFGSISTFMTLYYEHFNWENGAACLTLFGVFFILTRLIFNKVIDQY
F4C5X0_SPHS2          TVSPYGSGLALAGMGFGTLSTFITLYYAFNRWNQAAICITAFSLFFVLGRLLFAKSINRF
A0A088EZ27_9SPHI      AVSPFGMGLALAGIGFGTISTFITLYYNYKGWDNAALCITCFSTMFVLGRFVLTNSINKI
                       :   *  :  .  *:. :   : :::    *      :   .  *:  *.     :   

D8MPY7_ERWBE          GGIRVSLVSFAIECIGLVMIWKGGSVLMVDAGAFLTGSGFSLIFPALGVEAIRQVAPQNQ
A0A0J8YVF9_9GAMM      GGLAVSLGCLITEAIGLFMLWHAESVLWADIGALLTGAGFSLVFPALGVEAVRRVSEQSK
A6T908_KLEP7          GGVPVSLACFIIESLGLLLIWLAPSAWMAGVGAFLTGSGFSLVFPALGVEAVKQVEEQNQ
V2TQX3_9GAMM          GGIKVSLCSFVIEALGLLLIWGSTYIGMAYVGAFLVGAGFSLVFPSLGVEAVKQVEAQNR
W0HTE3_9GAMM          GGRRVALLSFVVESAGLVLLWAAPTAAIAGLGALLTGAGFSLVFPALGVEAMKQVPAQNQ
YHHS_ECOLI            GGLNVAMICFSVEIIGLLLVGVATMPWMAKIGVLLAGAGFSLVFPALGVVAVKAVPQQNQ
H8KYX1_FRAAD          GGYRVAMLSFLVEGLGLAILALGTHPAWSILGTALTGMGFSLVFPSLGVEAVNRVDGSNR
A0A023NW89_9GAMM      GGYRVALASLLVEAAGLFVLATASHVGVAMLGASLCGIGFSLVFPALGVVAVERVSVSNR
D4XDW7_9BURK          GGFRVAQVSFLVEAAGLLLLWLAPNPTAALLGAALTGCGFALVFPAIGVEAVARVPAGSR
A0A0F3L0U5_9GAMM      GGYRVAIASLVVECLGLLLMWFGTTPHLALAGAALTGSGFALVFPALGVEAVSRVSNHNR
A4JBX7_BURVG          GGFRVAIVSFAFESSGLLLLWLAPVPHVALVGAALTGFGFALIFPALGVEAVALVPPASR
F2LAQ7_BURGS          GGFRVAIVSFVVECLGLLLLWLAPVPHVALAGAALTGFGFALIFPALGVEAVALVPPASR
A0A0F5K360_9BURK      GGFRVAIVSFAVEAVGLLLVWLAWSPHVALIGAGLAGMGFSLIFPALAVEAVALVPPASR
A0A0D6MNW3_9PROT      GGTRVAVVSLVVEAVGLMMLWRSGSSTAAAMGAAITGAGFSLVFPALGVLAVDRAGPENR
A0A060QDB3_9PROT      GGTNVALISLGVETLGLLILAFLPSAEAATLGAAVTGAGFSLVFPALGVLAVDRAGAENR
K7SI25_GLUOY          GGVFVAIVSLLIEAAGLACLAIFTSQGAALIGAALTGAGFSLLFPALGVLAVNSAGPQNR
A9HEM1_GLUDA          GGRTVAIVSLLVEVAGLLILWRSSGVPAADLGAALTGAGFSLVFPALGVEAVTRAGPQNR
A0A2Z5ZHW8_9PROT      GGVNVAFISLFVEALGLMVLAYAPTAFWACVGAALSGAGFSLLFPALGVGAVERVGPENR
C7JH33_ACEP3          GGTIVALVSLLVESLGLCVLAMGHSPIWANIGAALTGAGFSLLFPALGVGAVARTKPENK
A0A0D6MWB3_ACEAC      GGERVALISMGVETLGLLIIAGGPSPILANIGAALTGVGFSLVFPALGVLAIERLGAENR
K5ZLT8_9PROT          GGFRAALVSFMVEAAGLALIWLAPAPLIALLGASLAGFGFSLVFPALAVEALHPVAAGSR
Q1LFR8_CUPMC          GGYPVALVSFAVEAAGLAMLWLAQAPWQALAGAAVVGFGFSLVFPSLGIEAVKRVPATNR
G2J5J9_PSEUL          GGFPVALVSLVVEASGLLLLWLAAAPWQAFAGAALTGFGFALVFPSLGMEAVRRVPSGNR
B9J7I9_AGRRK          GGLPLARISLVLEIVGLLTIALASTPTVAIIGAALAGAGFAPVFPALGNEAMARIPPQNR
B2IB62_BEII9          GGVPVARVALFLELGGFILLIVAAGPAMAILGTALAGFGYAAIFPSLGGEAIGRAPPQNR
A0A1E4N2A6_9SPHN      GGLSVSAVFIAIELAGLAIMASAPSAHLAIAGAAVTGFGFAMVFPALGVPVIERVPEQSR
A0A0G3EXH1_9BURK      GGIRVAVLSLLIEAVGQTLLWTATSSLMALAGAALTGVGFSLVFPSLGVEAIKHVPSQNR
Y1993_PSEAE           GGFRVAIICLGVESLGLLLLWSAPNPWVGLAGAALTGFGFSLVFPAFGVEAVNLVPASNR
C1DLY1_AZOVD          GGYRVGIASLLVEACGLLLIWAAPGPLLAMLGAGLSGFGFSLVFPALGVEAVKSAPASNR
F6AFK5_PSEF1          GGYRVATICLAIETLGLLLLWIAPIPALALCGAALTGFGLSLVYPALGVEAIGNIPAASR
A0A1E5XAK4_9PSED      GGYPVAVVCLAIEFFGLMLLAFGNAPSVMLAGAALTGLGLSLVYPALGVEAIALIPAASR
A0A1A9F370_9GAMM      GAYRVVRVCMAVQTLGLLLVWLAPSPLVAILGSALTGLGVSWVYPGLAVETLARTPEANR
A0A0B3BPS5_9PSED      GGYRVALACLGVELLGLLLIWLAPGPVLVFAGAALTGLGLSLLYPALAVEVIQQVPASSR
Q88IR4_PSEPK          GGYNVAVACMATEVLGLSLLWLAPSPPWALVGAGLTGFGLSLVYPALGVEAIKQVPSSSR
M4XCK7_9PSED          GGFVVAVVCLAVETGGLLLLWLAPGPGFALLGAALTGCGLSLVYPSLGVEAVLRIPASSR
W8R6U6_PSEST          GGYSVAMVCLVVEILGLTMLWLAEAPGMALAGSALTGCGLSLLYPALGVGVVSRVGAVNR
A0A172YKP0_9GAMM      GGYRVAVACCATEGLGMVLLWLAPSAGWALGGALLAGFGVSLIYPALGVVAVKNVPESNR
N2IRF8_9PSED          GGYPVAIACFIVETLGLLLLWLAVSPGMAMAGAALAGFGLSLVYPALGVEAIVKVPATNR
A0A191THH5_9BACT      GGIKVALACLICETVGLFLLAIIHHPYFALLGASVTGFGFSLVFPALGVEAVKLFSAERS
A0A085BDM2_9FLAO      GGINVAIVCLAVETLGLTIISLSYHPYFALIGAGITGLGFSLIFPALGVMAMKTVPSYNQ
A0A0J0Y6C8_9SPHI      GGMKTAIACLSMEVVGLGIIALSVNPTFTFIGAGIAGLGFSLVFPALGVEAVRLVPASSQ
A0A0M2XZ79_9SPHI      GGLKVALVSLFVETVGLTVIAVAIDPLWTLLGAALTGFGFSLVFPALGVEAIKRVDQSQQ
F4C5X0_SPHS2          GGLRVAIVSMAVESMGLLILWLATNPHIAVLGASFTGLGFSLIFPALGVEAVSRASASNK
A0A088EZ27_9SPHI      GGIKIALFCMVIESFGLLLISFAPSPFLTIIGAAITGLGFSMVFPALGVEAVNSASAANK
                      *.          :  *   :           *  . * * : ::*.:.  .:        

D8MPY7_ERWBE          GSALGLYSAFLDFGLGITGPIAGLLIGHWGVDSIYLGAAVVVLFAFALTLRLQLITQRET
A0A0J8YVF9_9GAMM      GSALGTYSAFLDLALGLTGPVAGLLMNHSGIRSIYLAAAVMVCLGALLVGTLLVKSRRRL
A6T908_KLEP7          GTALGTYSAFLDLALGLTGPLAGWVAGFYDLATLYLLAAIVVALAFLLIFRVHR--QQRL
V2TQX3_9GAMM          GSALGVYNAFLDIALMFIGPLAGLLIPLIGMQNLYGVAGVITVFAVILMYFLNKNAQKQI
W0HTE3_9GAMM          GTALGTYCAFLDLALGVAGPAAGLVMSHLGMSWIYLAAALMAVLAALLTRRLKQAAQIP-
YHHS_ECOLI            GAALATYTVFMDLSLGVTGPLAGLVMSWAGVPVIYLAAAGLVAIALLLTWRLKKRPPEHV
H8KYX1_FRAAD          GAALAAYSVFVDVALGVAGPVGGLLADHQRYHDLFGIASILAMAALALTWQLSRRFAEAV
A0A023NW89_9GAMM      GAALAAYSVFIDVALGVTGPLGGWIASGGRYGPMFVVAAALSLVASVLTGVLYVGYGSRV
D4XDW7_9BURK          GAALGAYSAFLDLALGVTGPVAGYISSGYGYPSIFLSAALAVVIGFVIAFGL-QRHASA-
A0A0F3L0U5_9GAMM      GAALGAYSVFLDVALGLTGPVGGWVAGRYDYPAIFLLASGATLAAAVLSFSLYSRHGRAP
A4JBX7_BURVG          GAALSAYSVFLDLSLGITGPLAGYIAGAFGYPQVFLFAAAAAAAGVALSMVLYQRQARV-
F2LAQ7_BURGS          GAALSAYSVFLDLSLGVTGPLAGYVAGEFGYPQVFLFAAVASAAGVALSILLYQRQARPG
A0A0F5K360_9BURK      GAALSAYSVFLDVAFCITGPIAGLISTHLGYAAIYLFAGLAAIGGGMLCASLHKGLGDGP
A0A0D6MNW3_9PROT      GAALGAFSVFLDLAIGFSGPALGLVAEYGGYPPLFLLAGACSVGGAIVSQALGRPAARRR
A0A060QDB3_9PROT      GAALGAFSVFLDLAIGVSGPLLGLVIHSAGYMALFIFTACITFLGIVQVLRLQRAARP--
K7SI25_GLUOY          GAALGAYSIFIDLAIACSGLVLGQVIEFAGYKTMFGTTAVCCLVGVLISRSLRGKPAV--
A9HEM1_GLUDA          GAALGVFSVFLDIGIGISGPMLGLVINSLGYGPMFLASALFTGAGVGATVLLRGGARRGT
A0A2Z5ZHW8_9PROT      GAAIGAFCVFLDIAIGVSGPLLGLIIPLWGYGVLFGITALCAIIGMAMCYALNTQKGLKT
C7JH33_ACEP3          GIAVGAFSVFLDIALGLSGPVLGFIIPFWGYQGLFLTTALMSLIGVGICALVYRKENGSS
A0A0D6MWB3_ACEAC      GVALGGFSVFLDLAIGASGPGLGMIIPIWGFPTLFVVAAAFCAIGFFLTFTLPKNSHAAS
K5ZLT8_9PROT          GAAIGIYTVFMDIAMGLTGPLAGLVAAQLGYPTVFLLGLLIVLGALTLTWKLRQAVLMKG
Q1LFR8_CUPMC          GSALGAYALFFDFSLGLTGPVAGLITKHAGYPAVYLFAALAAVLALVLSQVLAARYRDRL
G2J5J9_PSEUL          GAALGAYALFLDLALGVTGPLTGVVANRLGYASVFLLAALAVALAAILSSLLHSMAGKGT
B9J7I9_AGRRK          GVALGLYSMFLDVALGGTGPIAGILADHFGYTAPFLLGGGAVLLSLAICFWL--RKTSNA
B2IB62_BEII9          GVALGLYSMFQDVSLGATGPAAGILATHYGYASPFYLGIMAIALGLVVSFGLDPRKSTQA
A0A1E4N2A6_9SPHN      GTALSTFALFIDVALCLTGPLAGALAQHATYAAPFGGAAIGAGLALGMVALLMLRPKPAL
A0A0G3EXH1_9BURK      GAALAAYSGFFDLGLGLIGPLAGLVVGAFGYAAIFLFGALGAIGGAILTSRLARANRSAE
Y1993_PSEAE           GAALGAYSLFVDLSLGITGPLVGFVANLFGFRSMFLFACLASLGGLALAVALHRRS-RRP
C1DLY1_AZOVD          GAAIGAYSLFLDLALGVAGPLIGLLIGSHGFRPIFLVCALASFCGLGLTLALQQRSFRQP
F6AFK5_PSEF1          SSALGAYALFFDLALGIAGPLMGLIATAYDYGAVFLASGLLSLLGLGLSLLLLRRAERPK
A0A1E5XAK4_9PSED      SSALGAYTLFFDLSLGLAGPLMGYVAAHANYSTTFLVAALLAATGTLACIYRVYRARY--
A0A1A9F370_9GAMM      NSALSTLSLFFDLAVGLAGPVMGLVVAGFGLAQVFFCSALLSAMGCALVLSLHWRQPAAQ
A0A0B3BPS5_9PSED      SSALGAFALFFDLALGLAGPLMGLLVPLSGLAGLFGVSALLAVIGLGMGVRLLQGARG--
Q88IR4_PSEPK          GAGLGAYAVFFDMALAIAGPVMGAVAVHLGYASIFCVAALLALAGVGLTLWLARRARRS-
M4XCK7_9PSED          SAGLGAYALFFDLAMGVAGPLMGLVAARHGYAAIFLVAAGLATCGFVICLGLLRWTRQRH
W8R6U6_PSEST          SSGLSVFAMFFDLALGLSGAIMGALAVYIGMQNIFLGAAAIAVAGLAIVWGLLKQERKAE
A0A172YKP0_9GAMM      SAALGAYSLCLDLSIGLTGPLAGAVAGGFGYAIIYGLAALAAYLAVALVLVLFRRSLARA
N2IRF8_9PSED          SAALGAYSLCLDMSLGITGPVAGSIANAFGFNSIYLFAAIMSLAGLLLCLYLFKQAQRAM
A0A191THH5_9BACT      GAALAAYGLFIDISLGITGPLIGGVIEGFGIASMFTFCTGIVFIGLLLCASLNKKAAKVL
A0A085BDM2_9FLAO      GSALAGYGLFIDISLGITGPLIGGVADTFGLNYIFPFSIGIVMIGLGLVFYMKMKLSE--
A0A0J0Y6C8_9SPHI      GSALGNYGLFIDLSLGITGPLLGAISTGFGMNYLFPFSLGVVVLGLILASAILYKRQRLQ
A0A0M2XZ79_9SPHI      GSALAAYGLFIDISLGITGPLIGFVANNRGMTAIYPFSTMMVCIGFAVVGNLLYQKQREL
F4C5X0_SPHS2          GSALGAYGLFIDISLGVTGPLIGLVAKGLGMNYIFPFSMAMVLIGLVTCVILKENTGREI
A0A088EZ27_9SPHI      GAALGAYGLFIDISLGISGPLVGLIAKQFGMNFIFPFSLLLVLSGVVVCFLLIRSKRNSV
                      . .:.      *...   *   * :         :         .               

D8MPY7_ERWBE          VTT----------
A0A0J8YVF9_9GAMM      IESGQ--------
A6T908_KLEP7          VARE---------
V2TQX3_9GAMM          -------------
W0HTE3_9GAMM          -------------
YHHS_ECOLI            PEAASSS------
H8KYX1_FRAAD          LTV----------
A0A023NW89_9GAMM      RG-----------
D4XDW7_9BURK          ---QAGAH-----
A0A0F3L0U5_9GAMM      RPETANARA----
A4JBX7_BURVG          AGSGAAA------
F2LAQ7_BURGS          ARTGATA------
A0A0F5K360_9BURK      LRKSRGA------
A0A0D6MNW3_9PROT      -------------
A0A060QDB3_9PROT      -------------
K7SI25_GLUOY          -------------
A9HEM1_GLUDA          P------------
A0A2Z5ZHW8_9PROT      -------------
C7JH33_ACEP3          ISP----------
A0A0D6MWB3_ACEAC      A------------
K5ZLT8_9PROT          IG-----------
Q1LFR8_CUPMC          APAT---------
G2J5J9_PSEUL          AAPAA--------
B9J7I9_AGRRK          -------------
B2IB62_BEII9          -------------
A0A1E4N2A6_9SPHN      -------------
A0A0G3EXH1_9BURK      QANA---------
Y1993_PSEAE           G------------
C1DLY1_AZOVD          AEAEEAAATAELE
F6AFK5_PSEF1          AVQP---------
A0A1E5XAK4_9PSED      -------------
A0A1A9F370_9GAMM      SAETLKTPG----
A0A0B3BPS5_9PSED      -------------
Q88IR4_PSEPK          -------------
M4XCK7_9PSED          EELPQE-------
W8R6U6_PSEST          G------------
A0A172YKP0_9GAMM      AEVEQRAGRADG-
N2IRF8_9PSED          ETPNARQDRPS--
A0A191THH5_9BACT      AA-----------
A0A085BDM2_9FLAO      -------------
A0A0J0Y6C8_9SPHI      VAN----------
A0A0M2XZ79_9SPHI      TP-----------
F4C5X0_SPHS2          DTAMDLTTDNP--
A0A088EZ27_9SPHI      KKITTFV------