CLUSTAL format seed alignment for MF_01123

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ACSA_THET8       -------------------MDRLESVLKEERVFYPSEEFRKQAHIKSEEEYQRLYEESVR
ACSA_THET2       -------------------MDRLESVLKEERVFYPSEEFRKQAHIKSEEEYQRLYEESVR
ACSA_SYNY3       ------------------MSDTIESILQEERLFDPPTEFSERAYVRSGREYEQLYSRAAS
ACSA_THEEB       -----------------MSHPTIESILQENRLFYPPDDFVAKARIHSLEAYNALYEKAKA
ACSA_DEIRA       ---------------MTHPNDHIDAMLHETRVIHPSAEFQAGTRV-SRAEYERRYRQSLD
ACSA_CHLTE       ----MATEQTKGQ-----SSESISSVLSERRKFPPPEAFSSQSHISSMEQYEKLYADAAA
ACSA_RHOBA       MPTASASESSSNQPESSNASGSIDHVLVEDRLFHPSAEFTSKAVISTEEQYEKLATAARE
ACSA_LEPIC       -------------------MPNSEEVMAKERVVSPSAEFKKNANISL-KNYKSLYKESIE
ACSA_LEPIN       -------------------MPNSEEVMAKERVVSPSAEFKKNANISL-KNYKSLYKESIE
ACSA_LEPBL       --------------------------MAKERIVLPSAEFKKNSNITL-KDYKSLYKESIE
ACSA_LEPBJ       --------------------------MAKERIVLPSAEFKKNSNITL-KDYKSLYKESIE
ACSA_XANC8       ----------------------------MADVYPVDPAFAADARITR-EQYATLYRESIE
ACSA_XANCP       ----------------------------MADVYPVDPAFAADARITR-EQYATLYRESIE
ACSA_XANOM       ----------------------------MADVYPVDPAFAADARVTR-EQYAALYRESIE
ACSA_XANAC       ----------------------------MADVYPVDPAFAADARVTR-EQYAALYRESIQ
ACSA_XYLFA       ----------------------------MSDLYTIDPMLAKDAHVDR-AHYKTLYHESLE
ACSA_XYLFT       ----------------------------MSDLYTIDPMLAKDAHIDR-AHYKTLYHESIE
ACSA_BDEBA       ---------------------------MHKELYPVNSEVAKKAWIDE-AKYKAMYERSIQ
ACSA_NOVAD       ---------------------------MGEAVYPVPAEWAQNALVDE-ARYQDMYRQSVD
ACSA_CAUVC       -------------------------MVSDGQVFPVPADLARDAHIDA-AAYDAALARVEA
ACSA_BRADU       ---------------------------MSEKIYDVPAEWAKRAWVDQ-AKYKEMYARSIS
ACSA_BRASO       ---------------------------MSEKIYDVPAEWAKRAFVDD-AKYQEMYASSIR
ACSA_RHOP5       ---------------------------MSEKIYDVPAEWAKRAFVDD-AKYQEMYARSVN
ACSA_PARL1       ---------------------------MSDEIFPVPAEWKKRAIVDA-EKYRHMYEASIN
ACSA_RHOCB       -------------------MGVQGQPSVAPALREVPAGF-ETAHANG-AKYLEMYRESLE
ACSA_BRUA2       ---------------------------MSEKLYPVLPEAKKNTLIDN-ETYLEWYEESVS
ACSA_BRUAB       ---------------------------MSEKLYPVLPEAKKNTLIDN-ETYLEWYEESVS
ACSA_BRUSU       ---------------------------MSEKLYPVLPEAKKNTLIDN-ETYLEWYEESVS
ACSA_BRUC2       ---------------------------MSEKLYPVLPEAKKNTLIDN-ETYLEWYEESVS
ACSA_BRUME       ---------------------------MSEKLYPVLPEAKKNTLIDN-ETYLEWYEESVS
ACSA_BRUSI       ---------------------------MSEKLYPVLPEAKKNTLIDN-ETYLEWYEESMS
ACSA_BRUO2       ---------------------------MSEKLYPVLPEAKKNTLIDN-ETYLEWYEESVS
ACSA_OCHA4       ---------------------------MSEKLYPVLAEAKRNTLIDN-ATYLEWYQESVS
ACSA_AGRRH       ---------------------------MSEKIYPVAKPVESHALINK-AEYQEWYAESVA
ACSA_RHIEC       ---------------------------MSEKIHPVPKQVKAQALIDK-EKYLKWYEESVE
ACSA_RHIME       ---------------------------MDVKTYPVLEAAKNRTLLDN-ATYLEWYRESVA
ACSA_SINMW       ---------------------------MDVKTYPVLEAAKNRTLLDN-ETYLKWYQESVA
ACSA_AGRFC       ---------------------------MSAKIYPVLKSAKARTLIDN-ERYQKWYQESVE
ACSA_RHILO       --------------------------MSEVHVHRVQPAWKKNALIDN-DTYLKWYADSIK
ACSA_BART1       ---------------------------MTEKIYPISEEIKKNTLLDE-ETYQKWYRESIN
ACSA_BARHE       ---------------------------MSEKIYPIPDNIKKNALIDE-ETYQQWYQESIN
ACSA_BARQU       ---------------------------MSEKIYPVPTDIKKNALINE-ETYQKWYRESIN
ACSA_BARBK       ---------------------------MSERIYPIPVDIEKNALIDQ-DTYQKWYQKSIE
ACSA_ECOLI       --------------------------MSQIHKHTIPANIADRCLINP-QQYEAMYQQSIN
ACSA_ECO57       --------------------------MSQIHKHTIPANIADRCLINP-QQYEAMYQQSIN
ACSA_ECOL6       --------------------------MSQIHKHTIPANIADRCLINP-QQYEAMYQQSIN
ACSA_SALTI       --------------------------MSQTHKHAIPANIADRCLINP-EQYETKYKQSIN
ACSA_SALTY       --------------------------MSQTHKHAIPANIADRCLINP-EQYETKYKQSIN
ACSA_CITK8       --------------------------MSQIHKHAIPANIADRCLINP-EQYEAKYQQSIN
ACSA_CROS8       --------------------------MSQIHKHPIPAAIAERCLITP-EQYDAKYQQSVH
ACSA_YERPA       --------------------------MSQIHKHPIPAAIAEHALITP-EKYQHYYQQSVQ
ACSA_YERPN       --------------------------MSQIHKHPIPAAIAEHALITP-EKYQHYYQQSVQ
ACSA_YERPE       --------------------------MSQIHKHPIPAAIAEHALITP-EKYQHYYQQSVQ
ACSA_YERPP       --------------------------MSQIHKHPIPAAIAEHALITP-EKYQHYYQQSVQ
ACSA_YERP3       --------------------------MSQIHKHPIPAAIAEHALITP-EKYQHYYQQSVQ
ACSA_YERPS       --------------------------MSQIHKHPIPAAIAEHALITP-EKYQHYYQQSVQ
ACSA_YERE8       --------------------------MSQIHKHPIPTAIAEHALINP-EQYHQYYQQSVQ
ACSA_SERP5       --------------------------MSQVHKHAIPSAIAEHALINP-TQYQQYYQQSVQ
ACSA_PHOLL       --------------------------MTKIMKHPIPIAIAEHALMNE-QQYQQDYQLSLQ
ACSA_SODGM       --------------------------MSQPHRYPIPASLAERTLVSA-EQYRKLYEQSIN
ACSA_AERHH       --------------------------MSESKVYPVKAHISNGALLDK-AGYEAMYRASVQ
ACSA_AERS4       --------------------------MSESKVYPVKAHISNGALLDK-AGYEAMYRASVQ
ACSA_VIBVU       --------------------------MSEAHIYPVKENIKAHTHADN-DTYLAMYQQSVT
ACSA_VIBVY       --------------------------MSEAHIYPVKENIKAHTHADN-DTYLAMYQQSVT
ACSA_VIBPA       --------------------------MSEAHVYPVKENIKTHTHADN-DTYLAMYQQSVT
ACSA_VIBCH       --------------------------MSEAHIYPVKQNIKAHTHADN-DTYLAMYQQSIK
ACSA_PHOPR       --------------------------MSEVHVYPVNQEIAATAHVND-EQYREMYQQSVI
ACSA_PSYIN       --------------------------MSEEHIYPVTDNLAKNSLLTN-EEYLTQYQASIS
ACSA_SHESR       --------------------------MSSQSLYKVSGNIAANALVNN-DQYKKMYQESIV
ACSA_SHESM       --------------------------MSSQSLYKVSGNIAANALVNN-DQYKKMYQESIV
ACSA_SHESA       --------------------------MSSQSLYKVSGNIAANALVNN-DQYKKMYQESIV
ACSA_SHEON       --------------------------MSSQSLYKVSGNIAANALVNN-DQYKTMYQESIV
ACSA_SHESW       --------------------------MSSQSLYKVSGNIAANALVNN-EQYKTMYQESIV
ACSA_SHEPC       --------------------------MSSQSLYKVSGNIAANALVNN-EQYKTMYQESIV
ACSA_SHEB5       --------------------------MSSQSLYKVSGNIAANALVNN-DKYKTMYQESIV
ACSA_SHEB8       --------------------------MSSQSLYKVSGNIAANALVNN-DKYKTMYQESIV
ACSA_SHEB9       --------------------------MSSQSLYKVSGNIAANALVNN-DKYKTMYQESIV
ACSA_SHEFN       --------------------------MTPQSLYKVPSDIAENALVNN-DQYKKMYQESII
ACSA_SHEPA       --------------------------MSTQSLYKVPSEIAANALVND-EQYKKMYQESIV
ACSA_SHEHH       --------------------------MSTQSLYKVPSEIAANALVND-EQYKKMYQESIV
ACSA_SHELP       --------------------------MSTQSLYKVPSEIAANAHIND-EKYKKMYQESVV
ACSA_SHESH       --------------------------MSTQSLYKVSSEIAENAHINE-EQYKKMYQESIV
ACSA_SHEAM       --------------------------MSTQSLYSVPADIAANALVNN-EQYQKMYQESVA
ACSA_SHEDO       --------------------------MNSPTVYPVPSQISAHAHIDE-QTYQRMYQASID
ACSA_PSEU2       --------------------------MSAASLYPVRPEVAATTLTDE-ATYKAMYQQSVV
ACSA_PSE14       --------------------------MSAASLYPVRPEVAATTLTDE-ATYKAMYQQSVV
ACSA_PSESM       --------------------------MSAASLYPVRPEVAATTLTDE-ATYKAMYQQSVV
ACSA1_PSEPK      --------------------------MSAAPLYPVRPEVAATTLTDE-ATYKAMYQQSVI
ACSA1_PSEAE      --------------------------MSAASLYPVHPEAVARTFTDE-ATYKTMYQQSVV
ACSA_PSEU5       --------------------------MCAASVYPVSPEAAKHSLTDE-AAYRAMYQQSVI
ACSA_MARHV       --------------------------MTDKQVYPVSPEVAERALVNK-SQYEEMYRQSVE
ACSA2_PSEAE      --------------------------MFEISVHPVPDAVRQRAYLND-DDYQRLYRQSVE
ACSA2_PSEPK      --------------------------MFDIRKYPQALAVSQSAALTP-EDYRRLYRQSVE
ACSA_ALKEH       --------------------------MSDTKVYPVPDYIREKAHITK-DTYEEMYRRSLD
ACSA_HALHL       --------------------------MSETKVYPVPETIQRDAHLNF-EQYQEMYNRSIQ
ACSA_MAGMM       --------------------------MSDVKVYPVDPNVAANALINE-EQYQEMYKRSID
ACSA_SACD2       --------------------------MSTPHLYPVPEALAANAHINN-EKYHTDYARSIN
ACSA_ALCBS       --------------------------MSQVHIHPVPADYKKQTLMDR-ETYDRWYSQSIN
ACSA_PRB01       ----------------------------MPRKLYSPKHSSNPYIKDF-DEYKELYKQSIE
ACSA_THIDA       -------------------MAAIESVLTETRVFPPAEAFVTQANVAGMEAYQALCRRAEA
ACSA_CHRVO       -------------------MSTLDSILKETRSFAPSEEFRRKASISGIEAYHALCEQADD
ACSA_NITEU       -------------------MATIESILHENRIFPPASEFVRNANLSGREAYETLRQEAEH
ACSA_NITEC       -------------------MATIESILRENRIFPPANEFVRHANITGMKTYEALRQEAER
ACSA_METFK       -------------------MSSIESVLTETRVFAPHETFRQAATVSGLPGYQALCDAAEQ
ACSA_CUPNH       -------------------MSAIESVMQEHRVFNPPEGFASQAAIPSMEAYQALCDEAER
ACSA_CUPPJ       -------------------MSAIESVMQEHRVFNPPESFVRQAAIPGMDAYRALCAEAER
ACSA_CUPMC       -------------------MSAIESVMQEHRVFNPPASFAKTAAIPSMEAYQALCDEAAK
ACSA_RALSO       -------------------MAGIESVLQETRVFEPPASFVKQANIAGMDAYRTLCAEAER
ACSA_BURP0       -------------------MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAER
ACSA_BURMA       -------------------MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAER
ACSA_BURP6       -------------------MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAER
ACSA_BURP1       -------------------MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAER
ACSA_BURM7       -------------------MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAER
ACSA_BURPS       -------------------MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAER
ACSA_BURM9       -------------------MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAER
ACSA_BURMS       -------------------MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAER
ACSA_BURTA       -------------------MSAIESVLHERRQFAPPAAVEKAAAISGMAAYRALAEEAER
ACSA_BURL3       -------------------MSAIESVLHETRQFAPPAALEQAATISGMPAYRALAAEAEN
ACSA_HERAR       -------------------MSSIESFKQEGRVFDSPVDFVNNAAISGMEAYRALCAEAAD
ACSA_PASMU       --------------------MPHNSMLKENRLFKPTDEFRRQANISGLETYQALWEFADK
ACSA_HELPY       -------------------MQLDEDLEFAKKIFNPNRAFAKQARIKNMCEYKDLVHEANE
ACSA_HELPH       -------------------MQLDDDLEFAKKIFNPNRAFAKQARIKNMCEYKDLVHEANE
ACSA_HELAH       -------------------MQLDDDLEFAKKIFNPNRAFAKQARIKNMCEYKDLVHEANE
ACSA_CAMJJ       --------------------MLNQN---NQELFKPSKEFSRNARIKNLCEYYDLCDEAKE
ACSA_CAMJE       --------------------MLNQN---NQELFKPSKEFSRNARIKNLCEYYDLCDEAKE
ACSA_CAMJ8       --------------------MLNQN---NQELFKPSKEFSRNARIKNLCEYYDLCDEAKE
ACSA_WOLSU       --------------------MTQTH---STELFKPNRAFAKTARIKNLCEYEDLRLDAEE
ACSA_RUBXD       ----------------------MTEEKASVRTYDPPEEFASRANVRD----PGVYEEAAR
ACSA_STRAW       --MSNES--------------------LANLLKEERRFAPPADLAANANVTAEAYEQAKA
ACSA_STRCO       --MSNES--------------------LANLLKEERRFAPPADLAANANVTAEAYEQAKA
ACSA_MYCBO       --MSE------------------------STPEVSSSYPPPAHFAEHANARAELYREAEE
ACSA_MYCTU       --MSE------------------------STPEVSSSYPPPAHFAEHANARAELYREAEE
ACSA_PYRAE       --MSLELKEKE----------------SELPFDEQIINDKWRSKYTPIDAYFKFHRQTVE
ACSA_PYRAR       --MSLKSLEKE----------------TELPFDEYVLNDKWRHKYTPIDTYFKFHQQAIE
ACSA_METSH       -MLKLAGKEDKKLKTTVFQDETRIFNPPKELVEKSIVMQWMKKKGFKTEKEMRAWCSSDE
                                                                             

ACSA_THET8       DPEGFWGRVA-SELHWFEPW------RKVLEGDLPHPKWFVGGKTNLSYNALDRHVKTWR
ACSA_THET2       DPEGFWGRVA-SELHWFEPW------RKVLEGDLPHPKWFVGGKTNLSYNALDRHVKTWR
ACSA_SYNY3       NPEKFWGELAEQELHWFKKW------DQVLDWQPPFAKWFVGGQLNISHNCLDRHLTTWR
ACSA_THEEB       DPAAFWGELAQQELEWFQPW------EQVLDWQPPNAKWFVNGKINITYNCLDRHLKTWR
ACSA_DEIRA       QPDDFWSEVA-HDLHWMKDW------DRVLDWQEPHAQWFVGGQTNIAYNALDRNVQRGL
ACSA_CHLTE       DPDKYW-GDLAEQFHWFKKW------DSVLEWNAPYAKWFNGGTTNIAYNCLDVHVGSWR
ACSA_RHOBA       NPDEFWRAEALEHLHWFEPF------GTVCDWQPPHAKWFVNGKTNACYNSVDAHVAAGR
ACSA_LEPIC       NPNKFWAREANR-LIWFKKW----TKVLSHDFKNAKVEWFKGGKLNVSYNCLDRHISTPL
ACSA_LEPIN       NPNKFWAREANR-LIWFKKW----TKVLSHDFKNAKVEWFKGGKLNVSYNCLDRHISTPL
ACSA_LEPBL       NPNKFWAKEANR-LTWFKKW----TKVLNHDFKNAKVEWFKGGKLNVSYNCLDRHISTPL
ACSA_LEPBJ       NPNKFWAKEANR-LTWFKKW----TKVLNHDFKNAKVEWFKGGKLNVSYNCLDRHISTPL
ACSA_XANC8       HPEQFWGKAAQR-LDWFKQP--TQIKDVSFALDDFHVRWFGDGELNASVNCLDRQLATR-
ACSA_XANCP       HPEQFWGKAAQR-LDWFKQP--TQIKDVSFALDDFHVRWFGDGELNASVNCLDRQLATR-
ACSA_XANOM       HPEQFWGKAAQR-LEWFKQP--TQVKDVSYALDDFHIRWFGDGELNASVNCLDRQLATR-
ACSA_XANAC       HPEQFWGKAAQR-LEWFKQP--TQIKDVSYALDDFHIRWFGDGELNASVNCLDRQLATR-
ACSA_XYLFA       QPEAFWSNIAQR-LEWFKTP--TKIKDVSYQLEDVHIRWFEDGELNASVNCLDRHLTLR-
ACSA_XYLFT       QPEAFWNKVSQR-LEWFKAP--TKIKNVSYQLEDVHIRWFEDGELNASVNCLDRHLTLR-
ACSA_BDEBA       DNEAFWAEQAER-LDWIKKW--DKVKEVSFK-KPVSIKWYLGGKMNVSYNCVDRHLKTR-
ACSA_NOVAD       DPEGFWAEHGKR-IDWIRPF--TKVKNTSFHEADFGIRWFEDGTLNLAANCLDRHLAER-
ACSA_CAUVC       DPEGYWRDIAAR-LDWITPP--TKIKDVSYAKEDFRIRWYEDGVLNVSANCIDRHLPAK-
ACSA_BRADU       DPNGFWAEQAKR-IDWMKAP--TKIENVSFAPGNVSIKWFEDGVLNVAHNCIDRHLHKR-
ACSA_BRASO       DPNGFWAEQAKR-VDWIHAP--TKIENVSYAPGNISIKWFEDGVLNAAYNCIDRHLATR-
ACSA_RHOP5       DPNGFWKDEAQR-VDWIKPF--SVVENTSFAPGNVSIKWFEDGVLNVAANCIDRHLKDR-
ACSA_PARL1       DPESFWRREGLR-IDWMKPY--TKIKDTSFDPHNVSIKWFEDGTLNASVNCIDRHLERR-
ACSA_RHOCB       NPDAFWGREGKR-LDWITPY--TKVKNTDFTFGKVSIKWFEDGVLNASVNCIDRHLRDR-
ACSA_BRUA2       DPDGFWAKHGRR-IDWFKPF--TKVKNTDFN-GDVTIKWYEDGVTNVSYNCIDRHLKSR-
ACSA_BRUAB       DPDGFWAKHGRR-IDWFKPF--TKVKNTDFN-GDVTIKWYEDGVTNVSYNCIDRHLKSR-
ACSA_BRUSU       DPDGFWAKHGRR-IDWFKPF--TKVKNTDFN-GDVTIKWYEDGVTNVSYNCIDRHLKSR-
ACSA_BRUC2       DPDGFWAKHGRR-IDWFKPF--TKVKNTDFN-GDVTIKWYEDGVTNVSYNCIDRHLKSR-
ACSA_BRUME       DPDGFWAKHGRR-IDWFKPF--TKVKNTDFN-GDVTIKWYEDGVTNVSYNCIDRHLKSR-
ACSA_BRUSI       DPDGFWAKHGRR-IDWFKPF--TKVKNTDFN-GDVTIKWYEDGVTNVSYNCIDRHLKSR-
ACSA_BRUO2       DPDGFWAKHGRR-IDWFKPF--TKVKNTDFN-GDVTIKWYEDGVTNVSYNCIDRHLKSR-
ACSA_OCHA4       DPDSFWAKHGRR-IDWFKPF--TKVKNTDFN-GDVSIKWYEDGVTNVSYNCIDRHLKSR-
ACSA_AGRRH       DPEQFWGKHGKR-IDWFKPY--TSVKDTSFT-GDVSIKWFEDGETNVSYNCIDRHLATN-
ACSA_RHIEC       NPDKFWGKHGKR-IDWFKPY--TKVKNTSFT-GKVSIKWFEDGQTNVSYNCIDRHLKTN-
ACSA_RHIME       DPEKFWGEHGKR-IEWFEPY--TKVKNTSFE-GDVSIKWFEDGLTNVSYNCIDRHLKTH-
ACSA_SINMW       DPETFWGEHGKR-IDWFEPY--TKVKNTTFE-GDVSIKWFEDGLTNVSYNCIDRHLKAH-
ACSA_AGRFC       DPEKFWDKHGRR-IDWFKPY--TKVKNTSFK-GRVPIKWFEDGLTNVSYNCIDRHLKTH-
ACSA_RHILO       NPDKFWGKHGKR-IDWFKPF--SKVKNTSFD-GKVSIKWFEDGLTNVSYNCIDRHLKKR-
ACSA_BART1       DPESFWAKHGQC-IEWFKPF--TKVKNTSFN-DGVSIQWYEDGITNVAYNCIDRHLKTH-
ACSA_BARHE       DPESFWAKHGQC-IEWFKPY--TKVKNTSFN-GDVSIQWYEDGITNVAYNCIDRHLKTH-
ACSA_BARQU       DPEAFWAKHGQR-IEWFKPY--TKVKNTSFN-GDVSIQWYEDGITNVAYNCIDRHLKNS-
ACSA_BARBK       DPTSFWGEHGQR-IEWFKPY--TKVKNASFN-DNVSIKWYEDGITNVAYNCIDRHLKDR-
ACSA_ECOLI       VPDTFWGEQGKI-LDWIKPY--QKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQEN-
ACSA_ECO57       APDTFWGEQGKI-LDWIKPY--QKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQEN-
ACSA_ECOL6       APDTFWGEQGKI-LDWITPY--QKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQEN-
ACSA_SALTI       DPDTFWGEQGKI-LDWITPY--QKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQEN-
ACSA_SALTY       DPDTFWGEQGKI-LDWITPY--QKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQEN-
ACSA_CITK8       EPDTFWGEQGKI-LDWITPY--KKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQEN-
ACSA_CROS8       DPDAFWGEQGKI-LDWITPY--QTVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLSER-
ACSA_YERPA       NPDEFWGEQGKI-IDWIKPY--KTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAER-
ACSA_YERPN       NPDEFWGEQGKI-IDWIKPY--KTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAER-
ACSA_YERPE       NPDEFWGEQGKI-IDWIKPY--KTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAER-
ACSA_YERPP       NPDEFWGEQGKI-IDWIKPY--KTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAER-
ACSA_YERP3       NPDEFWGEQGKI-IDWIKPY--KTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAER-
ACSA_YERPS       NPDEFWGEQGKI-IDWIKPY--KTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAER-
ACSA_YERE8       NPDEFWGEHGKI-IDWIKPY--KTVKNTSFDPGHVSIRWFEDGTLNLAANCLDRHLAER-
ACSA_SERP5       DPETFWGEQGKI-LDWIKPY--SRVKNTSFDPGHISIRWFEDGTLNLAANCLDRHLAER-
ACSA_PHOLL       DPDRFWGEKGKI-VDWIKPY--TKVKNTSFDPGHINIRWFEDGTLNLSANCLDRHLKER-
ACSA_SODGM       DPDSFWREYAQI-VEWITPF--QTVKNTTFDPGHVNIRWFEDGTLNVAANCLDRHLQER-
ACSA_AERHH       DPDAFWGEQGKI-LDWMKPY--TRVKNTSYDPGHVSIKWYEDGLLNVSANCLDRHLAQR-
ACSA_AERS4       DPDAFWGEQGKI-IDWMKPY--TKVKNTSYDPGHVSIKWYEDGLLNVSANCLDRHLAQR-
ACSA_VIBVU       DPERFWSEHGKI-VDWIKPF--TKVKQTSFDTGHVDIRWFEDGTLNVSANCIDRHLAER-
ACSA_VIBVY       DPEGFWSEHGKI-VDWIKPF--TKVKQTSFDTGHVDIRWFEDGTLNVSANCIDRHLAER-
ACSA_VIBPA       DPEGFWNEHGKI-VDWIKPF--TKVKSTSFDTGHVDIRWFEDGTLNVSANCIDRHLAEH-
ACSA_VIBCH       DPEGFWSEHGKI-VDWIKPF--TKVKHTSFDPGHIDIRWFEDGTLNVSANCIDRHLATR-
ACSA_PHOPR       NPEGFWREHGQI-VDWIKPF--TKVKHTSFDTGHVSVKWFEDGTLNVSANCIDRHLATR-
ACSA_PSYIN       DPSAFWGEKGKI-LDWIKPY--TKVKNSSFDSGHVSIKWFEDGKLNVSANCIDRHLATK-
ACSA_SHESR       NPEGFWREHGKR-IDWIKPY--TKIKKTSFDDHNLSINWFYDGTLNASANCLDRHLAEH-
ACSA_SHESM       NPEGFWREHGKR-IDWIKPY--TKIKKTSFDDHNLSINWFYDGTLNASANCLDRHLAEH-
ACSA_SHESA       NPEGFWREHGKR-IDWIKPY--TKIKKTTFDDHNLSINWFYDGTLNASANCLDRHLAEH-
ACSA_SHEON       NPEGFWREHGKR-IDWIKPY--TKIKKTTFDDHNLSINWFYDGTLNASANCLDRHLAAH-
ACSA_SHESW       NPEGFWREHGKR-IDWIKPY--TKIKKTSFDDHNLSINWFYDGTLNASANCLDRHLAEH-
ACSA_SHEPC       NPEGFWREHGKR-IDWIKPY--TKIKKTSFDDHNLSINWFYDGTLNASANCLDRHLSEH-
ACSA_SHEB5       NPEGFWREHGKR-IDWIKPY--TKIKKTSFDDHNLSINWFYDGTLNASANCLDRHLAEH-
ACSA_SHEB8       NPEGFWREHGKR-IDWIKPY--TKIKKTSFDDHNLSINWFYDGTLNASANCLDRHLAEH-
ACSA_SHEB9       NPEGFWREHGKR-IDWIKPY--TKIKKTSFDDHNLSINWFYDGTLNASANCLDRHLAEH-
ACSA_SHEFN       NPEGFWREHGKR-IDWIKPY--TKIKKTSFDDHNLSINWFYDGTLNASANCLDRHLEEH-
ACSA_SHEPA       NPEGFWREHGNR-IDWIKPF--TKVKKTSFDDHNLFIKWFYDGTLNASANCLDRHLENN-
ACSA_SHEHH       NPEGFWREHGNR-IDWIKPF--TKVKKTSFDDHNLFIKWFYDGTLNASANCLDRHLENN-
ACSA_SHELP       NPEGFWREHGQR-IDWMKPF--TKVKKTSFDDHNLSINWFYDGTLNASVNCLDRHLADN-
ACSA_SHESH       NPEGFWREHGQR-IDWIKPY--TKIKKTSFDDHNLSINWFYDGTLNASANCLDRHLEKD-
ACSA_SHEAM       NPEGFWGEHAKR-IDWIKPF--TQVKDTSYDDQNLYIKWFHDGTLNASANCLDRHLASK-
ACSA_SHEDO       NPERFWGEQGKR-IDWITPYSQTQVKKTSFDANNLSIQWFADGTLNASSNCLDRHLERN-
ACSA_PSEU2       NPDGFWREQAQR-LDWIKPF--SVVKQTSFDDHRVDIKWFADGTLNVAYNCLDRHLEER-
ACSA_PSE14       NPDGFWREQAQR-LDWIKPF--SVVKQTSFDDHRVDIKWFADGTLNVAYNCLDRHLAER-
ACSA_PSESM       NPDGFWREQAQR-LDWIKPF--SVVKQTSFDDHRVDIKWFADGTLNVAYNCLDRHLAER-
ACSA1_PSEPK      NPDGFWREQAQR-IDWIKPF--TKVKQTSFDDHHVDIKWFADGTLNVSSNCLDRHLEER-
ACSA1_PSEAE      NPDGFWREQAQR-IDWIKPF--EKVKQTSFDDHHVDIKWFADGTLNVSHNCLDRHLAER-
ACSA_PSEU5       NPEGFWREQAAR-LDWIRPF--SEVKRTSFDDHHVDIKWFADGTLNVSANCLDRHLAER-
ACSA_MARHV       DPNTFWGEHGKR-IDWIKPF--TKVKNSTYDYNNLSIKWFEDGVLNASANCLDRHLEQR-
ACSA2_PSEAE      NPDEFWGEQAKAFLDWFKPW----HSVHHGDLRKGQATWFKGGQLNVAYNCIDRHLERR-
ACSA2_PSEPK      DPDTFWAEQAKR-LDWIKPW----SSVQQCDLHTGKARWFDGAQLNVSYNCIDRHLAQR-
ACSA_ALKEH       DPEGFWGEQAEKFLDWFSKW----DKVYHSDLKNGEIRFFEGGKLNVAHNCLDRHLEQR-
ACSA_HALHL       DPEGFWSEQADKFLDWFSKW----GTTCHWDLAKGDIRFFEGGTLNVAYNCVDRHLETR-
ACSA_MAGMM       DPAAFWAEQAEARIDWFKKW----DNVLDFDLRKGHIKWFEGAKLNVSYNCIDRHLEKR-
ACSA_SACD2       EPDVFWAEKAREFLTWDKPW----QSVRSFDFHKGEATWFEGGKLNVTVNCIDRHLPTK-
ACSA_ALCBS       DPGTFWAERAEQLLDWKTPW----DTVSEWDFNEGRAAWFKGATLNACYNCVDRHLPER-
ACSA_PRB01       DPSKFFKNLANENISWMEDF------KTTFNNQFNNAKWFEGGKTNISLNCIDRHLEND-
ACSA_THIDA       DYEGFWAELARQHIDWKTPF-----TRTLDESDAPFYRWFDDGELNVSYNCLDRHLATR-
ACSA_CHRVO       HYLSFWGDLARELITWKKPF-----SRVLDDSQAPFFKWFDDGVLNASYNCLDRHLAAN-
ACSA_NITEU       DYTGFWAKLAQQYIAWHKPF-----TRVLNDANPPFYKWFDDGELNISWNCLDRHLATQ-
ACSA_NITEC       DYAGFWAKLAKQYITWHKPF-----TRILDDTNPPFYKWFDDGELNISWNCLDRHLTTQ-
ACSA_METFK       DYTGFWANLARQEISWQTPF-----TEVLDESNAPFYRWFADGKLNASYNCIDRHLEKR-
ACSA_CUPNH       DYEGFWARHARELLHWTKPF-----TKVLDQSNAPFYKWFEDGELNASYNCLDRNLQNGN
ACSA_CUPPJ       DYEGFWASRARDLLHWNKPF-----TKVLDESNAPFYKWFEDGELNASYNCLDRNLQNGN
ACSA_CUPMC       DYEGFWARHARELLHWHKPF-----TKVLDESNAPFYKWFEDGEINASYNCLDRNVEKGL
ACSA_RALSO       DYEGFWARLAHEHLLWHKPF-----SKVLDESRAPFYTWFEDGELNASYNCLERNLENGN
ACSA_BURP0       DYEGFWARLARETLEWRKPF-----GKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGL
ACSA_BURMA       DYEGFWARLARETLEWRKPF-----GKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGL
ACSA_BURP6       DYEGFWARLARETLEWRKPF-----GKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGL
ACSA_BURP1       DYEGFWARLARETLEWRKPF-----GKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGL
ACSA_BURM7       DYEGFWARLARETLEWRKPF-----GKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGL
ACSA_BURPS       DYEGFWARLARETLEWRKPF-----GKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGL
ACSA_BURM9       DYEGFWARLARETLEWRKPF-----GKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGL
ACSA_BURMS       DYEGFWARLARETLEWRKPF-----GKVLDETNAPFYKWFEDGELNASYNCLDRHVAAGL
ACSA_BURTA       DYEGFWARLARETLEWRKPF-----GKALDETNAPFYKWFDDGELNASYNCLDRHVAAGL
ACSA_BURL3       DYEGFWARLAREGLAWHKPF-----TKVLDESNAPFYKWFEDGELNASYNCLDRHVEAGN
ACSA_HERAR       DYEGFWARLAQQNLHWTKPF-----TKKLDESNAPFYKWFEDGELNVSWNCLDRHLHNGN
ACSA_PASMU       DYLTYWSDLARELITWKKPF-----MHIFDDSEAPFYKWFSDGTLNVSYNCLDRHLPDK-
ACSA_HELPY       DYEHFWGDLAKQKLTWFKPF-----DKVLNSDNAPFFKWFENGKINVSYNCIDRHLKDK-
ACSA_HELPH       DYEHFWGELAKQKLTWFKPF-----DKVLNSDNAPFFKWFENGKINVSYNCIDRHLKDK-
ACSA_HELAH       NYENFWGELAKQKLTWFKPF-----DKVLNSDNAPFFKWFENGKINVSYNCIDRHLKDK-
ACSA_CAMJJ       DFEGFWKRQAFEKIEWFSPF-----SRVLNEDKAPFYKWFEGGTLNVSYQCLDRHMKTR-
ACSA_CAMJE       DFEGFWKRQAFEKIEWFSPF-----SRVLNEDKAPFYKWFEGGTLNVSYQCLDRHMKTR-
ACSA_CAMJ8       DFEGFWKRQALEKIEWFSPF-----SRVLNEDKAPFYKWFEGGTLNVSYQCLDRHMKTR-
ACSA_WOLSU       DFEGFWGKLAKEKIDWMEPF-----SKVLDESEAPFYKWFVGGKLNVCAQCLDRHLDTR-
ACSA_RUBXD       DYEGFWAERARK-LHWFREW------DEVLRWDPPEAQWFVGGKINASYNCLDYQVQQGR
ACSA_STRAW       DRLGFWAEQARR-LTWATEP-----TETLDWSNPPFAKWFKDGKLNVAYNCVDRHVEAGH
ACSA_STRCO       DRLGFWAEQARR-LTWAKEP-----TETLDWSNPPFAKWFKDGTLNVAYNCVDRHVEAGN
ACSA_MYCBO       DRLAFWAKQANR-LSWTTPF-----TEVLDWSEAPFAKWFVGGELNVAYNCVDRHVEAGH
ACSA_MYCTU       DRLAFWAKQANR-LSWTTPF-----TEVLDWSGAPFAKWFVGGELNVAYNCVDRHVEAGH
ACSA_PYRAE       NLESFWESVAKE-LEWFKPW-----DKVLDASNPPFYKWFVGGRLNLSYLAVDRHVKTWR
ACSA_PYRAR       NLESFWESVAKE-LEWFKPW-----DKVLDASNPPFYKWFVGGRLNLSYLAVDRHVKTWR
ACSA_METSH       HYLEFWDEMAKTYVDWHKPY-----TKVMDDSEMPYFHWFTGGEINITYNAVDRHAKGAK
                     ::       . *                      :: ..  *    .:: :     

ACSA_THET8       RNKAAIVWEGE---PG----EERVLTYHDLWREVQRFANVLK-RLGVKKGDRVTIYLPMI
ACSA_THET2       RNKAAIVWEGE---PG----EERVLTYHDLWREVQRFANVLK-RLGVKKGDRVTIYLPMI
ACSA_SYNY3       RNKAAIIWEGE---PG----DSRIITYAQLHREVCQFANALK-SLGVQKGDRVAIYLPMI
ACSA_THEEB       KNKAALIWEGE---PG----DSRTLTYAQLHREVCQFANVLK-QLGVKKGDRVGIYMPMI
ACSA_DEIRA       GDKRAIIWEGE---DG----EVRTYTYAELLREVCKAANALE-ELGVVAGDRVTLYMPLI
ACSA_CHLTE       KNKAAIIWEGE---EG----NERILTYGELHRQVSKFANVLK-IAGIKPGDKVAIYMGMV
ACSA_RHOBA       GDRTAIIWEGEPVEDGQPR-DQRTLTYAELQTEVAKCAEGLT-QLGIGVGDVVSIYMPMT
ACSA_LEPIC       KNKAALIWEGD--NPTE----SRVLTYYDVYREVNRFANILK-KFGVKKGDRVLVYLPMI
ACSA_LEPIN       KNKAALIWEGD--NPTE----SRVLTYYDVYREVNRFANILK-KFGVKKGDRVLVYLPMI
ACSA_LEPBL       KNKAALIWEGD--NPSE----SKVLTYYDVYREVNRFANVLK-KYGVKKGDRVLVYLPMI
ACSA_LEPBJ       KNKAALIWEGD--NPSE----SKVLTYYDVYREVNRFANVLK-KYGVKKGDRVLVYLPMI
ACSA_XANC8       GDKTALLFEPD--SPDSP---SYPVTYRELYERVCKLGNALR-NLGVKKGDRVTIYLPMI
ACSA_XANCP       GDKTALLFEPD--SPDSP---SYPVTYRELYERVCKLGNALR-NLGVKKGDRVTIYLPMI
ACSA_XANOM       GDKTALLFEPD--SPDAA---SYPVTYRQLYERVCKLGNALR-NLGVKKGDRVTIYLPMI
ACSA_XANAC       GDKTALLFEPD--SPDAA---SYPVTYRELYERVCKLGNALR-NLGVKKGDRVTIYLPMI
ACSA_XYLFA       GDKTALLFEPD--APDAP---SSRITYRELYERVCQLGNALR-HLNIEKGDRVTIYLPMI
ACSA_XYLFT       GDKTALLFEPD--APDAP---SSRITYRELYERVCQLGNALR-HLGIEKGDRVTIYLPMI
ACSA_BDEBA       GDKTALLWEAD--NPSTP---SRKITYKELHLEVCRFANVLK-KMGVKKGDVVTIYMPMI
ACSA_NOVAD       GDEIAILWEPD--SPDEA---HREITYRQLHADVCRFANLLK-AKGVQKGERVTIYLPMV
ACSA_CAUVC       KDDVALVFEGD--EPG-T---SSTLTYGQLHEEVCRMANVLK-AQGVKKGDRVTIYLPMV
ACSA_BRADU       ANQTAIIWEGD--DPSQ----SRHITYKELHDEVCRMANILR-TRNVKKGDRVTIYLPMI
ACSA_BRASO       ADQTAIIWEGD--DPAD----SKHITYRQLHDEVCKMANILR-NRNVKKGDRVTIYLPMI
ACSA_RHOP5       ADQVAIIWEGD--DPSE----SRKITYRQLHDEVCKMANVLR-NRNVQKGDRVTIYLPMI
ACSA_PARL1       AGQVAIIWEGD--DPSI----DRKITYRELHDEVCRFANVLK-ARGVKKGDRVTIYMPMI
ACSA_RHOCB       ALQTAIIFEPD--DPKEP---ARHITYKELSEKVNRMANVLL-SQGIMRGDRVVIYLPMI
ACSA_BRUA2       GDKVAIIWEGD--NPYI----DKKITYRELYENVCRMANVLK-KHGVKKGDRVTIYLPMI
ACSA_BRUAB       GDKVAIIWEGD--NPYI----DKKITYRELYENVCRMANVLK-KHGVKKGDRVTIYLPMI
ACSA_BRUSU       GDKVAIIWEGD--NPYI----DKKITYRELYENVCRMANVLK-KHGVKKGDRVTIYLPMI
ACSA_BRUC2       GDKVAIIWEGD--NPYI----DKKITYRELYENVCRMANVLK-KHGVKKGDRVTIYLPMI
ACSA_BRUME       GDKVAIIWEGD--NPYI----DKKITYRELYENVCRMANVLK-KHGVKKGDRVTIYLPMI
ACSA_BRUSI       GDKVAIIWEGD--NPYI----DKKITYRELYENVCRMANVLK-KHGVKKGDRVTIYLPMI
ACSA_BRUO2       GDKVAIIWEGD--NPYI----DKKITYRELYENVCRMANVLK-KHGVKKGDRVTIYLPMI
ACSA_OCHA4       GDQVAIIWEGD--NPYI----DKKITYRELHENVCRLANVLK-KHGVKKGDRVTIYLPMI
ACSA_AGRRH       GDQVAIIWEGD--DPSL----DRKITYRELYEHVCRMANVLK-KHGVKKGDRVTIYMPMV
ACSA_RHIEC       GDQVAIIWEGD--NPYI----DKKITYNELYEHVCRMANVLK-KHGVKKGDRVTIYMPMI
ACSA_RHIME       GEKTAIIWEGD--NPYL----DKKITYNELYDKVCRLANVLK-EQGVKKGDRVTIYMPMI
ACSA_SINMW       GDKTAIIWEGD--NPYL----DKKITYNELYDTVCRLANVLK-KHGVKKGDRVTIYMPMI
ACSA_AGRFC       GERTAIIWEGD--NPYI----DKKITYNQLYDYVCRLANVLK-KHGVKKGDRVTIYMPMI
ACSA_RHILO       GDQTAIIWEGD--NPYD----DKKITYNELYERVCRLANVMK-KHGVKKGDRVTIYMPMI
ACSA_BART1       GDQIALIWEGD--NPYH----DKKITYNELYEHVCRFANLLK-NHGVKKGDKVTIYLPMI
ACSA_BARHE       GDKIALIWEGD--NPYH----DKKITYNELYEHVCRFANILK-NHGVKKGDKVTIYLTMI
ACSA_BARQU       GNHIALIWEGN--NPYH----DKKITYNELYEHVCRFANILK-NHGVKKGDRVTIYLPMI
ACSA_BARBK       GNEIALIWESD--NPYS----DKKITYNELYEHVCRFANILK-NHGVKKGDRVSIYLPMI
ACSA_ECOLI       GDRTAIIWEGD--DASQ----SKHISYKELHRDVCRFANTLL-ELGIKKGDVVAIYMPMV
ACSA_ECO57       GDRTAIIWEGD--DASQ----SKHISYKELHRDVCRFANTLL-KLGIKKGDVVAIYMPMV
ACSA_ECOL6       GDRTAIIWEGD--DASQ----SKHISYKELHRDVCRFANTLL-ELGIKKGDVVAIYMPMV
ACSA_SALTI       GDRTAIIWEGD--DASQ----SKHISYRELHRDVCRFANTLL-DLGIKKGDVVAIYMPMV
ACSA_SALTY       GDRTAIIWEGD--DTSQ----SKHISYRELHRDVCRFANTLL-DLGIKKGDVVAIYMPMV
ACSA_CITK8       GDRTAIIWEGD--DATQ----SKHISYRELHRDVCRFANTLL-ELGIKKGDVVAIYMPMV
ACSA_CROS8       GDQTAIIWEGD--DATQ----SKHISYRELHRDVCRFANTLT-SLGIKKGDVVAIYMPMV
ACSA_YERPA       GDQTAIIWEGD--DPNQ----SKTVTYKQLHHDVCQFANVLK-SLGVKKGDVVAIYMPMV
ACSA_YERPN       GDQTAIIWEGD--DPNQ----SKTVTYKQLHHDVCQFANVLK-SLGVKKGDVVAIYMPMV
ACSA_YERPE       GDQTAIIWEGD--DPNQ----SKTVTYKQLHHDVCQFANVLK-SLGVKKGDVVAIYMPMV
ACSA_YERPP       GDQTAIIWEGD--DPNQ----SKTVTYKQLHHDVCQFANVLK-SLGVKKGDVVAIYMPMV
ACSA_YERP3       GDQTAIIWEGD--DPNQ----SKTVTYKQLHHDVCQFANVLK-SLGIKKGDVVAIYMPMV
ACSA_YERPS       GDQTAIIWEGD--DPNQ----SKTVTYKQLHHDVCQFANVLK-SLGIKKGDVVAIYMPMV
ACSA_YERE8       GDQTAIIWEGD--DPNQ----SKTVTYKQLHHDVCQFANVLK-KLGIKKGDVVAIYMPMV
ACSA_SERP5       GDQTAIIWEGD--DPTQ----SKQVTYKQLHHDVCQFANVLK-KLGVKKGDVVAIYMPMV
ACSA_PHOLL       GEQTAIIWEGD--DPTE----SKAITYRELHHDVCQFANVLK-NMGIKKGDVVAIYMPMV
ACSA_SODGM       GDQTAIIWEGD--DASQ----SKTLTYRQLHQAVCRFANVLK-AQGIGKGDVVALYMPMV
ACSA_AERHH       GDKVAIIWEGD--NPAE----DRKLTYRELHTEVCKFANVLK-AQGVHRGDVVCLYMPMV
ACSA_AERS4       GDKVAIIWEGD--NPAE----DRKLTYRELHAEVCKFSNVLK-AQGVHRGDVVCLYMPMV
ACSA_VIBVU       GDDVAIIWEGD--NPED----DKTLTYNELYTEVCRFSNALK-EQGVRKGDVVCLYMPMV
ACSA_VIBVY       GDDVAIIWEGD--NPAD----DKTLTYNELYTEVCRFSNALK-EQGVRKGDVVCLYMPMV
ACSA_VIBPA       GDDVAIIWEGD--DPAD----DKTLTFNELHKEVCKFSNALK-DQGVRKGDVVCLYMPMV
ACSA_VIBCH       GDQVAIIWEGD--DPTQ----DKTLTYKQLHQEVCRFANALK-EQGVRKGDVVCIYMPMV
ACSA_PHOPR       GDQPAIIWEGD--DPTD----DATFTYNELHEQVCKFSNALK-SQGVRKGDVVCLYMPMV
ACSA_PSYIN       GDQVAILWEGD--TADK----DEKITYKQLHQRVCQFANVLK-SQGVRKGDVVCLYMPMT
ACSA_SHESR       SDRVAIIWEGD--NASE----QRKITYGELHTQVCKFANALR-SQGVRRGDIVTIYMPMV
ACSA_SHESM       SDRVAIIWEGD--NASE----QRKITYGELHTQVCKFANALR-SQGVRRGDIVTIYMPMV
ACSA_SHESA       SDRVAIIWEGD--NASE----QRQITYGELHTQVCKFANALR-SQGVRRGDIVTIYMPMV
ACSA_SHEON       SDRVAIIWEGD--NANE----QRKITYGELHTQVCKFANALR-SQGVRRGDIVTIYMPMV
ACSA_SHESW       SDRVAIIWEGD--NASE----QRKITYGELHADVCKFANALR-SQGVRRGDIVTIYMPMV
ACSA_SHEPC       SDRVAIIWEGD--NASE----QRKITYGELHADVCKFANALR-SQGVRRGDIVTIYMPMV
ACSA_SHEB5       SDRVAIIWEGD--NASE----QRKITYGELHADVCKFANALR-SQGVRRGDIVTIYMPMV
ACSA_SHEB8       SDRVAIIWEGD--NASE----QRKITYGELHADVCKFANALR-SQGVRRGDIVTIYMPMV
ACSA_SHEB9       SDRVAIIWEGD--NASE----QRKITYGELHAEVCKFANALR-SQGVRRGDIVTIYMPMV
ACSA_SHEFN       GDKLAIIWEGD--DANE----QRKLTYAELHTQVCKFANALR-SQGVNKGDIVTIYMPMV
ACSA_SHEPA       ADKLAIIWEGD--DAKD----QRTLTYGQLHAEVCKFANALR-SQGVRRGDVVTVYMPMV
ACSA_SHEHH       ADKLAIIWEGD--DAKD----QRTLTYGQLHTQVCKFANALR-SQGVRRGDVVTIYMPMV
ACSA_SHELP       ADKLAIIWEGD--DAAD----QRTLTYGELHTEVCKFANALR-SQGVRRGDVVTVYMPMV
ACSA_SHESH       SDKVAIIWEGD--DAKD----QRTITYGELHSDVCKFANALR-SQGVRRGDIVTVYMPMV
ACSA_SHEAM       GDDVAIIWEGD--DASE----QRKVTYRELHAEVCQFANALK-AEGVKRGDVVTIYMPMV
ACSA_SHEDO       GDKIAILWEGD--DAKE----QRQLSYRELHTQVCQFANVLK-AQGVVKGDIVTLYMPMV
ACSA_PSEU2       GDSIAIIWEGD--DPSE----HREITYRELHAEVCKFANALR-GQDVHRGDVVTIYMPMI
ACSA_PSE14       GDTIAIIWEGD--NPSE----HREITYRELHAEVCKFANALR-GQDVHRGDVVTIYMPMI
ACSA_PSESM       GDTIAIIWEGD--DPSE----HREITYRELHEEVCKFANALR-GQDVHRGDVVTIYMPMI
ACSA1_PSEPK      GDQLAIIWEGD--DPSE----HRNITYRELHEQVCKFANALR-GQDVHRGDVVTIYMPMI
ACSA1_PSEAE      GDQVAIIWEGD--DPAD----HQEITYRQLHEQVCKFANALR-GQDVHRGDVVTIYMPMI
ACSA_PSEU5       GDQVAIIWEGD--DPSE----HREITYRELYQEVCKFANALR-GQDVHRGDVVTIYMPMI
ACSA_MARHV       GDQTAIIFEGD--DPSV----SRNVTYRELYEETCKFANVLK-DQGVKKGDVVTIYMPMI
ACSA2_PSEAE      GEQIAIVWEGD--NPSE----SAHITYRKLHHNVCRLANVLK-SRGVEKGDRVCIYMPMI
ACSA2_PSEPK      GEQTALLWEGD--DPKD----SKAITYRELHRQVCRLANAMK-ARGVKKGDRVSIYMPMI
ACSA_ALKEH       GDQTAIIWEGD--DPNN----SEHITYKDLHERVCRLANAMK-ARGVKKGDRVCIYLPMI
ACSA_HALHL       GDQTAIIWEGD--EPDQ----DEHITYRDLYERVGRLANALK-ARGVKKGDRVCIYLPMV
ACSA_MAGMM       GDKVAILWEGD--NPAA----DRKITYRELSALVNKFANALK-ARGVKKGDRVCIYMPMI
ACSA_SACD2       ANDVAIIWEGD--DPSV----DASITYQQLHDAVCKFANVLK-ARGVAKGDRVCIYMPMI
ACSA_ALCBS       ANQTAIIWEGD--EPDQ----DKHISYQQLFEEVSKFGNVLK-NRGVKKGDRVVIYMPMI
ACSA_PRB01       PNKIALIWEGD--DPAD----SKELTYKELHDEVCKFANVLK-DLGVQKGSRVCIYMPMI
ACSA_THIDA       GDKTALIFEAD--DGSV-----RTVTYKELHARVCQFANGLK-SLGVGKGDRVIVYMPMS
ACSA_CHRVO       ANKIAIIFEAD--DGEV-----TRVTYSELHRRVCQFANGLK-SLGVKKGDRVVVYMPMG
ACSA_NITEU       ADKTAIIFESD--AGEV-----NHCSYRELHRQVCHFANGLK-SLGIRQGDRVVIYMPMR
ACSA_NITEC       ANKTAIIFESD--EGEV-----IRCSYRELHQRVCRFANGLK-ALGIRQGDRIVIYMPMR
ACSA_METFK       ANKIALIFEAD--NGDV-----ANITYRELHQRVCRFANALK-KQGVGLGDRVIIYLPMS
ACSA_CUPNH       ADKVAIVFEAD--DGSV-----TRVTYRELHGKVCRFANGLK-ALGIRKGDRVVIYMPMS
ACSA_CUPPJ       ADKTAIVFEAD--DGTA-----TRVSYRDLHAKVCRFANGLK-ALGIKKGDRVVIYMPMS
ACSA_CUPMC       GDKTAIVFEAD--DGTV-----TRVSYQELLAKVSRFANGMK-ALGIKKGDRVVIYMPMS
ACSA_RALSO       ADKVAVIFEAD--DGSV-----ARITYRELHARVCRFANGLK-ALGIRKGDRVVIYMPMS
ACSA_BURP0       GERVAVIFEAD--DGTV-----TRVTYADLLARVSRFANALK-KRGVGRGDRVVIYIPMS
ACSA_BURMA       GERVAVIFEAD--DGTV-----TRVTYADLLARVSRFANALK-KRGVGRGDRVVIYIPMS
ACSA_BURP6       GERVAVIFEAD--DGTV-----TRVTYADLLARVSRFANALK-KRGVGRGDRVVIYIPMS
ACSA_BURP1       GERVAVIFEAD--DGTV-----TRVTYADLLARVSRFANALK-KRGVGRGDRVVIYIPMS
ACSA_BURM7       GERVAVIFEAD--DGTV-----TRVTYADLLARVSRFANALK-KRGVGRGDRVVIYIPMS
ACSA_BURPS       GERVAVIFEAD--DGTV-----TRVTYADLLARVSRFANALK-KRGVGRGDRVVIYIPMS
ACSA_BURM9       GERVAVIFEAD--DGTV-----TRVTYADLLARVSRFANALK-KRGVGRGDRVVIYIPMS
ACSA_BURMS       GERVAVIFEAD--DGTV-----TRVTYADLLARVSRFANALK-KRGVGRGDRVVIYIPMS
ACSA_BURTA       GERIAVIFEAD--DGTV-----ARVTYADLLARVSRFANALK-KRGIGRGDRVVIYIPMS
ACSA_BURL3       GERVAVIFEAD--DGTV-----TRVTYADLLARVSRFANALK-KRGIGKGDRVVIYIPMS
ACSA_HERAR       ADKVAIIFEAD--DGNV-----TRITYKELHERVCKFANGLK-SLSINKGDRVIIYMPMS
ACSA_PASMU       ADKTALIFESD--FGQV-----QLYTYAKLHNRVCRFANALR-ELGIKKGDRVIIYLPML
ACSA_HELPY       KNKVAIIFEGE--MGDY-----NVITYRKLHSEVNKTANLLKNEFNVKKGDRVIIYMPMI
ACSA_HELPH       KNKVAIIFEGE--MGDY-----NVITYRKLHSEVNKTANLLKNEFNVKKGDRVIIYMPMI
ACSA_HELAH       KNKVAIIFEGE--MGDY-----NAITYRKLHSEVNKTANLLKNEFNIKKGDRVIIYMPMI
ACSA_CAMJJ       RNKAALIFEGE--MGDY-----EVYTYRRLLHETCKAANLLK-KFGVKKGDRVVIYMPMI
ACSA_CAMJE       RNKAALIFEGE--MGDY-----EVYTYRRLLHETCKAANLLK-KFGVKKGDRVVIYMPMI
ACSA_CAMJ8       RNKAALIFEGE--MGDY-----EVYTYRRLLHETCKAANLLK-KFGVKKGDRVVIYMPMI
ACSA_WOLSU       KNKAAIIFEGE--LGDS-----RIITYRELFYEVKRTANLLKNKFNVKKGDRVVIYMPMI
ACSA_RUBXD       GDKRAIIWEGD--EPGE----NRTLTYSELKAEVEKFANVLK-GLGVRKGDAVSIYLPMI
ACSA_STRAW       GDRVAIHFEGEP-GDS------RAITYAELKDEVSKAANALT-ELGVQKGDRVAVYLPMI
ACSA_STRCO       GDRVAIHFEGES-GDS------RALTYAQLKDEVSKAANALL-ELGVQKGDRVAIYMPMI
ACSA_MYCBO       GDRVAIHWEGEPVGDR------RTLTYSDLLAEVSKAANALT-DLGLVAGDRVAIYLPLI
ACSA_MYCTU       GDRVAIHWEGEPVGDR------RTLTYSDLLAEVSKAANALT-DLGLVAGDRVAIYLPLI
ACSA_PYRAE       KNKLAIEWEGEPVDENGYPTDRRKLTYYDLYREVNRVAYMLKQNFGVKKGDKITLYLPMV
ACSA_PYRAR       KNKLAIEWEGEPLDESGYPIDRRKLTYYDLFREVNRVACMLKCNFGVKKGDRVTLYLPMV
ACSA_METSH       KDKVAYIWIPEPTDQP-----VQKITYGDLYKEVNKFANGLK-SLGLKKGDRVSIYMPMI
                     *  :  :              ::  :   . : .  :    .:  *. : :*: : 

ACSA_THET8       PEAAIAMLACTRIGAVHSVVFGGFSAGALADRIKDAEAKVLITADGGFRRGGIVPLKQNA
ACSA_THET2       PEAAIAMLACTRIGAVHSVVFGGFSAGALADRIKDAEAKVLITADGGFRRGGIVPLKQNA
ACSA_SYNY3       PEAAITMLACSRIGAPHSVVFGGFSAEALRDRLVDAEAKLVITADGGFRKDKAIALKQEV
ACSA_THEEB       PEAAIAMLACARIGAPHSVVFGGFSAEALRDRLIDAQAKLVVTADGGWRKDAIVPLKDQV
ACSA_DEIRA       PEAAIAMLACARIGAVHSIVFGGFSVSALADRINNAQSKLLITADAGYRRGKPVTLKINA
ACSA_CHLTE       PELVIAVLACARVGAVHNVIFAGFAAHAITERVNDSRAKIVICADGTRRRGSTINLKNIV
ACSA_RHOBA       PELAVAMLACARIGAIHSVIFAGFSAESIAERNNDASAKLVITSDGLYRRGKVLPLKATV
ACSA_LEPIC       PELAITILACTRIGAIHSVVFGGFSPEALQSRIDDCKPKLVVTADGGFRGGKPIELKKNV
ACSA_LEPIN       PELAITILACTRIGAIHSVVFGGFSPEALQSRIDDCKPKLVVTADGGFRGGKPIELKKNV
ACSA_LEPBL       PELAITILACTRIGAIHSVVFGGFSPEALQSRIDDCKPKLIVTADGGFRGGKPIELKRNV
ACSA_LEPBJ       PELAITILACTRIGAIHSVVFGGFSPEALQSRIDDCKPKLIVTADGGFRGGKPIELKRNV
ACSA_XANC8       VDAAVAMLACARIGAVHSVVFGGFAANSIADRVIDCQSKLIITADEGLRGGKKIPLKANV
ACSA_XANCP       VDAAVAMLACARIGAVHSVVFGGFAANSIADRVIDCQSKLIITADEGLRGGKKIPLKANV
ACSA_XANOM       VDAAVAMLACARIGAVHSVVFGGFAANSIADRVIDCQSKLIITADEGLRGGKKIPLKANV
ACSA_XANAC       VDAAVAMLACARIGAVHSVVFGGFAANSIADRVIDCQSKLIITADEGLRGGKKIPLKANV
ACSA_XYLFA       PDAVVAILACARIGAIHSVVFGGFAPNSIADRINDCGSKLIITADEGLRGGRKIPLKANV
ACSA_XYLFT       PDAVVAILACARIGAIHSVVFGGFAANSIADRVNDCGSKLIITADEGLRGGRKIPLKANV
ACSA_BDEBA       PDTAVAMLACARIGAVHSVVFAGFSPDSISDRILDGQCRFVITGDAGFRGSKVVALKENI
ACSA_NOVAD       PEAAVAMLACARIGAIHSIVFAGFSPDALAGRITDCDSRIVLTSDEGLRGGRKVPLKANV
ACSA_CAUVC       PLAAVAMLACARIGAVHSVVFGGFSPDSIAGRIQDCASHFVITADEGRRGGRRVPLKANI
ACSA_BRADU       PEAAYAMLACARIGAIHSVVFAGFSPDSLAQRINDCQSKVIITADEGLRGGKKVPLKANV
ACSA_BRASO       PEAAYAMLACARIGAIHSVVFAGFSPDSLAQRIKDCDSKVVITADEGLRGGRKVPLKANV
ACSA_RHOP5       PEAAFAMLACARIGAIHSVVFGGFSPDSLAQRITDCASKVVITADEGLRGGRTVPLKANV
ACSA_PARL1       PEAAYAMLACARIGAVHSVVFGGFSPDSLAGRIVDCASSCVITADEGVRGGRKIPLKANT
ACSA_RHOCB       PEAAYAMLACARIGAIHSIVFAGFSPDALANRINDCGAKLVITADTAPRGGRRTPLKANT
ACSA_BRUA2       PEAAYAMLACARIGAVHSVVFAGFSPEALAGRIVDCESTFVITADEGVRGGKPVALKENT
ACSA_BRUAB       PEAAYAMLACARIGAVHSVVFAGFSPEALAGRIVDCESTFVITADEGVRGGKPVALKENT
ACSA_BRUSU       PEAAYAMLACARIGAVHSVVFAGFSPEALAGRIVDCESTFVITADEGVRGGKPVALKENT
ACSA_BRUC2       PEAAYAMLACARIGAVHSVVFAGFSPEALAGRIVDCESTFVITADEGVRGGKPVALKENT
ACSA_BRUME       PEAAYAMLACARIGAVHSVVFAGFSPEALAGRIVDCESTFVITADEGVRGGKPVALKENT
ACSA_BRUSI       PEAAYAMLACARIGAVHSVVFAGFSPEALAGRIVDCESTFVITADEGVRGGKPVALKENT
ACSA_BRUO2       PEAAYAMLACARIGAVHSVVFAGFSPEALAGRIVDCESTFVITADEGVRGGKPVALKENT
ACSA_OCHA4       PEAAYAMLACARIGAVHSVVFAGFSPEALAGRIVDCESTFVITADEGVRGGKPVPLKENT
ACSA_AGRRH       PEAAYAMLACARIGAIHSVVFGGFSPEALGGRIVDCQSTFVITCDEGLRGGKPVPLKANV
ACSA_RHIEC       PEAAYAMLACARIGAVHSVVFGGFSPEALAGRIVDCESTFVITCDEGVRGGKPVPLKDNT
ACSA_RHIME       PEAAYAMLACARIGAIHSVVFGGFSPEALAGRIVDCESTFVITCDEGVRGGKPVALKENT
ACSA_SINMW       PEAAYAMLACTRIGAVHSVVFGGFSPEALAGRIVDCESTFVITCDEGVRGGKPVALKENT
ACSA_AGRFC       PEAAYAMLACARIGAVHSVVFGGFSPEALAGRIVDCESTFVITCDEGVRGGKPIPLKENT
ACSA_RHILO       PEAAYAMLACTRIGAIHSIVFGGFSPDALAGRIVDCESTFVITADEGLRGGKSIPLKENT
ACSA_BART1       PEAAYAMLACARIGAVHSVIFAGFSAEAIAGRIVDCESTFIITADHGLRGGKRINLKDNV
ACSA_BARHE       PEAAYAMLACARIGAIHSVIFAGFSPEAIAGRIVDCESTFIITANQGLRGGKQINLKDSV
ACSA_BARQU       PEAAYAMLACARIGAIHSVIFAGFSSEAIADRIVDCKSTFIITADQGLRGGKLIKLKNNI
ACSA_BARBK       PEAAYAMLACARIGAIHSVIFAGFSSEAIAGRLIDGQSTFIITADHALRGDKTIPLKDNV
ACSA_ECOLI       PEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITSDEGVRAGRSIPLKKNV
ACSA_ECO57       PEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSRLVITSDEGVRAGRSIPLKKNV
ACSA_ECOL6       PEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITSDEGVRAGRSIPLKKNV
ACSA_SALTI       PEAAVAMLACARIGAVHSVIFGGFSPEAIAGRIIDSSSRLVITADEGVRAGRSIPLKKNV
ACSA_SALTY       PEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRSIPLKKNV
ACSA_CITK8       PEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITADEGVRAGRGIPLKKNV
ACSA_CROS8       PEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSARLVITADEGVRAGRAIPLKKNV
ACSA_YERPA       PEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRAIPLKKNV
ACSA_YERPN       PEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRAIPLKKNV
ACSA_YERPE       PEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRAIPLKKNV
ACSA_YERPP       PEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRAIPLKKNV
ACSA_YERP3       PEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRAIPLKKNV
ACSA_YERPS       PEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHSKLVITADEGIRAGRAIPLKKNV
ACSA_YERE8       PEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSNSKLVITADEGIRAGRAIPLKKNV
ACSA_SERP5       PEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNSKLVITADEGLRAGRAVPLKKNV
ACSA_PHOLL       PEAAVAMLACARIGAIHSVIFAGFSPDAVSGRIIDSNTKLVITADEGLRAGRTIPLKKNV
ACSA_SODGM       PEAAVAMLACARIGAVHSVIFAGFSPEAIAGRIIDSSAKLVVTADEGLRAGRKIPLKKNI
ACSA_AERHH       PEAAIAMLACTRIGAVHSIVFGGFSPEALAGRIIDSGSSIVITADEGLRGGRPVPLKKNV
ACSA_AERS4       PEAAIAMLACTRIGAVHSIVFGGFSPEALAGRIIDSGSSIVITADEGLRGGRPVPLKKNV
ACSA_VIBVU       PEAAVAMLACTRIGAVHTIVFGGFSPEALAGRIIDSDAKVVITADEGVRGGRAVPLKKNV
ACSA_VIBVY       PEAAVAMLACTRIGAVHTIVFGGFSPEALAGRIIDSDAKVVITADEGVRGGRAVPLKKNV
ACSA_VIBPA       PEAAIAMLACTRIGAVHTVVFGGFSPEALSGRIIDSDAKVVITADEGVRGGRAVPLKKNV
ACSA_VIBCH       PEAAVAMLACTRIGAVHTIVFGGFSPEALAGRIIDSNAKLVITADEGVRGGRAVPLKKNV
ACSA_PHOPR       AEAAIAMLACTRIGAVHTIVFGGFSPEALAGRIVDSNAKLVITADEGVRAGRAVPLKKNV
ACSA_PSYIN       PEAAVAMLACTRIGAVHSIVFGGFSPDAIAGRIVDSSAKIVITADEGRRGGRVVPLKANV
ACSA_SHESR       PEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITADEGMRGGRAIPLKRNI
ACSA_SHESM       PEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITADEGMRGGRAIPLKRNI
ACSA_SHESA       PEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITADEGMRGGRAIPLKRNI
ACSA_SHEON       PEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKIVITSDEGMRGGRAIPLKRNI
ACSA_SHESW       PEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITSDEGMRGGRAIPLKRNI
ACSA_SHEPC       PEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVVITSDEGMRGGRAIPLKRNI
ACSA_SHEB5       PEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVIITSDEGMRGGRAIPLKRNI
ACSA_SHEB8       PEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVIITSDEGMRGGRAIPLKRNI
ACSA_SHEB9       PEAAVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVIITSDEGMRGGRAIPLKRNI
ACSA_SHEFN       PEAAVAMLACARIGAVHSVVFGGFSPDSIAARVIDGKSKVLITADEGIRGGRKIPLKRSI
ACSA_SHEPA       PEAAVAMLACARIGAIHSVVFGGFSPDSIASRVIDGNSKVVITADEGVRAGRIIPLKANI
ACSA_SHEHH       PEAAVAMLACARIGAIHSVVFGGFSPDSIASRVIDGNSKVVITADEGVRAGRIIPLKANI
ACSA_SHELP       PEAAVVMLACARIGAIHSVVFGGFSPDSIASRVIDGKSKVVITADEGVRGGRTIPLKANI
ACSA_SHESH       PEAAVVMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKVIITADEGVRGGRIIPLKANI
ACSA_SHEAM       VEATVAMLACARIGAVHSVVFGGFSPDSIASRVIDGKSKLLITADEGVRGGRKIPLKGNI
ACSA_SHEDO       PEAAVAMLACARIGAVHSVIFGGFSPDSIASRVIDGKSKVIITADEGIRAGRTIPLKHNV
ACSA_PSEU2       PEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCSSKVVITADEGLRGGKKTALKANV
ACSA_PSE14       PEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCSSKVVITADEGLRGGKKTALKANV
ACSA_PSESM       PEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCSSKVVITADEGLRGGKKTALKANV
ACSA1_PSEPK      PEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCKSKVVITADEGVRGGRRTPLKANV
ACSA1_PSEAE      PEAVVAMLACTRIGAIHSVVFGGFSPEALAGRIIDCKSKVVITADEGVRGGKRTPLKANV
ACSA_PSEU5       PEAAVAMLACARIGAIHSVVFGGFSPEALAGRIIDGSSKVVITADQGIRGGKTIALKENV
ACSA_MARHV       VETAVAMLACARIGAIHSVVFGGFSPEALAARIVNGKSRFVITADEGLRGGRAIPLKKNV
ACSA2_PSEAE      PEAAYAMLACARIGAVHSVVFGGFSPDSLRDRILDADCRTVITADEGVRGGKYIPLKQNV
ACSA2_PSEPK      PEAAFAMLACTRIGAIHSVVFGGFSPDALRDRILDADCRTVITADEGVRGGKRIPLKQNV
ACSA_ALKEH       PEAAVAMLACARIGAIHSIVFGGFSPDALKDRIQNADCETVITADEGVRGGRNVALKSNA
ACSA_HALHL       PEAAVAMLACARIGAVHSIVFGGFSPEALRDRIQDADAEVVITSDEGVRGGRSIPLKANT
ACSA_MAGMM       PEAAVAMLACTRIGAVHSIVFGGFSPDALRDRIIDAECRVVITADGGMRGSKKIPLRKNV
ACSA_SACD2       PEAAYAMLACARIGAVHSIVFGGFSPEALKDRIVDSDCKVLITADEGLRGGRAVALKANA
ACSA_ALCBS       PEAAYAMLACARIGAIHSVVFGGFSPEALKDRILNAEACALITADEGVRGGKTIPLKVNA
ACSA_PRB01       IETAFAMLACTRIGAVHSVVFGGFSPESLKDRILDADCKIVITADEGLRGGKKVPLKSNV
ACSA_THIDA       IEAVVAMQACARIGAIHSVVFGGFSAKSLFERIEDAQAKLIVTADESLRGGKAVPLKRAA
ACSA_CHRVO       IEAVVTMQACARIGAIHSVVFGGFSAGAVRDRIQDAGATVVVTANESVRGGKNVPLKATV
ACSA_NITEU       IEAVVAMQACARIGAIHSVVFGGFSAKSVYERIIDAGASAVITADEQIRGGRYHPLKATV
ACSA_NITEC       IEAVVAMQACARIGVIHSVVFGGFSAKSVYERIIDAGASAVITADEQTRGGKRHALKATV
ACSA_METFK       IEAIVAMQACARIGAIHSVVFGGFSAKSLHERIVDVGAKLVITADAGIRGGKQVALKASV
ACSA_CUPNH       VEGVVAMQACARLGATHSVVFGGFSAKSLQERLVDVGAVALITADEQMRGGKALPLKAIA
ACSA_CUPPJ       VEGVVAMQACARLGATHSVVFGGFSAKSLQERLVDVGAVALITADEQMRGGKALPLKAIA
ACSA_CUPMC       VEGVVAMQACARIGATHSVVFGGFSAKSLQERLVDVGAVALITADEQMRGGKALPLKAIA
ACSA_RALSO       IEGVVAMQACARIGATHSVVFGGFSAKSLQERIVDVGAVAVITADEQMRGGKALPLKAIA
ACSA_BURP0       VEGIVAMQACARIGATHSVVFGGFSSKSLHERIVDVGATALVTADEQMRGGKTLPLKSIA
ACSA_BURMA       VEGIVAMQACARIGATHSVVFGGFSSKSLHERIVDVGATALVTADEQMRGGKTLPLKSIA
ACSA_BURP6       VEGIVAMQACARIGATHSVVFGGFSSKSLHERIVDVGATALVTADEQMRGGKTLPLKSIA
ACSA_BURP1       VEGIVAMQACARIGATHSVVFGGFSSKSLHERIVDVGATALVTADEQMRGGKTLPLKSIA
ACSA_BURM7       VEGIVAMQACARIGATHSVVFGGFSSKSLHERIVDVGATALVTADEQMRGGKTLPLKSIA
ACSA_BURPS       VEGIVAMQACARIGATHSVVFGGFSSKSLHERIVDVGATALVTADEQMRGGKTLPLKSIA
ACSA_BURM9       VEGIVAMQACARIGATHSVVFGGFSSKSLHERIVDVGATALVTADEQMRGGKTLPLKSIA
ACSA_BURMS       VEGIVAMQACARIGATHSVVFGGFSSKSLHERIVDVGATALVTADEQMRGGKTLPLKSIA
ACSA_BURTA       VEGIVAMQACARIGATHSVVFGGFSSKSLHERIVDVGATALVTADEQMRGGKTLPLKSIA
ACSA_BURL3       IEGIVAMQACARIGATHSVVFGGFSAKSLNERLVDVGATALITADEQARGGKTLPLKSIA
ACSA_HERAR       IDGIAAMQACARIGATHSVVFGGFSAKSLHERIIDAGAVAVLTADYQVRGGKNLPLKAIV
ACSA_PASMU       VEAVIAMQACARIGAVHSVVFGGFSASALRDRIEDAEAKLVITANAGLRGGKIIPLKETV
ACSA_HELPY       VESVYMMLACTRIGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFRKGKPYMLKPAL
ACSA_HELPH       VESVYMMLACARIGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFRKGKPYMLKPAL
ACSA_HELAH       AESVYMMLACTRIGAIHSIVFAGFSPEALRDRINDAQAKLVITADGTFRKGKPYMLKPAL
ACSA_CAMJJ       PETAIVMLACARIGAIHSVVFGGFSPEALRDRIIDAGAKLVVTADGAFRRGKPYMLKPAV
ACSA_CAMJE       PETAIVMLACARIGAIHSVVFGGFSPEALRDRIIDAGAKLVVTADGAFRRGKPYMLKPAV
ACSA_CAMJ8       PETAIVMLACARIGAIHSVVFGGFSPEALRDRIIDAGAKLVVTADGAFRRGKPYMLKPAV
ACSA_WOLSU       PEAAFMMLACARIGAIHSVVFGGFSAEALRDRIIDAEAKLVITADGAYRRGKPYMLKPVV
ACSA_RUBXD       PELPIAMLACARIGAPHSVVFGAFSAQSLRDRINDCEAKVLVTADSGPRGGKRTPLKANA
ACSA_STRAW       PEAVVAMLACARIGAAHSVVFGGFSADAIAARIKDADAKLVITADGGYRRGKPSALKPAV
ACSA_STRCO       PETAIAMLACARIGAAHSVVFGGFSSDALATRIQDADARVVITADGGYRRGKPSALKPAV
ACSA_MYCBO       PEAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAKLLITADGQFRRGKPSPLKAAA
ACSA_MYCTU       PEAVIAMLACARLGIMHSVVFGGFTAAALQARIVDAQAKLLITADGQFRRGKPSPLKAAA
ACSA_PYRAE       PELPITMLAAWRIGAITSVVFSGFSADALAERINDSQSRIVITADGFWRRGRVVRLKEVV
ACSA_PYRAR       PELPITMLAAWRIGAITNVVFSGFSADALAERINDSQSRIVITADGFWRRGKVVRLKEVV
ACSA_METSH       PQLPIAMLACAKLGVSHIVVFSGFSSKGLMDRAAHCGSRAIITVDGFYRRGKPVPLKPNA
                       : *. ::*    ::*..*:  .:  *  .     ::  :   * .    *:   

ACSA_THET8       DEALKD----ATSVEHVVVVRRTGEE--VPWTP-GRDHWWHELMEA--APDRCDPEPMEA
ACSA_THET2       DEALKD----ATSVEHVVVVRRTGEE--VPWTP-GRDHWWHELMEA--APDRCDPESMEA
ACSA_SYNY3       DKALEH-G--APSVENVIVVQRTKAD--VTMTA-GRDHWWHELQPQ--QSAHCPAEPIDS
ACSA_THEEB       DKALAHQG--VPSVENVLVVQRTQQP--VTMVP-GRDHWWHDLQKG--VSADCPAEPMDS
ACSA_DEIRA       DEAAKL----APCLEHVLVVKRAGIP--LEWWTEGRDLWWHDVVDR--QSDQHEATALDS
ACSA_CHLTE       DEAIIN----TPSVKNVIVLKVTGEE--IHMHD-GMDHWWHDLMGL--AVDECEPAQVDS
ACSA_RHOBA       DEALEK----SPTVEKCLVLRRTGDD--APMQE-GRDVWWHDVVEN--QPGEMAAKPLDS
ACSA_LEPIC       DLALEKS---KEKVKTVIVVRRTGNESGLTWKD-GQDYWYHFLMNDPELSAYCKPEEMDA
ACSA_LEPIN       DLALEKS---KEKVKTVIVVRRTGNESGLTWKD-GQDYWYHFLMNDPELSAYCKPEEMDA
ACSA_LEPBL       DIALEKS---KEDVKTVIVVRRTGNESGLVWKD-GRDYWYHFLISDPDLSPYCKPESMDA
ACSA_LEPBJ       DIALEKS---KEDVKTVIVVRRTGNESGLVWKD-GRDYWYHFLIGDPDLSPYCKPESMDA
ACSA_XANC8       DAALKI--PGTNTVETVLVVRHTGGA--VDMQA-PRDRWFHDVVDG--QPAECEPERMNA
ACSA_XANCP       DAALKI--PGTNTVETVLVVRHTGGA--VDMQA-PRDRWFHDVVDG--QPAECEPERMNA
ACSA_XANOM       DAALKI--PGTNTIETVLVVRHTGGA--VEMQA-PRDRWFHDVVDG--QPAECEPERMNA
ACSA_XANAC       DAALKI--PGTNTVETVLVVRHTGGA--VEMQA-PRDRWFHDVVDG--QPAACEPERMNA
ACSA_XYLFA       DAALKI--HGTQSVETVLVVRHTGGT--INMHT-PRDRWFHHVVDI--QATECAPERMNA
ACSA_XYLFT       DAALKI--HGTQSVETVLVVRHTGST--INMHT-PRDRWFHDLVDI--QATECAPERMNA
ACSA_BDEBA       DKALV----KTPDVQKVLVVKYAGTT--VDMKP-GRDLWYHEEVKT--VSDQCEPEPMDA
ACSA_NOVAD       DEALK----QCPGVDTVIMLRRTGAD--VDFVE-GRDIDWATAVAE--QSADCQPEEMNA
ACSA_CAUVC       DEALK----HCPWVGKVLMIRWTGAD--VPLKA-GRDIVWQDVRDT--VSADCPPEPMNA
ACSA_BRADU       DAALAKAD----GVDWVVVVKRTGGK--IDMNP-TRDLWYHEAAAM--VTTECPVEHMHA
ACSA_BRASO       DAALNKVD----NVDWVVVVKRTGGK--IEMNP-TRDLWYHEAAEM--VTTECPVEHMNA
ACSA_RHOP5       DAALRKSS----AVDWVVVVKRTGAD--VFMDD-VRDFWYHEAAEM--VTTECPVEPMHA
ACSA_PARL1       DEALKKCP----GVKSVIVVKHTGGA--VAMEK-GRDVWYAEEAAK--VSATCAPEEMNA
ACSA_RHOCB       DAALLHCS----DKVRCLVVKHTGDQ--ISWVH-GRDVDLLYLMEH--VSPECPPRPMNA
ACSA_BRUA2       DTAIDIAAKQYVMVNKVLVVRRTGGK--VSWGR-GRDLWYHQEVAS--VEPHCEPEPMNA
ACSA_BRUAB       DTAIDIAAKQYVMVNKVLVVRRTGGK--VSWGR-GRDLWYHQEVAS--VEPHCEPEPMNA
ACSA_BRUSU       DTAIDIAAKQYVMVNKVLVVRRTGGK--VSWGR-GRDLWYHQEVAS--VEPHCEPEPMNA
ACSA_BRUC2       DTAIDIAAKQYVMVNKVLVVRRTGGK--VSWGR-GRDLWYHQEVAS--VEPHCEPEPMNA
ACSA_BRUME       DTAIDIAAKQYVMVNKVLVVRRTGGK--VSWGR-GRDLWYHQEVAS--VEPHCEPEPMNA
ACSA_BRUSI       DTAIDIAAKQYVMVNKVLVVRRTGGK--VSWGR-GRDLWYHQEVAS--VEPHCEPEPMNA
ACSA_BRUO2       DTAIDIAAKQYVMVNKVLVVRRTGGK--VSWGR-GRDLWYHQEVAS--VEPHCEPEPMNA
ACSA_OCHA4       DTAIDIAAKQYVMVNKVLTVRRTGGK--VSWGP-GRDLWYHQEVAS--VEPTCDPEPMNA
ACSA_AGRRH       DKAIDIAARGHVMVKNVLVIRRTGSP--LSWAP-GRDLWHHEEAAT--VSADCPPEPMKA
ACSA_RHIEC       DTAIHIAARQHVNVSKVLVVRRTGGK--TGWAP-GRDLWYHQEVAT--VKAECPPVKMKA
ACSA_RHIME       DTAIDIAARQHVTVSKVLVVRRTGGK--VGWAP-GRDLWYHQETAA--AEPHCPPEKMNA
ACSA_SINMW       DTAVGIAAKQNVTVGKVLVVRRTGGK--VGWAP-ERDLWYHQETAA--VEPHCPPERMNA
ACSA_AGRFC       DKAIDIAAKQYVIVNKVLVVRRTGGK--TGWAP-GRDIWYHQEIAT--VKPDCPPVKMRA
ACSA_RHILO       DKAIDIAAKNFVMVKNVLVVRRTGGK--VGWAP-GRDLWYHDEVAT--VKAECKPEKMKA
ACSA_BART1       DHAIEIAARQNVRVDQVMVIRRTCGP--IDWIE-GRDFWYHEEITH--AKTNCPAEPMNA
ACSA_BARHE       DHAIEIAARQNVHVDQVMVIRRTCGP--IHWVE-GRDFWYHEEVSH--TKTDCPAEKMNA
ACSA_BARQU       DHAIDIAARRGVHVNQVLVIRRTSGT--IDWVK-GRDFWYHEEISH--AKTDCPAEMMNA
ACSA_BARBK       DRAIHIAACQNVNVTQVMVIRRTSKI--IHWVN-GRDFWYHEEMPH--ATPDCPPEHMNA
ACSA_ECOLI       DDALKNP--NVTSVEHVVVLKRTGGK--IDWQE-GRDLWWHDLVEQ--ASDQHQAEEMNA
ACSA_ECO57       DDALKNP--NVTSVEHVVVLKRTGGK--IDWQE-GRDLWWHDQVEQ--ASDQHQAEEMNA
ACSA_ECOL6       DDALKNP--NVTSVEHVVVLKRTGGK--IDWQE-GRDLWWHDLVEQ--ASAQHQAEEMNA
ACSA_SALTI       DDALKNP--NVTSVEHVIVLKRTGND--IDWQE-GRDLWWRDLIEK--ASPEHQPEAMNA
ACSA_SALTY       DDALKNP--NVTSVEHVIVLKRTGSD--IDWQE-GRDLWWRDLIEK--ASPEHQPEAMNA
ACSA_CITK8       DDALKNP--NVNSVEHVVVLKRTGGK--VDWHE-GRDLWWSDVIEK--SSADHQPEEMNA
ACSA_CROS8       DDALKNP--GVTSVEHVVVFKRTGGN--IEWHE-GRDLWWSELVKK--ASAHHQPVEMNA
ACSA_YERPA       DEALKNP--AITSIKNVVVFQRTGNA--SYWED-GRDVWWHDLIKE--ASADCPPEEMNA
ACSA_YERPN       DEALKNP--AITSIKNVVVFQRTGNA--SYWED-GRDVWWHDLIKE--ASADCPPEEMNA
ACSA_YERPE       DEALKNP--AITSIKNVVVFQRTGNA--SYWED-GRDVWWHDLIKE--ASADCPPEEMNA
ACSA_YERPP       DEALKNP--AITSIKNVVVFQRTGNA--SYWED-GRDVWWHDLIKE--ASADCPPEEMNA
ACSA_YERP3       DEALKNP--AITSIKNVVVFQRTGNA--SYWED-GRDVWWHDLIKE--ASADCPPEEMNA
ACSA_YERPS       DEALKNP--AITSIKNVVVFQRTGNA--SYWED-GRDVWWHDLIKE--ASADCPPEEMNA
ACSA_YERE8       DEALKNP--AITSIKNVVVFQRTGNA--SYWKD-GRDVWWHDLIKD--ASVDCPPEEMNA
ACSA_SERP5       DDALKNP--GVKSITNVVVFQRTGKP--GYWQE-GRDLWWHELTAG--VSADCPPEEMNA
ACSA_PHOLL       DDALNNA--AVVNVSNVIVFKRTGNI--GHWQS-GRDLWWHELVAD--ASADCPVEEINA
ACSA_SODGM       DDALNHP--EVKSVNRVIVFRRTGNA--IDWQP-ERDVWWHDAIDG--ADDTCPPEAMGA
ACSA_AERHH       DEALTNP--ETK-VNNVIVLKRTGGN--IAWHN-HRDIWWHDAVAT--VSADCPPEAMGA
ACSA_AERS4       DEALTNP--DTR-VSKVIVLKRTGGN--VAWHN-HRDIWWHEATAA--ASSDCPPEAMNA
ACSA_VIBVU       DEALTNP--EVKTISKVVVFKRTGGN--IDWHE-HRDVWWHEATAK--VSDVCPPEEMKA
ACSA_VIBVY       DEALTNP--EVKTISKVVVFKRTGGN--IDWHE-HRDVWWHEATAK--VSDVCPPEEMKA
ACSA_VIBPA       DEALTNP--EVKTISKVVVLKRTGGN--VDWHG-HRDVWWHEATAK--VSDVCPPEEMKA
ACSA_VIBCH       DEALCNP--EVKNISKVMVLKRTGGN--VAWHE-HRDIWWHEATAK--ASDNCPPEEMKA
ACSA_PHOPR       DDALANK--NVTSIEKVIVLKRTGGN--VEWHS-ERDVWWHEATAV--ASSHCEPEEMNA
ACSA_PSYIN       DEALTKD--GTDCVKSVIVFKNTGGE--VNWVV-GRDLDWESVCAD--ESSECEPEAMNA
ACSA_SHESR       DDALKHP--DVTSVEKVIVLKRTGGK--VDWVE-GRDVWWHSLVET--ASEHCAIEEMGA
ACSA_SHESM       DDALKHP--DVTSVEKVIVLKRTGGK--VDWIE-GRDVWWHSLVET--ASEHCAVEEMGA
ACSA_SHESA       DDALKHP--DVTSVEKVIVLKRTGGK--VDWVE-GRDVWWHSLVET--ASEHCAIEEMGA
ACSA_SHEON       DDALKHP--DVTSVEKVIVLKRTGGK--IDWVE-GRDVWWHSLVET--ASEHCAVEEMGA
ACSA_SHESW       DDALNHP--DVTSVEKVIVLKRTGGK--IDWVE-GRDVWWHSLLET--ASEHCQPEEMGA
ACSA_SHEPC       DDALNHP--DVTSVEKVIVLKRTGGK--IDWVE-GRDVWWHSLLET--ASEHCQPEEMGA
ACSA_SHEB5       DDALKNP--DVTTVEKVIVLKRTGGK--VDWVE-GRDVWWHSLMET--ASEYCQPEEMDA
ACSA_SHEB8       DDALKNP--DVTTVEKVIVLKRTGGK--VDWVE-GRDVWWHSLMET--ASEYCQPEEMDA
ACSA_SHEB9       DDALKNP--DVTTVEKVIVLKRTGGI--VDWVE-DRDVWWHSLMET--ASEYCQPEEMDA
ACSA_SHEFN       DEAISNP--DVTCVEKVIVFKRTGGD--IDWVE-GRDVWWHSLMEV--ASEFCQPAEMNA
ACSA_SHEPA       DEALSHP--DVNCVEKVIVMKRTGGD--INWVE-GRDIWWGSLMET--ASEHCIPEEMGA
ACSA_SHEHH       DEALSHP--DVNCVEKVIVMKRTGGD--INWVE-GRDIWWDSLMDT--ASEHCIAEEMGA
ACSA_SHELP       DEALSHP--DVTCVEKVIVLERTGNP--VNWVE-GRDIKWASLMET--ASEHCVAEEMGA
ACSA_SHESH       DEALSHP--DVDCVEKVIVLERTGGD--VNWVE-GRDIKWESLMDT--ASEHCIPEEMGA
ACSA_SHEAM       DEALNRP--DVTTVETVIVLKRTGGA--VNWVE-GRDKWWHQVTDG--AATECAVEEMGA
ACSA_SHEDO       DEALARP--SVTCVNNVIVLKRTGAN--VDWQQ-GRDLDWDELMAG--VSSDCPAEEMNA
ACSA_PSEU2       DRALTNP--ETSSVQKVIVCKRTGGE--IEWNR-HRDIWYHSLLEV--ASSTCAPKEMGA
ACSA_PSE14       DRALTNP--ETSSVQKVIVCKRTGGE--IEWNR-HRDIWYHSLLEV--ASSTCAPKEMGA
ACSA_PSESM       DRALTNP--ETSSVQKVIVCKRTGGE--IEWNR-HRDIWYHALLEV--ASSTCAPKEMGA
ACSA1_PSEPK      DLALTNP--ETSSVQKIIVCKRTGGD--IAWHQ-HRDIWYEDLMKV--ASSHCAPKEMGA
ACSA1_PSEAE      DDALTNP--ETSSVQKIIVCKRTGAE--IKWNQ-HRDVWYDDLMKV--AGSTCAPKEMGA
ACSA_PSEU5       DEALTNP--QTRCVQKIIVVRRTGAN--IRWYP-HRDVSYDDLMRV--AGEVCAPKEMGA
ACSA_MARHV       DSALKHE--DDAKVDKVIVVSRTGNDQ-VPWTE-GRDLRYEDLMKN--ASAECQPEPMNA
ACSA2_PSEAE      EKALKDC----PDVSTVVVVERTQGD--IPWVE-GRDIWYHEALHA--ASADCPAEAMDA
ACSA2_PSEPK      DKALASC----PAVSSVLVVRRTGGD--VAWTE-GRDLWYHEATKD--AGDDCPPEPMEA
ACSA_ALKEH       DKALESC----PDVKNVFVVKRTGGD--IDWKE-GRDIWYHEAVAD--VSADCPAEELDA
ACSA_HALHL       DKALEGC----PNVKTVFVVRRTGGD--IAWND-GRDVWFHEACAE--ASPDCPPEHMDA
ACSA_MAGMM       ETALAQC----PNVHTCFVVQDTQLE--IEWTE-GRDVWYHEAIAA--ASADCPPEEMDA
ACSA_SACD2       DKAVAHC----PQVHSVIVVKRTGAD--VAWNT-ERDIWLHEAQQS--VDTVCEPESMDS
ACSA_ALCBS       DKALDGI----DCVHTCLTVKRTGGD--VDWQA-PRDVWYHEAMAD--ASSDCEPEWVEA
ACSA_PRB01       DEALLGC----PDVKNTLVIKRTGGE--INWDD-KKDVWYEDLVKD--VSNKCAPEPMDS
ACSA_THIDA       DEALAMGD--TSCVERVVVYRRSGGE--VNWS--ARDLWWHELTQT--QAETCEPVWVSA
ACSA_CHRVO       DEALALEG--AESVRHVVVYQRTNGG--ADWTD-GRDVWWHKLIEG--QSEACEPEWMGA
ACSA_NITEU       DEALAMGD--TATVHSVIVFRHTGTG--ITWQP-ERDHWWHDLIAG--QPDECEPAWINA
ACSA_NITEC       DEALAMGD--TTSVHSVIVFRHTGTD--IPWQP-ERDRWWHNLTAS--QSDECEPIWVNA
ACSA_METFK       DEALELGG--CESVEKVIVYQRTGVD--IAWNP-HRDAWWHEVEAA--ENDNCEPVWVDA
ACSA_CUPNH       DDALALGG--CEAVRNVIVYRRTGGK--VAWTE-GRDRWMEDVSAG--QPDTCEAEPVSA
ACSA_CUPPJ       DDALALGG--CEAVKNVIVYRRTGGK--VNWVE-GRDRWMEDVSAG--QPDTCEAVPVSA
ACSA_CUPMC       DEALTLGG--CEAVKNVIVYRRTGGN--VAWTE-GRDRSMEDVAAG--QSDNCPAEPVGA
ACSA_RALSO       DEALAMEG--SEAVRHVIVYRRTGAG--VNWVE-GRDRAMDEVEAG--QPDTCEVTPVGA
ACSA_BURP0       DEALAMGG--CDAVKTVVVYRRTGGN--VDWHA-GRDVWMHEMVAN--ESDACEPEWVGA
ACSA_BURMA       DEALAMGG--CDAVKTVVVYRRTGGN--VDWHA-GRDVWMHEMVAN--ESDACEPEWVGA
ACSA_BURP6       DEALAMGG--CDAVKTVVVYRRTGGN--VDWHA-GRDVWMHEMVAN--ESDACEPEWVGA
ACSA_BURP1       DEALAMGG--CDAVKTVVVYRRTGGN--VDWHA-GRDVWMHEMVAN--ESDACEPEWVGA
ACSA_BURM7       DEALAMGG--CDAVKTVVVYRRTGGN--VDWHA-GRDVWMHEMVAN--ESDACEPEWVGA
ACSA_BURPS       DEALAMGG--CDAVKTVVVYRRTGGN--VDWHA-GRDVWMHEMVAN--ESDACEPEWVGA
ACSA_BURM9       DEALAMGG--CDAVKTVVVYRRTGGN--VDWHA-GRDVWMHEMVAN--ESDACEPEWVGA
ACSA_BURMS       DEALAMGG--CDAVKTVVVYRRTGGN--VDWHA-GRDVWMHEMVAN--ESDACEPEWVGA
ACSA_BURTA       DEALAMGG--CDAVKTVVVYRRTGGN--VDWHA-GRDVWMHEIVAN--ESDACEPEWVGA
ACSA_BURL3       DEAIALGG--CEAVKSVIVYRRTGGK--IDWHA-ERDLWMHELTAG--ESDQCEPEWVGA
ACSA_HERAR       DEALAMGG--CDTIRNVVVYKRTGGA--VDFVE-RRDIWLHELVEQ--RTSECAPEPVGA
ACSA_PASMU       DEALEMG---CKTIENVIVFHRVNID--TPWKK-GRDLWWNELTAN--QPAFCEPEWMNA
ACSA_HELPY       DKALENNA--CPSVEKALIVIRNAKE--IDYVR-GRDFVYNEMVNY--QSDKCEPEMMDS
ACSA_HELPH       DKALENNA--CPSVEKALIVIRNAKE--IDYVR-GRDFVYNEMVNY--QSDKCEPEMMDS
ACSA_HELAH       DKALANNT--CPSVEKTLIVIRNAKE--IDYVR-GRDFVYNEMVNY--QSDKCEPEMMDS
ACSA_CAMJJ       DKAL-SEG--CESVEKVLIVIRNNEP--IEYIK-GRDYVYNELVKN--ESYKCEPEIMDS
ACSA_CAMJE       DKAL-SEG--CESVEKVLIVIRNNEP--IEYIK-GRDYVYNELVKN--ESYKCEPEIMDS
ACSA_CAMJ8       DKAL-SEG--CESVEKVLIVIRNNEP--IEYIK-GRDYVYNELVKN--ESYKCEPEIMDS
ACSA_WOLSU       DDALAEGA--CPSIEKVLIVIRNKEE--INYVP-GRDYIYNEMIGL--ESAHCPPEPMDA
ACSA_RUBXD       DEALEDT----PSIEKVVVVRRTGDE--VNMVE-GRDLWWHELMRE--AEPECPAEEMDS
ACSA_STRAW       DDAVSR----GDGVEKVLVVRRTGQ--EVAWTE-GRDVWWHEITAK--QSAEHTPEAFDA
ACSA_STRCO       DEAVER----AGIVEHVLVVRRTGQ--DVAWDD-SRDKWWHETVDG--QSAEHTPEAFDA
ACSA_MYCBO       DEALAAIP--DCSVEHVLVVRRTGI--EMAWSE-GRDLWWHHVVGS--ASPAHTPEPFDS
ACSA_MYCTU       DEALAAIP--DCSVEHVLVVRRTGI--EMAWSE-GRDLWWHHVVGS--ASPAHTPEPFDS
ACSA_PYRAE       DAALEK----ATGVESVIVLPRLGLK-DVPMTE-GRDYWWNKLMQGIPPNAYIEPEPVES
ACSA_PYRAR       DSALEK----APGVENVIVLPRLGLK-DVPMTE-GRDFWWNRLMQGIPPNTYIEPEPVES
ACSA_METSH       DEAAGG----APSVEKIIVYKRAGV--DVSMKE-GRDVWWHDLVKG--QSEECEPVWVDP
                 : *              .                  *                    . .

ACSA_THET8       EEPLFILYTSGSTGKPKGVLHTTGGYMTYVYYTTKLVFDLKD-EDVYWCTADVGWITGHS
ACSA_THET2       EEPLFILYTSGSTGKPKGVLHTTGGYMTYVYYTTKLVFDLKD-EDVYWCTADVGWITGHS
ACSA_SYNY3       EDMLFILYTSGSTGKPKGVVHTTGGYNLYTHMTTKWIFDLKD-TDVYWCTADVGWITGHS
ACSA_THEEB       EDLLFILYTSGSTGKPKGVVHTTAGYNLYTHITTQWVFDLQD-TDVYWCTADVGWITGHS
ACSA_DEIRA       EHPLFILYTSGSTGAPKGVQHTTGGYMVGTYLTTQTVFDLRD-DDIYWCTADIGWITGHS
ACSA_CHLTE       EHPLFLLYTSGSTGKPKGILHTTAGYMVHAASSFKYVFDIKD-EDIYFCTADIGWITGHT
ACSA_RHOBA       ETPLFILYTSGSTGKPKGILHTTAGYNLWAKRTFEWVFDHRE-GDVYWCTADCGWITGHS
ACSA_LEPIC       EDPLFILYTSGSTGKPKGVLHTTGGYLLGANLTFHYVFDIKP-EDTYWCTADIGWVTGHS
ACSA_LEPIN       EDPLFILYTSGSTGKPKGVLHTTGGYLLGANLTFHYVFDIKP-EDTYWCTADIGWVTGHS
ACSA_LEPBL       EDPLFILYTSGSTGKPKGVLHTTGGYLLGVNLTFHYVFDIKP-EDTYWCTADIGWVTGHS
ACSA_LEPBJ       EDPLFILYTSGSTGKPKGVLHTTGGYLLGVNLTFHYVFDIKP-EDTYWCTADIGWVTGHS
ACSA_XANC8       EDPLFILYTSGSTGKPKGVLHTTAGYLLFASYTHEVVFDLRE-DDIYWCTADVGWVTGHS
ACSA_XANCP       EDPLFILYTSGSTGKPKGVLHTTAGYLLFASYTHEVVFDLRE-DDIYWCTADVGWVTGHS
ACSA_XANOM       EDPLFILYTSGSTGKPKGVLHTTAGYLLFASYTHEVVFDLRE-DDIYWCTADVGWVTGHS
ACSA_XANAC       EDPLFILYTSGSTGKPKGVLHTTAGYLLFASYTHEVVFDLRE-DDIYWCTADVGWVTGHS
ACSA_XYLFA       EDPLFILYTSGSTGKPKGVLHTTGGYLVYTSYTHETVFDLRE-NDIYWCTADIGWITGHS
ACSA_XYLFT       EDSLFILYTSGSTGKPKGVLHTTGGYLVYTSYTHETVFDLRE-NDIYWCTADIGWITGHS
ACSA_BDEBA       EDPLFILYTSGSTGKPKGVMHTTGGYLVYASMTHQYVFDYHE-DDIYWCSADVGWVTGHS
ACSA_NOVAD       EDPLFILYTSGSTGKPKGVLHTTGGYSVWASMTHQYVFDYRP-GQIYWCAADIGWVTGHS
ACSA_CAUVC       EDPLFILYTSGSTGKPKGVLHTTGGYLAWASWTFWAVFDYKP-GEVFWCTADVGWVTGHS
ACSA_BRADU       EDPLFILYTSGSTGQPKGVLHTSAGYLVYAAMTHQYVFDYHD-GDIYWCTADVGWVTGHS
ACSA_BRASO       EDALFILYTSGSTGQPKGVLHTTGGYLVYASMTHQYVFDYHE-GDVYWCTADVGWVTGHS
ACSA_RHOP5       EDPLFILYTSGSTGQPKGVLHTTGGYLVFASMTHQYVFDYHD-GDVYWCTADVGWVTGHS
ACSA_PARL1       EDPLFILYTSGSTGKPKGVLHTTGGYMVYASMTHQYVFDYHD-GDIYWCTADVGWVTGHS
ACSA_RHOCB       EDPLFILYTSGSTGKPKGVVHTTGGYLVYAAMTHQYTFDYKD-GDVFWCTADVGWVTGHS
ACSA_BRUA2       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHD-GEIYWCTADVGWVTGHS
ACSA_BRUAB       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHD-GEIYWCTADVGWVTGHS
ACSA_BRUSU       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHD-GEIYWCTADVGWVTGHS
ACSA_BRUC2       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHD-GEIYWCTADVGWVTGHS
ACSA_BRUME       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHD-GEIYWCTADVGWVTGHS
ACSA_BRUSI       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHD-GEIYWCTADVGWVTGHS
ACSA_BRUO2       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHD-GEIYWCTADVGWVTGHS
ACSA_OCHA4       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHD-GDIYWCTADVGWVTGHS
ACSA_AGRRH       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHEYVFDYQH-GDIYWCTADVGWVTGHS
ACSA_RHIEC       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHEYVFDYHH-GDIYWCTADVGWVTGHS
ACSA_RHIME       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYQD-GDIYWCTADVGWVTGHS
ACSA_SINMW       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYQD-GDIYWCTADVGWVTGHS
ACSA_AGRFC       EDPLFILYTSGSTGKPKGVLHTTGGYLVYTSMTHEYVFDYKD-GEVFWCTADVGWVTGHS
ACSA_RHILO       EDPLFILYTSGSTGKPKGVLHTTAGYLVYASMTHQYVFDYHD-GDIYWCTADVGWVTGHS
ACSA_BART1       EDPLFILYTSGSTGKPKGVLHSTGGYLVYAAITHKYVFDYHP-GEIYWCTADIGWITGHS
ACSA_BARHE       EDPLFILYTSGSTGKPKGVLHTTAGYLVYASMTHKYVFDYHA-GEIYWCTADIGWITGHS
ACSA_BARQU       EDPLFILYTSGSTGKPKGVLHTTAGYLVYVSMTHQYVFDYHP-GEIYWCTADIGWISGHS
ACSA_BARBK       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHP-GEIYWCTADIGWITGHS
ACSA_ECOLI       EDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHP-GDIYWCTADVGWVTGHS
ACSA_ECO57       EDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHP-GDIYWCTADVGWVTGHS
ACSA_ECOL6       EDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHP-GDIYWCTADVGWVTGHS
ACSA_SALTI       EDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHP-GDIYWCTADVGWVTGHS
ACSA_SALTY       EDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHP-GDIYWCTADVGWVTGHS
ACSA_CITK8       EDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHP-DDIYWCTADVGWVTGHS
ACSA_CROS8       EDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFLYAFDYHP-GDIYWCTADVGWVTGHS
ACSA_YERPA       EDPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYVFDYHP-GDIYWCTADVGWVTGHS
ACSA_YERPN       EDPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYVFDYHP-GDIYWCTADVGWVTGHS
ACSA_YERPE       EDPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYVFDYHP-GDIYWCTADVGWVTGHS
ACSA_YERPP       EDPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYVFDYHP-GDIYWCTADVGWVTGHS
ACSA_YERP3       EDPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYVFDYHP-GDIYWCTADVGWVTGHS
ACSA_YERPS       EDPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYVFDYHP-GDIYWCTADVGWVTGHS
ACSA_YERE8       EDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHP-GDIYWCTADVGWVTGHS
ACSA_SERP5       EDPLFILYTSGSTGKPKGVLHTTGGYLVYAAMTFKYVFDYHD-GDVYWCTADVGWVTGHS
ACSA_PHOLL       EDPLFILYTSGSTGKPKGVLHTTGGYLVYASLTFKYVFDYQP-GEVYWCTADVGWVTGHS
ACSA_SODGM       EDPLFILYTSGSTGTPKGVLHTTGGYLVYAATTFKYVFDYHP-GDVYWCTADVGWVTGHS
ACSA_AERHH       EDPLFILYTSGSTGKPKGVLHTTGGYLVYATLTFKYIFDYHE-EDIYWCTADVGWVTGHS
ACSA_AERS4       EDPLFVLYTSGSTGKPKGVLHTTGGYLVYATLTFKYVFDYHE-EDIYWCTADVGWVTGHS
ACSA_VIBVU       EDPLFILYTSGSTGKPKGVLHTTGGYLVYATMTFKYVFDYQP-GETFWCTADVGWITGHT
ACSA_VIBVY       EDPLFILYTSGSTGKPKGVLHTTGGYLVYATMTFKYVFDYQP-GETFWCTADVGWITGHT
ACSA_VIBPA       EDPLFILYTSGSTGKPKGVLHTTGGYLVYAAMTFKYVFDYQP-GETFWCTADVGWITGHT
ACSA_VIBCH       EDPLFILYTSGSTGKPKGVLHTTGGYLVYATMTFKYVFDYQP-NEVFWCTADVGWITGHS
ACSA_PHOPR       EDPLFILYTSGSTGKPKGVLHTTGGYLVYATMTFKYVFDYQE-GDVYWCTADVGWITGHS
ACSA_PSYIN       EDPLFILYTSGSTGTPKGVLHTTGGYLVYAAMTFKYVFDYQE-GDIYWCTADVGWITGHT
ACSA_SHESR       EDPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKP-GEIYWCTADVGWITGHS
ACSA_SHESM       EDPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKP-GEIYWCTADVGWITGHS
ACSA_SHESA       EDPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKP-GEIYWCTADVGWITGHS
ACSA_SHEON       EDPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKP-GEIYWCTADVGWITGHS
ACSA_SHESW       EDPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKA-GEVYWCTADVGWITGHS
ACSA_SHEPC       EDPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKA-GEVYWCTADVGWITGHS
ACSA_SHEB5       EAPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKA-GEVYWCTADVGWITGHS
ACSA_SHEB8       EAPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKA-GEVYWCTADVGWITGHS
ACSA_SHEB9       EAPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKA-GEVYWCTADVGWITGHS
ACSA_SHEFN       EDPLFLLYTSGSTGNPKGVLHTTGGYMVYASMTHEYVFDYKA-DEVYWCTADVGWITGHS
ACSA_SHEPA       EDPLFLLYTSGSTGNPKGVLHTTGGYMVYAAMTHEYVFDYKE-NEVYWCTADVGWITGHS
ACSA_SHEHH       EDPLFLLYTSGSTGNPKGVLHTTGGYMVYAAMTHEYVFDYKE-NEVYWCTADVGWITGHS
ACSA_SHELP       EDPLFLLYTSGSTGNPKGVLHTTGGYLVYASMTHEYVFDYKE-GEIYWCTADVGWITGHS
ACSA_SHESH       EDPLFLLYTSGSTGNPKGVLHTTGGYMVYAAMTHEYVFDYKD-GEVYWCTADVGWITGHS
ACSA_SHEAM       EDPLFLLYTSGSTGNPKGVLHTTGGYLVYASMTHEYVFDYKP-GEVYWCTADVGWITGHS
ACSA_SHEDO       EDPLFLLYTSGSTGNPKGVLHTTGGYLVYAAMTHEYVFDYKE-NEVYWCTADVGWITGHS
ACSA_PSEU2       EESLFILYTSGSTGKPKGVLHTTAGYLLYAALTHERVFDYRP-GEVYWCTADVGWVTGHS
ACSA_PSE14       EESLFILYTSGSTGKPKGVLHTTAGYLLYAALTHERVFDYKP-GEIYWCTADVGWVTGHS
ACSA_PSESM       EESLFILYTSGSTGKPKGVLHTTAGYLLYAALTHERVFDYKP-GEIYWCTADVGWVTGHS
ACSA1_PSEPK      EEALFILYTSGSTGKPKGVLHTTGGYLVYAALTHERVFDYRP-GEVYWCTADVGWVTGHS
ACSA1_PSEAE      EDPLFILYTSGSTGKPKGVLHTTGGYLVYASLTHERVFDYRP-GEVYWCTADIGWVTGHT
ACSA_PSEU5       EEPLFILYTSGSTGKPKGVLHTCGGYLLYAALTHERVFDYRP-GDIYWCTADIGWITGHS
ACSA_MARHV       EDPLFMLYTSGSTGAPKGVLHTTGGYMVYASMTHQYVFDYHD-GDVYWCTADFGWVTGHS
ACSA2_PSEAE      EDPLFILYTSGSTGKPKGVLHTTGGYLLGAAMTHKYVFDYHD-GDVYWCTADVGWVTGHS
ACSA2_PSEPK      EDPLFILYTSGSTGKPKGVLHTTGGYLLQATMTFKVVFDYRD-GEVFWCTADVGWVTGHS
ACSA_ALKEH       EDPLFILYTSGSTGKPKGVQHCSAGYLLGAAMTHKYVFDYQE-GEVYWCTADVGWVTGHS
ACSA_HALHL       EDPLFILYTSGSTGKPKGVQHSTAGYLLGTAMTHKYIFDYQD-GEVYWCTADVGWVTGHS
ACSA_MAGMM       EDPLFVLYTSGSTGKPKGVLHTTGGYLLYASITHQYIFDYHE-DDIYWCTADVGWVTGHT
ACSA_SACD2       EDPLFILYTSGSTGKPKGVLHTTGGYLLQAAMTHKYVFDYQP-GEVYWCTADVGWVTGHT
ACSA_ALCBS       EDPLFTLYTSGSTGKPKGVVHTTAGYLLNTALTHKYVFDYQD-GDIYWCTADVGWITGHS
ACSA_PRB01       EDPLFILYTSGSTGKPKGVLHTTAGYLLGAHISFKYLFGIRP-EDKYWCTADVGWITGHT
ACSA_THIDA       EHPLFILYTSGSTGKPKGVQHSTGGYLLGALLSMLWVFDAKADNDVYWCTADVGWITGHT
ACSA_CHRVO       EDPLFILYTSGSTGKPKGIQHSTAGYLLGALNSFRWVFDYKP-NDVFWCTADVGWITGHS
ACSA_NITEU       EHPLFTLYTSGSTGKPKGVQHSSAGYLLGAVTSMQWVFDYHA-DDVFWCTADVGWVTGHS
ACSA_NITEC       EHPLFTLYTSGSTGKPKGVQHSSAGYLLGAIVSMQWVFDYHS-EDIFWCTADVGWVTGHS
ACSA_METFK       EHPLFILYTSGSTGTPKGVQHSTGGYLLGAIMSMKWVFDHKA-TDIFWCTADVGWITGHS
ACSA_CUPNH       EHPLFVLYTSGSTGKPKGVQHSTGGYLLWALMTMKWTFDIKP-DDLFWCTADIGWVTGHT
ACSA_CUPPJ       EHPLFVLYTSGSTGKPKGVQHSTGGYLLWALMTMQWTFDIKP-DDLFWCTADIGWVTGHT
ACSA_CUPMC       EHPLFVLYTSGSTGKPKGVQHSTGGYLLWALMTMRWTFDIKP-DDMFWCTADIGWVTGHT
ACSA_RALSO       EHPLFILYTSGSTGKPKGVQHSTGGYLLWALLTMQWTFDLKP-DDVFWCTADIGWVTGHT
ACSA_BURP0       EHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFDWKP-DDVFWCTADIGWVTGHS
ACSA_BURMA       EHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFDWKP-DDVFWCTADIGWVTGHS
ACSA_BURP6       EHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFDWKP-DDVFWCTADIGWVTGHS
ACSA_BURP1       EHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFDWKP-DDVFWCTADIGWVTGHS
ACSA_BURM7       EHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFDWKP-DDVFWCTADIGWVTGHS
ACSA_BURPS       EHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFDWKP-DDVFWCTADIGWVTGHS
ACSA_BURM9       EHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFDWKP-DDVFWCTADIGWVTGHS
ACSA_BURMS       EHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFDWKP-DDVFWCTADIGWVTGHS
ACSA_BURTA       EHPLFILYTSGSTGKPKGVQHSTAGYLLWVAQTMKWTFDWKP-DDVFWCTADIGWVTGHS
ACSA_BURL3       EHPLFILYTSGSTGKPKGVQHSTGGYLLWAAQTMKWTFDWKP-TDVFWCTADIGWVTGHT
ACSA_HERAR       EHPLFILYTSGSTGKPKGVQHSSAGYLLWAMLTMKWVFDIKP-NDVYWCTADIGWVTGHT
ACSA_PASMU       EDPLFILYTSGSTGKPKGIVHSTGGYLLGALNSFRNVFDNKP-NDIFWCTADVGWITGHS
ACSA_HELPY       EDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWVFDIRD-NDNFWCTADIGWITGHT
ACSA_HELPH       EDPLFLLYTSGSTGKPKGVQHSNAGYLLWAQMTMEWVFDIRD-NDNFWCTADIGWITGHT
ACSA_HELAH       EDPLFLLYTSGSTGKPKGVQHSSAGYLLWAQMTMEWVFDIRD-NDNFWCTADIGWITGHT
ACSA_CAMJJ       EDLLFLLYTSGSTGKPKGVMHASAGYILWAQMTMEWVFDIKD-YDNYWCSADVGWITGHT
ACSA_CAMJE       EDLLFLLYTSGSTGKPKGVMHASAGYILWAQMTMEWVFDIKD-YDNYWCSADVGWITGHT
ACSA_CAMJ8       EDLLFLLYTSGSTGKPKGVMHASAGYILWAQMTMEWVFDIKD-YDNYWCSADVGWITGHT
ACSA_WOLSU       EDPLFLLYTSGSTGKPKGVQHNQAGYILWAQTTMEWVFDVKE-NDTYWCTADVGWITGHT
ACSA_RUBXD       EDILYILYSSGSTGKPKGIVHTTGGYLTHVNTTTDWVFDLKE-DDVYWCTADIGWVTGHS
ACSA_STRAW       EHPLFILYTSGTTGKPKGILHTSGGYLTQTSYTHHAVFDLKPETDVYWCTADIGWVTGHS
ACSA_STRCO       EHPLFILYTSGTTGKPKGILHTSGGYLTQTAYTHWAVFDLKPETDVFWCTADVGWVTGHS
ACSA_MYCBO       EHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTIFDVKPDSDVFWCTADIGWVTGHT
ACSA_MYCTU       EHPLFLLYTSGTTGKPKGIMHTSGGYLTQCCYTMRTIFDVKPDSDVFWCTADIGWVTGHT
ACSA_PYRAE       EHPSFILYTSGTTGKPKGIVHDTGGWAVHVYATMKWVFDIR-DDDIFWCTADIGWVTGHS
ACSA_PYRAR       EHPSFILYTSGTTGKPKGIVHDTGGWAVHVYATMKWVFDIR-DDDIYWCTADIGWVTGHS
ACSA_METSH       EHRLYILYTSGTTGKPKGIEHATGGNAVGPAQTLHWVFDLK-DDDVWWCTADIGWVTGHS
                 *   : **:**:** ***: *  .*       :    *. :   : ::*:** **::**:

ACSA_THET8       YVVYGPLLNGATTVMYEGAPNWPEPDRFWRIVDKYGVTVFYTAPTAIRSFMKWGEG----
ACSA_THET2       YVVYGPLLNGATTVMYEGAPNWPEPDRFWRIVDKYGVTVFYTAPTAIRSFMKWGEG----
ACSA_SYNY3       YIVYGPLSNGATTVMYEGVPRPSNPGCFWDVIERYGVNIFYTAPTAIRAFIRMGEA----
ACSA_THEEB       YIVYGPLSNGATTLMYEGAPRPSNPGCFWDVIEKYGVTIFYTAPTAIRAFIKMGEH----
ACSA_DEIRA       YSVYGPLLNGATVVMYEGAPNQPDWGRFWDIVQKHRVTILYTAPTAIRSFMQHGDE----
ACSA_CHLTE       YIIYGPLLNGATVFMYEGAPNYPQWDRFWDIINRHKITILYTAPTAIRAFIRAGNE----
ACSA_RHOBA       YVVYGPLSAGATCLMYEGAPNFPAEDRFWDIVERHKVSILYTAPTAVRAFIKWGDE----
ACSA_LEPIC       YLVYGPLSNGASSVMFEGVPSYPDAGRFWDVIDKYGVNIFYTAPTAIRALMREGLN----
ACSA_LEPIN       YLVYGPLSNGASSVMFEGVPSYPDAGRFWDVIDKYGVNIFYTAPTAIRALMREGLN----
ACSA_LEPBL       YLVYGPLSNGASSVMFEGVPSYPDAGRFWDVIDKYGVNIFYTAPTAIRALMREGLT----
ACSA_LEPBJ       YLVYGPLSNGASSVMFEGVPSYPDAGRFWDVIDKYGVNIFYTAPTAIRALMREGLT----
ACSA_XANC8       YIVYGPLANGATAVMFEGVPNYPNVSRFWEVIDKHQVTIFYTAPTAIRALMREGEA----
ACSA_XANCP       YIVYGPLANGATAVMFEGVPNYPNVSRFWEVIDKHQVTIFYTAPTAIRALMREGEA----
ACSA_XANOM       YIVYGPLANGATAVMFEGVPNYPNVSRFWEVIDKHQVTIFYTAPTAIRALMRDGAE----
ACSA_XANAC       YIVYGPLANGATAVMFEGVPNYPNVSRFWEVIDKHQVTIFYTAPTAIRALMRDGAD----
ACSA_XYLFA       YIVYGPLANGATVLLFEGVPHYPTVSRFWEVIDKHHVTLFYTAPTAIRALMREGDT----
ACSA_XYLFT       YIVYGPLANGTTVLLFEGTPHYPTVSRFWEVIDKHHVTLFYTAPTAIRALMREGDT----
ACSA_BDEBA       YIVYGPLANGATSLFFEGVPNYPTPSRFWEVVDKHKVTIFYTSPTAIRSLMREGDA----
ACSA_NOVAD       YVVYGPLMNGATTVMFEGVPNFPDASRFWQVVDKFKVEIFYGAPTALRALMREGDE----
ACSA_CAUVC       YVVYGPLANGGTSLIFEGVPNYPTPSRFWEVIDKHQVSIFYTAPTALRALMREGDA----
ACSA_BRADU       YILYGPLANGATTLMFEGVPNYPDNSRFWNVIDKHKVNTFYTAPTAIRALMQGGDE----
ACSA_BRASO       YILYGPLANGAVTLMFEGVPNYPDNSRFWNVIDKHKVNIFYTAPTAIRALMQGGDG----
ACSA_RHOP5       YILYGPLANGATTLMFEGVPNYPTNSRFWEVIDKHQVNIFYTAPTAIRALMQGGDE----
ACSA_PARL1       YILYGPLANGATTLMFEGVPNYPDASRCWQVIDKHEVNIFYTAPTALRALMREGEE----
ACSA_RHOCB       YIIYGPLANGATTLMFEGVPTFPDAGRFWAVCEKHKVNQFYTAPTAIRALMGQGPE----
ACSA_BRUA2       YIVYGPLANGATTLMFEGVPNFPDQGRFWEVVDKHHVNIFYTAPTALRALMGAGDE----
ACSA_BRUAB       YIVYGPLANGATTLMFEGVPNFPDQGRFWEVVDKHHVNIFYTAPTALRALMGAGDE----
ACSA_BRUSU       YIVYGPLANGATTLMFEGVPNFPDQGRFWEVVDKHHVNIFYTAPTALRALMGAGDE----
ACSA_BRUC2       YIVYGPLANGATTLMFEGVPNFPDQGRFWEVVDKHHVNIFYTAPTALRALMGAGDE----
ACSA_BRUME       YIVYGPLANGATTLMFEGVPNFPDQGRFWEVVDKHHVNIFYTAPTALRALMGAGDE----
ACSA_BRUSI       YIVYGPLANGATTLMFEGVPNFPDQGRFWEVVDKHHVNIFYTAPTALRALMGAGDE----
ACSA_BRUO2       YIVYGPLANGATTLMFEGVPNFPDQGRFWEVVDKHHVNIFYTAPTALRALMGAGDE----
ACSA_OCHA4       YIVYGPLANGATTLMFEGVPNFPDQGRFWEVVDKHHVNIFYTAPTAIRALMGAGDE----
ACSA_AGRRH       YIVYGPLANCATTLMFEGIPTFPDAGRFWDVIDKHKVNIFYTAPTAIRSLMGAGDD----
ACSA_RHIEC       YIVYGPLSNCATTLMFEGVPNFPDQGRFWEVIDKHKVNIFYTAPTAIRSLMGAGDD----
ACSA_RHIME       YIVYGPLANAATTLMFEGVPNFPDAGRFWEVVDKHKVNIFYTAPTAIRSLMGAGDD----
ACSA_SINMW       YIVYGPLANAATTLMFEGVPNFPDAGRFWEVVDKHKVNIFYTAPTAIRSLMGAGDD----
ACSA_AGRFC       YIVYGPLANCATTLMFEGVPNFPDQGRFWEVIDKHKVNIFYTAPTALRSLMGAGDQ----
ACSA_RHILO       YIVYGPLANGATTLMFEGVPNYPSQSRFWEVIDKHKVNIFYTAPTALRALMGAGND----
ACSA_BART1       YLVYGPLCNGATTLMFEGTPTFPDKGRFWEIVDKHKVNTLYTAPTAIRALMGAGNS----
ACSA_BARHE       YLVYGPLCNAATTLMFEGTPTFPDNGRFWEIVDKHQVNIFYTAPTAIRALMGAGNS----
ACSA_BARQU       YLIYGPLCNGATTLMFEGIPTFPDQGRFWEIVDKHKVNTLYTAPTAIRALMGAGNS----
ACSA_BARBK       YLVYGPLCNGATTLMFEGSPTFPDEGRFWEIVDKHKVNIFYTAPTAIRALMGAGDS----
ACSA_ECOLI       YLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTAIRALMAEGDK----
ACSA_ECO57       YLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTAIRALMAEGDK----
ACSA_ECOL6       YLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTAIRALMAEGDK----
ACSA_SALTI       YLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDK----
ACSA_SALTY       YLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDK----
ACSA_CITK8       YLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVTILYTAPTAIRALMAEGDK----
ACSA_CROS8       YLLYGPLACGATTLMFEGVPNWPSANRMAQVVDKHKVNILYTAPTAIRALMAEGDK----
ACSA_YERPA       YLLYGPLACGAITLMFEGVPNYPGVNRLSQVVDKHKVNILYTAPTAIRALMAEGDK----
ACSA_YERPN       YLLYGPLACGAITLMFEGVPNYPGVNRLSQVVDKHKVNILYTAPTAIRALMAEGDK----
ACSA_YERPE       YLLYGPLACGAITLMFEGVPNYPGVNRLSQVVDKHKVNILYTAPTAIRALMAEGDK----
ACSA_YERPP       YLLYGPLACGAITLMFEGVPNYPGVNRLSQVVDKHKVNILYTAPTAIRALMAEGDK----
ACSA_YERP3       YLLYGPLACGAITLMFEGVPNYPGVNRLSQVVDKHKVNILYTAPTAIRALMAEGDK----
ACSA_YERPS       YLLYGPLACGAITLMFEGVPNYPGVNRLSQVVDKHKVNILYTAPTAIRALMAEGDK----
ACSA_YERE8       YLLYGPLACGAITLMFEGVPNYPGVNRLGQVIDKHQVNILYTAPTAIRALMAEGDK----
ACSA_SERP5       YLLYGPLACGAITLMFEGVPNYPGVNRLSQVIDKHQVNILYTAPTAIRALMAEGDK----
ACSA_PHOLL       YLLYGPLSCGAITLMFEGVPNYPAVNRLSQIIDKHQVNILYTAPTAIRALMAEGDK----
ACSA_SODGM       YLLYGPLACCAITLMFEGVPNWPAASRMAQVVDKHQVNILYTAPTAIRALMAEGDK----
ACSA_AERHH       YLVYGPLANGATTIMFEGVPNYPATNRMSQVVDKHQVSILYTAPTAIRALMAKGNE----
ACSA_AERS4       YLVYGPLANGATTIMFEGVPNYPATNRMSQVVDKHQVTILYTAPTAIRALMAKGRD----
ACSA_VIBVU       YLVYGPLANGAKTILFEGVPNYPNTSRMSEVVDKHQVNILYTAPTAIRALMAKGNE----
ACSA_VIBVY       YLVYGPLANGAKTILFEGVPNYPNTSRMSEVVDKHQVNILYTAPTAIRALMAKGNE----
ACSA_VIBPA       YLIYGPLANGAKTILFEGVPNYPNTSRMSEVVDKHQVNILYTAPTAIRALMAKGNE----
ACSA_VIBCH       YLVYGPLANGAKTILFEGVPNYPTTARMSEVVDKHKVNILYTAPTAIRALMAKGDE----
ACSA_PHOPR       YLVYGPLANGATTVLFEGVPNYPSTSRMSEVVDKHNVSILYTAPTAIRALMAKGTE----
ACSA_PSYIN       YSVYGPLANGATSLIFEGVPNYPTPARMSEVVDKHKVSILYTAPTAIRALMAKGDQ----
ACSA_SHESR       YMVYGPLANGATVLIHEGIPNHPSPARLGEMIDRHKVNILYTAPTLIRALMAEGKQ----
ACSA_SHESM       YMVYGPLANGATVLIHEGIPNHPSPARLGEMIDRHKVNILYTAPTLIRALMAEGKQ----
ACSA_SHESA       YMVYGPLANGATVLIHEGIPNYPSPARLGEMIDRHKVNILYTAPTLIRALMAEGKQ----
ACSA_SHEON       YMVYGPLANGATVLIHEGVPNHPSPARLGEMIDRHKVNILYTAPTLIRALMAEGKQ----
ACSA_SHESW       YMVYGPLANGATVLIHEGVPNHPSPARLGEMIDRHKVNILYTAPTLIRALMAEGKQ----
ACSA_SHEPC       YMVYGPLANGATVLIHEGVPNHPSPARLGEMIDRHKVNILYTAPTLIRALMAEGKQ----
ACSA_SHEB5       YMVYGPLANGATVLIHEGVPNHPSPARLGEMIDRHKVSILYTAPTLIRALMAEGKQ----
ACSA_SHEB8       YMVYGPLANGATVLIHEGVPNHPSPARLGEMIDRHKVSILYTAPTLIRALMAEGKQ----
ACSA_SHEB9       YMVYGPLANGATVLIHEGVPNHPSPARLGEMIDRHKVSILYTAPTLIRALMAEGKQ----
ACSA_SHEFN       YMVYGPFANAATVLIHEGVPNHPTPARLGEMIDRHKVNILYTAPTLIRALMAEGKE----
ACSA_SHEPA       YMVYGPLANGATVLIHEGVPNYPTPARLGEMVDRHKVNILYTAPTLIRALMAEGKE----
ACSA_SHEHH       YMVYGPLANGATVLIHEGVPNYPSPARLGEMVDRHKVNILYTAPTLIRALMAEGKE----
ACSA_SHELP       YMVYGPLANGATILIHEGIPNYPTPARLGEMIDRHKVNILYTAPTLIRALMAEGKE----
ACSA_SHESH       YMVYGPLANGATVLIHEGVPNYPTPARLGEMVDRHKVNILYTAPTLIRALMAEGKE----
ACSA_SHEAM       YMVYGPLANGATILIHEGIPNFPSPARLGEIVDRHQVNILYTAPTLIRALMAEGKQ----
ACSA_SHEDO       YMVYGPFANGATVLMHEGVPNYPTPARLGEIVDRHKVNILYTAPTLIRALMAEGKE----
ACSA_PSEU2       YIVYGPLANGATTLLFEGVPNYPDITRVSKIIDKHKVNILYTAPTAIRAMMAEGTK----
ACSA_PSE14       YIVYGPLANGATTLLFEGVPNYPDITRVSKIIDKHKVNILYTAPTAIRAMMAEGTK----
ACSA_PSESM       YIVYGPLANGATTLLFEGVPNYPDITRVSKIIDKHKVNILYTAPTAIRAMMAEGTK----
ACSA1_PSEPK      YIVYGPLANGATTLLFEGVPNYPDITRVSKIVDKHKVNILYTAPTAIRAMMAEGQA----
ACSA1_PSEAE      YIVYGPLANGATTILFEGVPNYPDVTRVAKIIDKHKVNILYTAPTAIRAMMAEGKA----
ACSA_PSEU5       YLIYGPLANGATTLMYEGVPNYPDVTRIARIIDKHRVNILYTAPTAIRAMMAEGPA----
ACSA_MARHV       YILYGPLANGAITLLFEGVPNYPDSSRMGQVVDKHKVNILYTAPTAIRALMAQGES----
ACSA2_PSEAE      YIVYGPLANGATTLMFEGVPNYPDASRFWQVIDKHQVNIFYTAPTAIRALMREGDA----
ACSA2_PSEPK      YIVYGPLANGAISLMFEGVPNYPDTSRFWQVVDKHQVNIFYTAPTALRALMREGSA----
ACSA_ALKEH       YIVYGPLANGATTLMFEGVPTYPSAARCWEVVDKHNVSIFYTAPTAIRALMGQGNE----
ACSA_HALHL       YIVYGPLANGAKTLMFEGVPTYPDAGRFWQVVDKHEVSIFYTAPTAIRALMGQGDD----
ACSA_MAGMM       YIVYGPLANGATTLMFEGVPTYPDASRFWQVVDKHQVSIFYTAPTAIRSIMSQGDA----
ACSA_SACD2       YIVYGPLTNGATTLMFEGVPTYPTAARCWEVCDKHNVNIFYTAPTAIRALMGQGDE----
ACSA_ALCBS       YIVYGPLANGATTLMFEGVPTYPDASRCWQVVDKHKVNIFYTAPTAIRALMGLGDA----
ACSA_PRB01       YILYGPLSNGATTLMFEGVPTYPSASRCWEICDKHDISIFYTAPTAIRALMAQGDD----
ACSA_THIDA       YVAYGPLALGMTEVIFEGIPTYPHAGRFWETIAKHKVTTFYTAPTAIRSLIKLGSE----
ACSA_CHRVO       YVCYGPLANGATQVIFEGVPTYPDAGRFWKMIEQHKVSIFYTAPTAIRSLIKLGSD----
ACSA_NITEU       YVAYGPLAIGATQVIFEGTPTHPHAGRFWEIIQKHRITTFYTAPTAIRSLIKLGSD----
ACSA_NITEC       YVTYGPLAIGATQVIFEGTPTYPHAGRFWEIIQKHRVTTFYTAPTAIRSLIKLGPD----
ACSA_METFK       YVAYGPLALGSTQVVFEGVPTYPDAGRFWQMIERHKVSIFYTAPTAIRSLIKLGGD----
ACSA_CUPNH       YIAYGPLAAGATQVVFEGVPTYPNAGRFWDMIARHKVSIFYTAPTAIRSLIKAAEADEKI
ACSA_CUPPJ       YIAYGPLAAGATQIIFEGVPTYPNAGRFWDMIARHKVSIFYTAPTAIRSLIKAAEADEKI
ACSA_CUPMC       YITYGPLAAGATQIVFEGVPTFPNAGRFWDMIQRHKVSIFYTAPTAIRSLIKAAEADEKI
ACSA_RALSO       YIAYGPLAAGATQVVFEGVPTYPNAGRFWDMIQKHRVNTFYTAPTAIRSLIKAAEADETS
ACSA_BURP0       YITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAAEADDRV
ACSA_BURMA       YITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAAEADDRV
ACSA_BURP6       YITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAAEADDRV
ACSA_BURP1       YITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAAEADDRV
ACSA_BURM7       YITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAAEADDRV
ACSA_BURPS       YITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAAEADDRV
ACSA_BURM9       YITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAAEADDRV
ACSA_BURMS       YITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVTVFYTAPTAIRSLIKAAEADDRV
ACSA_BURTA       YITYGPLAVGATQVVFEGVPTYPNAGRFWKMIGDHKVSVFYTAPTAIRSLIKAAEADEHV
ACSA_BURL3       YITYGPLACGGTQVVFEGVPTYPDAGRFWKMIGDHKVTVFYTAPTAIRSLIKAAEADDKV
ACSA_HERAR       YVTYGPLAVGATQIVFEGVPMYPNAGRFWEMVQKHKVSIFYTAPTAIRSLIKAAEADPST
ACSA_PASMU       YVCYGPLANGATQVIFEGVPTYPDPGRIWRMIQRHKINVFYTSPTLIRSLTRLGDH----
ACSA_HELPY       YVVYGPLACGATTLILEGTMSYPDYGRWWRMIEEYRVDKFYTSPTAIRMLHAKGEN----
ACSA_HELPH       YVVYGPLACGATTLILEGTMSYPDYGRWWRMIEEYRVDKFYTSPTAIRMLHAKGEN----
ACSA_HELAH       YVVYGPLACGATTLILEGTMSYPDYGRWWRMIEEYRVDKFYTSPTAIRMLHAKGEN----
ACSA_CAMJJ       YVVYGPLACGATTIMHEGTPTYPNSGRWWRMIEEYQISKFYTSPTAIRMLHADAPN----
ACSA_CAMJE       YVVYGPLACGATTIMHEGTPTYPNSGRWWRMIEEYQISKFYTSPTAIRMLHADAPN----
ACSA_CAMJ8       YVVYGPLACGATTIMHEGTPTYPNSGRWWRMIEEYQISKFYTSPTAIRMLHADAPD----
ACSA_WOLSU       YIVYGPLAMGATTVMYEGVPIYPDTGRWWKMIEHYRVNQFYTAPTAIRLLHKEGKE----
ACSA_RUBXD       YIVYGPLSNGATALMFEGTPSYPANDRWWDIIERHGVTILYTAPTAIRAFMKQGPG----
ACSA_STRAW       YITYGPLSNGATQVMYEGTPDTPHQGRFWEIVQKYGVTILYTAPTAIRTFMKWGDD----
ACSA_STRCO       YIVYGPLANGATQVMYEGTPDTPHQGRFWEIVQKYGVTILYTAPTAIRTFMKWGDD----
ACSA_MYCBO       YGVYGPLCNGVTEVLYEGTPDTPDRHRHFQIIEKYGVTIYYTAPTLIRMFMKWGRE----
ACSA_MYCTU       YGVYGPLCNGVTEVLYEGTPDTPDRHRHFQIIEKYGVTIYYTAPTLIRMFMKWGRE----
ACSA_PYRAE       YVVLGPLLMGATEVIYEGAPDYPQPDRWWSIIERYGVTIFYTSPTAIRMFMRYGEE----
ACSA_PYRAR       YVVLGPLLMGTTEIIYEGAPDYPQPDRWWSIIERYGVTILYTSPTAIRMFMRYGEA----
ACSA_METSH       YIVYAPLILGMTSLMYEGAADYPDFGRWWKNIQDHKVTVLYTAPTAVRMFMKQGAE----
                 *   .*:      .. **    .           . :   * :** :* :   .      

ACSA_THET8       WPGKHRLDSLRLLGTVGEPINPEAWLWYYHVIGKGRCPIVDTWWQTETGGIMITTLPG--
ACSA_THET2       WPGKHRLDSLRLLGTVGEPINPEAWLWYYHVIGKGRCPIVDTWWQTETGGIMITTLPG--
ACSA_SYNY3       VPNARDLSSLRLLGTVGEPINPEAWMWYHRVIGGGKCPIVDTWWQTETGGIMLTPLPG--
ACSA_THEEB       LPRARDLSSLRLLGTVGEPINPEAWMWYYRVIGGERCPIVDTWWQTETGGHMITSLPG--
ACSA_DEIRA       IPGRYDLASLRLLGSVGEPINPEAWMWYYRVIGGERCPVVDTWWQTETGSIMLTTLPG--
ACSA_CHLTE       WVTKHDLSSLRLLGTVGEPINPEAWMWYHKYVGQEKCPIVDTWWQTETGGIMISPMPG--
ACSA_RHOBA       HVDKHDLSSLRLLGSVGEGINPEAWMWYHKKIGGEKCPIVDTWWQTETGGIMMSPLPG--
ACSA_LEPIC       HIQKRDLSSLRLLGSVGEPINPEAWEWYFKNIGKGKCPIVDTWWQTETGSIMITALPG--
ACSA_LEPIN       HIQKRDLSSLRLLGSVGEPINPEAWEWYFKNIGKGKCPIVDTWWQTETGSIMITALPG--
ACSA_LEPBL       HVQKRNLSSLRLLGSVGEPINPEAWEWYFKIIGKEKCPIVDTWWQTETGSIMITALPG--
ACSA_LEPBJ       HVQKRNLSSLRLLGSVGEPINPEAWEWYFKIIGKEKCPIVDTWWQTETGSIMITALPG--
ACSA_XANC8       PVKKTSRSSLRLLGSVGEPINPEAWRWYYEVVGDSRCPIVDTWWQTETGGILISPLAG--
ACSA_XANCP       PVKKTSRSSLRLLGSVGEPINPEAWRWYYEVVGDSRCPIVDTWWQTETGGILISPLAG--
ACSA_XANOM       PVKKTSRKSLRLLGSVGEPINPEAWRWYYDVVGDSRCPIVDTWWQTETGGILISPLAG--
ACSA_XANAC       PVKKTSRKSLRLLGSVGEPINPEAWRWYYEVVGDSRCPIVDTWWQTETGGILISPLAG--
ACSA_XYLFA       PVKKTSRKSLRLLGSVGEPINPEAWHWYYTIVGNGRCPIVDTWWQTETGGILITPLIG--
ACSA_XYLFT       PVKKTSRKSLRLLGSVGEPINPEAWHWYYTIVGNGRCPIVDTWWQTETGGILITPLIG--
ACSA_BDEBA       AVKTTSRKTLRLLGSVGEPINPEAWAWYHDVVGEGRCPVVDTWWQTETGGILITPLPG--
ACSA_NOVAD       WVKKTSRASLRLLGSVGEPINPEAWEWYHKVVGDSRCPIVDTWWQTETGGAMITPLPG--
ACSA_CAUVC       HVTKNDLSSLRLLGSVGEPINPEAWLWYHRVVGKEKLPIVDTWWQTETGGMLITPLPG--
ACSA_BRADU       PVKKTSRASLRLLGSVGEPINPEAWEWYHRVVGEDRCPIVDTWWQTETGGILITPLPG--
ACSA_BRASO       PVTKTSRESLRLLGSVGEPINPEAWEWYHRVVGDNRCPIVDTWWQTETGGILITPLPG--
ACSA_RHOP5       PVTKTSRKSLRLLGSVGEPINPEAWEWYHRVVGEDRCPIVDTWWQTETGGILITPLPG--
ACSA_PARL1       PVKKTSRKSLRLLGSVGEPINPEAWLWYHRVVGDGRCPIVDTWWQTETGGILISPLPG--
ACSA_RHOCB       WVEKYDLSSLRVLGSVGEPINPEAWVWYDKYVGKGKCPIVDTFWQTETGGHMITPLPG--
ACSA_BRUA2       FVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQKCPIVDTWWQTENGGILITPLPG--
ACSA_BRUAB       FVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQKCPIVDTWWQTENGGILITPLPG--
ACSA_BRUSU       FVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQKCPIVDTWWQTENGGILITPLPG--
ACSA_BRUC2       FVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQKCPIVDTWWQTENGGILITPLPG--
ACSA_BRUME       FVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQKCPIVDTWWQTENGGILITPLPG--
ACSA_BRUSI       FVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQKCPIVDTWWQTENGGILITPLPG--
ACSA_BRUO2       FVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQKCPIVDTWWQTENGGILITPLPG--
ACSA_OCHA4       FVTRSSRSTLRLLGSVGEPINPEAWEWYYNVVGDQRSPIVDTWWQTETGGILITPLPG--
ACSA_AGRRH       FVKRSSRSSLRLLGSVGEPINPEAWEWYYHTVGDGRCPVVDTWWQTETGGIMITPLPG--
ACSA_RHIEC       FVTRSSRSSLRLLGTVGEPINPEAWEWYYNVVGDKRCPVIDTWWQTETGGHMITPLPG--
ACSA_RHIME       FVKRSSRSSLRLLGTVGEPINPEAWEWYYHVVGDERCPVVDTWWQTETGGILITPLPG--
ACSA_SINMW       FVKRSSRSSLRLLGTVGEPINPEAWEWYYHVVGDERCPVVDTWWQTETGGILITPLPG--
ACSA_AGRFC       FVQRSSRESLRLLGTVGEPINPEAWEWYYHVVGEDKSPIVDTWWQTETGGILISPLPG--
ACSA_RHILO       PVKKTSRKSLRVLGSVGEPINPEAWEWYFNVVGNGKVPIVDTWWQTETGGILITPLPG--
ACSA_BART1       FVEHSKRTSLRLLGTVGEPINPEAWEWFYHTVGNDRCPILDTWWQTETGGHMITPLPG--
ACSA_BARHE       FVERSKRTSLRLLGSVGEPINPEAWEWFYHTVGNNHCPILDTWWQTETGGHMITPLPG--
ACSA_BARQU       FVEHSKRTSLRLLGTVGEPINPEAWKWFYHTVGDNRCPILDTWWQTETGGHMITPLPG--
ACSA_BARBK       FVKRSQRTSLRLLGTVGEPINPEAWKWFYHTVGDSRCPILDTWWQTETGGHIITPLPG--
ACSA_ECOLI       AIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPG--
ACSA_ECO57       AIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPG--
ACSA_ECOL6       AIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPG--
ACSA_SALTI       AIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGGFMITPLPG--
ACSA_SALTY       AIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGGFMITPLPG--
ACSA_CITK8       AIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGGFMITPLPG--
ACSA_CROS8       AIDGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVIDTWWQTETGGFMITPLPG--
ACSA_YERPA       AIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTETGGFMITPLPG--
ACSA_YERPN       AIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTETGGFMITPLPG--
ACSA_YERPE       AIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTETGGFMITPLPG--
ACSA_YERPP       AIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTETGGFMITPLPG--
ACSA_YERP3       AIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTETGGFMITPLPG--
ACSA_YERPS       AIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTETGGFMITPLPG--
ACSA_YERE8       AIEGTKRTSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTETGGFMITPLPG--
ACSA_SERP5       AIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNAKCPIVDTWWQTETGGFMITPLPG--
ACSA_PHOLL       AIEGTKRTSLRIMGSVGEPINPEAWEWYYQKIGNSKCPIVDTWWQTETGGFMITPLPG--
ACSA_SODGM       AITGTHRSSLRIMGSVGEPINPEAWEWYYHKIGNGRCPIVDTWWQTETGGFMITPLPG--
ACSA_AERHH       AVADTSRSSLRIMGSVGEPINPEAWEWYYRTIGEERCPIVDTWWQTETGGILISPLPG--
ACSA_AERS4       AVEGTSRQSLRIMGSVGEPINPEAWEWYYRTIGEERCPIVDTWWQTETGGILISPLPG--
ACSA_VIBVU       AIEGTDRSSLRIMGSVGEPINPEAWEWYYKTIGNEKSPIVDTWWQTETGGILITPLPG--
ACSA_VIBVY       AIEGTDRSSLRIMGSVGEPINPEAWEWYYKTIGNEKSPIVDTWWQTETGGILITPLPG--
ACSA_VIBPA       AVAGTSRSSLRIMGSVGEPINPEAWEWYYKTIGNENSPIVDTWWQTETGGILIAPLPG--
ACSA_VIBCH       AIKGTSRDSLRIMGSVGEPINPEAWEWYYRTIGNEKSPIVDTWWQTETGGILITPLPG--
ACSA_PHOPR       AIKGTSRSSLRIMGSVGEPINPEAWEWYHHTIGDSRCPIVDTWWQTETGGILITPLPG--
ACSA_PSYIN       AIEGTHRSSLRILGSVGEPINPEAWEWYYNKIGDERCPIVDTWWQTETGGILISPLPG--
ACSA_SHESR       HFDKYDGSSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPG--
ACSA_SHESM       HFDKYDGSSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPG--
ACSA_SHESA       HFDKYDGSSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPG--
ACSA_SHEON       HFDKYNGSSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPG--
ACSA_SHESW       HFDQFDGSTLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPG--
ACSA_SHEPC       HFDQFDGSTLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPG--
ACSA_SHEB5       HFDKFDGSSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPG--
ACSA_SHEB8       HFDKFDGSSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPG--
ACSA_SHEB9       HFDKFDGSSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPG--
ACSA_SHEFN       QFSSYKGDSLRIMGSVGEPINPEAWRWYHEVIGHENCPIVDTWWQTETGGILISPLPG--
ACSA_SHEPA       QFEGFDGSSLRIMGSVGEPINPEAWRWYNDVIGHEKCPIVDTWWQTETGGILISPLPG--
ACSA_SHEHH       QFAGFDGSSLRIMGSVGEPINPEAWRWYNDVIGHEKCPIVDTWWQTETGGILISPLPG--
ACSA_SHELP       QFDGFDGSSLRIMGSVGEPINPEAWRWYHEVIGHENCPIVDTWWQTETGGILISPLPG--
ACSA_SHESH       QFADFDGSSLRIMGSVGEPINPEAWRWYNEVIGHEHCPIVDTWWQTETGGILISPLPG--
ACSA_SHEAM       HFDNFDGKSLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGGILITPLPG--
ACSA_SHEDO       HFNGFSGESLRIMGSVGEPINPEAWRWYHEVIGHEHCPIVDTWWQTETGGILISPLPG--
ACSA_PSEU2       SVEGADGSSLRLLGSVGEPINPEAWAWYYNTVGKQNCPIVDTWWQTETGGILISPLPG--
ACSA_PSE14       SVEGADGSSLRLLGSVGEPINPEAWGWYYNTVGKQNCPIVDTWWQTETGGILISPLPG--
ACSA_PSESM       SVEGADGSSLRLLGSVGEPINPEAWGWYYNTVGKQNCPIVDTWWQTETGGILISPLPG--
ACSA1_PSEPK      AVEGADGSSLRLLGSVGEPINPEAWNWYYKTVGKERCPIVDTWWQTETGGILISPLPG--
ACSA1_PSEAE      AVAGADGSSLRLLGSVGEPINPEAWQWYYETVGQSRCPIVDTWWQTETGACLMTPLPG--
ACSA_PSEU5       AMEGADGSSLRLLGTVGEPINPEAWHWYYETVGRSRCPIVDTWWQTETGGILISPLPG--
ACSA_MARHV       CMDGTTRGSLKLLGSVGEPINPEAWEWYHRVIGNSKCPIVDTWWQTETGGILISPLPG--
ACSA2_PSEAE      PVRQTSRSSLRLLGSVGEPINPEAWEWYYQVVGEKRCPILDTWWQTETGSILITPLPG--
ACSA2_PSEPK      PLQSTSRKSLRLLGSVGEPINPEAWEWYFEEVGQKRCPIVDTWWQTETGGIMLTPLPG--
ACSA_ALKEH       HVTKTSRKSLRILGTVGEPINPEAWEWYYNVVGDGRCPIVDTWWQTETGSILIAPLPG--
ACSA_HALHL       HVKKTSRKSLRILGTVGEPINPEAWEWYYHTIGEDRCPIVDTWWQTETGSILIAPLPG--
ACSA_MAGMM       LVKATSRQSLRILGSVGEPINPEAWEWYYHVVGEGRCPIVDTWWQTETGGILITPLPG--
ACSA_SACD2       FVASTQRKSLRILGTVGEPINPEAWEWYYNVVGDRRCPIMDTWWQTETGGHMLTPLPG--
ACSA_ALCBS       PVEQTSRASLKLLGTVGEPINPEAWEWYYRVVGDSRCPIVDTWWQTETGAIMIAPLPG--
ACSA_PRB01       PVKKTKRDSLRILGTVGEPINPEAWDWYYSVVGKSNCEVIDTWWQTETGSVLISPIAG--
ACSA_THIDA       LPAQYDLSSLRLLGTVGEPINPEAWMWYHEVIGGGRCPIVDTWWQTETGAHMIAPLPG--
ACSA_CHRVO       LPKQYDLSSLRVLGTVGEPINPEAWIWYYETVGGGRCPIVDTWWQTETGSTMIAPLPG--
ACSA_NITEU       LPAKYDLSSLRLLGSVGEPINPEAWMWYYTVVGQSRCPVVDTWWQTETGCHMIAPAPG--
ACSA_NITEC       LPEKYDLSSLRLLGSVGEPINPEAWMWYYTVIGQSRCPVVDTWWQTETGSHMIAPIPG--
ACSA_METFK       LPHKYDLSSLRLLGTVGEPINPEAWMWYYKVVGKERCPIADTWWQTETGAHMIAPLPG--
ACSA_CUPNH       HPKQYDLSSLRLLGTVGEPINPEAWMWYYKNIGNERCPIVDTFWQTETGGHMITPLPG--
ACSA_CUPPJ       HPKQYDLSSLRLLGTVGEPINPEAWMWYYKNIGNERCPIVDTFWQTETGGHMITPLPG--
ACSA_CUPMC       HPKQYDLSSLRLLGTVGEPINPEAWMWYYKNIGRERCPIVDTFWQTETGGHMITPLPG--
ACSA_RALSO       HPKRYDLSSLRLLGTVGEPINPEAWMWYHTNIGGGRCPIVDTFWQTETGGHMISPLPG--
ACSA_BURP0       HPRSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQARCPIVDTWWQTETGGHMITPLPG--
ACSA_BURMA       HPRSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQARCPIVDTWWQTETGGHMITPLPG--
ACSA_BURP6       HPRSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQARCPIVDTWWQTETGGHMITPLPG--
ACSA_BURP1       HPRSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQARCPIVDTWWQTETGGHMITPLPG--
ACSA_BURM7       HPRSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQARCPIVDTWWQTETGGHMITPLPG--
ACSA_BURPS       HPRSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQARCPIVDTWWQTETGGHMITPLPG--
ACSA_BURM9       HPRSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQARCPIVDTWWQTETGGHMITPLPG--
ACSA_BURMS       HPRSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQARCPIVDTWWQTETGGHMITPLPG--
ACSA_BURTA       HPKSYDLSSLRIIGTVGEPINPEAWIWYHKNVGQERCPIVDTWWQTETGGHMITPLPG--
ACSA_BURL3       HPKSYDLSSLRIIGTVGEPINPEAWMWYHKHVGQERCPIVDTWWQTETGGHMITPLPG--
ACSA_HERAR       HPSKYDLSSLRLLGSVGEPINPEAWMWYYKNIGGERCPIVDTFWQTETGGHVISPLPG--
ACSA_PASMU       IPNKYDLSSLRLLGSVGEPINPSAWMWFYEVVGKSRCPIVDTWWQTETGSIMLAPIPG--
ACSA_HELPY       EPSKYNLESLKVLGTVGEPINPTAWKWFYEKIGNSKCSIVDTWWQTETGGHIISPLPG--
ACSA_HELPH       EPLKYNLESLKVLGTVGEPINPTAWKWFYEKIGNSKCSIVDTWWQTETGGHIISPLPG--
ACSA_HELAH       EPSKYNLDSLKVLGTVGEPINPTAWKWFYEKIGNSQCSIVDTWWQTETGGHIISPLPG--
ACSA_CAMJJ       EPRKYDLSTLEVLGTVGEPINPSAWKWFYDEIGGTKSPIVDTWWQTETGGHMITPLPG--
ACSA_CAMJE       EPRKYDLSTLEVLGTVGEPINPSAWKWFYDEIGGTKSPIVDTWWQTETGGHMITPLPG--
ACSA_CAMJ8       EPRKYDLSTLEVLGTVGEPINPSAWKWFYDEIGGTKSPIVDTWWQTETGGHMITPLPG--
ACSA_WOLSU       EPKKYNLSNLKVLGTVGEPINPDAWNWYYNEIGGGQCPIVDTWWQTETGGHMISPLPG--
ACSA_RUBXD       PIEKHDLSSLRLLGSVGEPINPRAWEWYHEHVGGGRCPVVDTWWQTETGGIMISPLPG--
ACSA_STRAW       IPAKFDLSSLRVLGSVGEPINPEAWIWYRKHIGGDRTPIVDTWWQTETGAMMISPLPG--
ACSA_STRCO       IPAKFDLSSLRVLGSVGEPINPEAWIWYRKNIGADATPVVDTWWQTETGAMMITPLPG--
ACSA_MYCBO       IPDSHDLSSLRLLGSVGEPINPEAWRWYRDVIGGGRTPLVDTWWQTETGSAMISPLPG--
ACSA_MYCTU       IPDSHDLSSLRLLGSVGEPINPEAWRWYRDVIGGGRTPLVDTWWQTETGSAMISPLPG--
ACSA_PYRAE       WPRKHDLSTLRIIHSVGEPINPEAWRWAYRVLGNEKVAFGSTWWMTETGGIVISHAPGLY
ACSA_PYRAR       WPGKHDLSTLRIIHSVGEPINPEAWRWAYRVLGNEKVAFGSTWWMTETGGIVISHAPGLY
ACSA_METSH       WPDKYDLSSLRLLGSVGEPINPEAWMWYREHIGRGELQIMDTWWQTETGTFLNSPLP---
                         .*.:: :*** *** ** *    :*     . .*:* **.*  : :      

ACSA_THET8       AHAMKPGHAGKPFFGVVPEILDGEHRPVENP-----DEGGHLCITRPWPSMLRTVWGDPE
ACSA_THET2       AHAMKPGHAGKPFFGVVPEILDGEHRPVENP-----DEGGHLCITRPWPSMLRTVWGDPE
ACSA_SYNY3       AIPTKPGSCTKPFPGIVAEIVDLDGNPVES------DQGGFLVIKQPWPSMIRDVYGDTD
ACSA_THEEB       ALPMKPGSASKPFPGILADVVDLEGNPVGV------NEGGYLVIRHPWPGMMRTVYGDPD
ACSA_DEIRA       AFPSKPGSAGLPMFGVEPALMTRDGEEIGD------DDGGLLVIKRPWPSMLRTVYGDDE
ACSA_CHLTE       ATPTKPGTATRPLPGIMVDVVRKDGTPCNA------NEGGYLVVKRPWPSMLRTIYGDNE
ACSA_RHOBA       ITPTKPGSCTRPLPGVVPSIVDELGNSVDS------EHGGKLCISQPWPGMLRGIYGDEE
ACSA_LEPIC       AIPQKPGSATLPFFGVQPVLVDNDGKEITDKG----EVSGNLCIKGPWPSMMRGVYGDPK
ACSA_LEPIN       AIPQKPGSATLPFFGVQPVLVDNDGKEITDKG----EVSGNLCIKGPWPSMMRGVYGDPK
ACSA_LEPBL       AIPQKPGSATLPFFGVQPVLVDNDGKEINDKG----EVSGNLCIKSPWPSMMRGVYGDSK
ACSA_LEPBJ       AIPQKPGSATLPFFGVQPVLVDNDGKEINDKG----EVSGNLCIKSPWPSMMRGVYGDSK
ACSA_XANC8       AVDLKPGSATLPFFGVQPALVDAEGKILEGA------TEGNLVLLDSWPGQMRTVYGDHQ
ACSA_XANCP       AVDLKPGSATLPFFGVQPALVDAEGKILEGA------TEGNLVLLDSWPGQMRTVYGDHQ
ACSA_XANOM       AVDLKPGSATLPFFGVQPALVDAEGKILEGA------TEGNLVLLDSWPGQMRSVYGDHQ
ACSA_XANAC       AVDLKPGSATLPFFGVQPALVDAEGKILEGA------TEGNLVLLDSWPGQMRSVYGDHQ
ACSA_XYLFA       ATDLKPGSVTLPFFGIRPALVDTNGQILDGP------AAGNLVLLDSWPGQMRTVYGDHQ
ACSA_XYLFT       ATDLKPGSVTLPFFGIRPALVDTNGQTLDGP------AAGNLVLLDSWPGQMRTLYGDHQ
ACSA_BDEBA       AIAQKPGSATLPFFGVQPKLLTNEGQEIHGP------GEGVLVIADSWPGQMRTVYRNHE
ACSA_NOVAD       ATALKPGSASRPFFGVKPALVDNDGTFLEGA------TDGCLVVTDSWPGQMRTVWGDHE
ACSA_CAUVC       ATALKPGSASKPLPGVKPQLVDAEGKFLDGA------TEGNLVITDSWPGQMRTVYGDHQ
ACSA_BRADU       ATKLKPGSATQPFFGVVPEIVDADGKVLEGE------TTGNLCLTRAWPGMMRTVYGDHA
ACSA_BRASO       ATRLKPGSATRPFFGVVPEIVDADGNTLEGA------TEGNLCLTRSWPGQMRTVYGDHA
ACSA_RHOP5       ATKLKPGSATRPFFGVVPQIMDADANVLEGE------CTGNLCLAKSWPGQMRTVYGDHA
ACSA_PARL1       AIATKPGSATKPFFGVQPVIVDAEGNVQEGA------TTGNLCIDDSWPGQMRTVYGDHQ
ACSA_RHOCB       ATPTKPGSATNPFFGVKPVVLDPQTAVRIGEV----ECEGVLCISDSWPGQMRTVWGDHD
ACSA_BRUA2       ATDLKPGSATRPFFGVKPVLVDNEGNVQEGV------ADGNLCISDSWPGQMRTVYGDHK
ACSA_BRUAB       ATDLKPGSATRPFFGVKPVLVDNEGNVQEGV------ADGNLCISDSWPGQMRTVYGDHK
ACSA_BRUSU       ATDLKPGSATRPFFGVKPVLVDNEGNVQEGV------ADGNLCISDSWPGQMRTVYGDHK
ACSA_BRUC2       ATDLKPGSATRPFFGVKPVLVDNEGNVQEGV------ADGNLCISDSWPGQMRTVYGDHK
ACSA_BRUME       ATDLKPGSATRPFFGVKPVLVDNEGNVQEGV------ADGNLCISDSWPGQMRTVYGDHK
ACSA_BRUSI       ATDLKPGSATRPFFGVKPVLVDNEGNVQEGV------ADGNLCISDSWPGQMRTVYGDHK
ACSA_BRUO2       ATDLKPGSATRPFFGVKPVLVDNEGNVQEGV------ADGNLCISDSWPGQMRTVYGDHK
ACSA_OCHA4       ATDLKPGSATRPFFGIKPELVDNEGAVIEGA------VDGNLCIIDSWPGQMRTLYGDHK
ACSA_AGRRH       ATDLKPGSATRPFFGIRPELVDAEGKLIEGA------ADGNLCIADSWPGQARSVYGDHE
ACSA_RHIEC       AIDLKPGSATVPFFGVKPELVDNEGKVLEGA------ADGNLCIADSWPGQMRTVYGDHE
ACSA_RHIME       ATDLKPGSATRPFFGVQPQIVDSDGKVVDGA------ADGNLCITDSWPGQMRTVYGDHE
ACSA_SINMW       ATDLKPGSATRPFFGVQPQIVDGEGNVVEGA------ADGNLCIIDSWPGQMRTVYGDHE
ACSA_AGRFC       ATDLKPGSATRPFFGVQPQLVDAEGNVLEGP------ADGNLCIIDSWPGQSRSVYGDHQ
ACSA_RHILO       ATDLKAGSATRPFFGVKPQLVDGEGKVLEGA------ADGNLCITDSWPGQMRTVYGDHD
ACSA_BART1       ATPLKAGSATRPFFGVQLQIIDEQGNILEGE------AEGNLCIIDSWPGQMRTLYKDHE
ACSA_BARHE       ATPLKAGSATRPFFGVQLQIIDAEGNVLEGE------TEGNLCIIDSWPGQMRTLYNDHE
ACSA_BARQU       ATQLKAGSATHPFFGVQLQIIDGEGNVLEGE------AEGNLCIIDSWPGQMRTLYNDHE
ACSA_BARBK       ATKLKAGSATHPFFGIQVQLVDPQGNILKGE------AEGNLCIVDSWPGQMRTLYNNHQ
ACSA_ECOLI       ATELKAGSATRPFFGVQPALVDNEGNPLEG------ATEGSLVITDSWPGQARTLFGDHE
ACSA_ECO57       ATELKAGSATRPFFGVQPALVDNEGNPLEG------ATEGSLVITDSWPGQARTLFGDHE
ACSA_ECOL6       ATELKAGSATRPFFGVQPALVDNEGNPLEG------ATEGSLVITDSWPGQARTLFGDHE
ACSA_SALTI       AIELKAGSATRPFFGVQPALVDNEGHPQEG------ATEGNLVITDSWPGQARTLFGDHE
ACSA_SALTY       AIELKAGSATRPFFGVQPALVDNEGHPQEG------ATEGNLVITDSWPGQARTLFGDHE
ACSA_CITK8       ATELKAGSATRPFFGVQPALVDNEGHPQEG------ATEGNLVITDSWPGQARTLFGDHE
ACSA_CROS8       ATELKAGSATRPFFGVQPALVDNEGNPQQG------ATEGNLVITDSWPGQARTLFGDHE
ACSA_YERPA       ATELKAGSATRPFFGVQPALVDNLGNPQEG------VAEGNLVITDSWPGQARTLFGDHE
ACSA_YERPN       ATELKAGSATRPFFGVQPALVDNLGNPQEG------VAEGNLVITDSWPGQARTLFGDHE
ACSA_YERPE       ATELKAGSATRPFFGVQPALVDNLGNPQEG------VAEGNLVITDSWPGQARTLFGDHE
ACSA_YERPP       ATELKAGSATRPFFGVQPALVDNLGNPQEG------VAEGNLVITDSWPGQARTLFGDHE
ACSA_YERP3       ATELKAGSATRPFFGVQPALVDNLGNPQEG------VAEGNLVITDSWPGQARTLFGDHD
ACSA_YERPS       ATELKAGSATRPFFGVQPALVDNLGNPQEG------VAEGNLVITDSWPGQARTLFGDHD
ACSA_YERE8       ATELKAGSATRPFFGVQPALVDNLGNPQEG------AAEGNLVITDSWPGQARTLFGDHE
ACSA_SERP5       ATELKAGSATRPFFGVQPALVDNIGTVQEG------ACEGNLVITDSWPGQARTLFGDHD
ACSA_PHOLL       ATELKAGSATLPFFGVQPALVDNLGEQLEG------VCEGNLVITDSWPGQARSLFGDHD
ACSA_SODGM       AMALKPGSAALPFFGVQPALVDNVGTPVDG------AGEGNLVITDSWPGQARTLYGDHD
ACSA_AERHH       VTDLKPGSATRPFFGVQPALVDNMGEPLEG------ATEGNLVITDSWPGQMRTVFGDHE
ACSA_AERS4       VTDLKPGSATRPFFGVQPALVDNMGEPLEG------ATEGNLVITDSWPGQMRTVFGDHE
ACSA_VIBVU       ATALKPGSATRPFFGVQPALVDNMGNVIEDQ-----AAEGNLVILDSWPGQMRTVYGDHE
ACSA_VIBVY       ATALKPGSATRPFFGVQPALVDNMGNVIEDQ-----AAEGNLVILDSWPGQMRTVYGDHE
ACSA_VIBPA       ATDLKPGSATRPFFGVQPALVDNMGNILEDT-----VAEGNLVILDSWPGQMRTVYGDHE
ACSA_VIBCH       ATALKPGSATRPFFGVQPALVDNMGEIVEG------ATEGNLVLLDSWPGQMRTVYGDHD
ACSA_PHOPR       ATALKPGSATRPFFGVQPAIVDNMGNILEG------VAEGNLVMVDSWPGQMRTLWGDHE
ACSA_PSYIN       ATDLKPGSATRPFFGVQPAIVDSEGVVLEG------EAAGNLVMLDSWPGQMRTLYNNHD
ACSA_SHESR       ATDTKPGSATRPFFGVQPALVDNMGNILEG------ATEGNLVLLDSWPGQMRTVYGDHE
ACSA_SHESM       ATDTKPGSATRPFFGVQPALVDNMGNILEG------ATEGNLVLLDSWPGQMRTVYGDHE
ACSA_SHESA       ATDTKPGSATRPFFGVQPALVDNMGNILEG------ATEGNLVLLDSWPGQMRTVYGDHE
ACSA_SHEON       ATDTKPGSATRPFFGVQPALVDNMGNILEG------ATEGNLVLLDSWPGQMRTVYGDHE
ACSA_SHESW       ATDTKPGSATRPFFGVQPALVDNMGNILEG------ENEGNLVLLDSWPGQMRTVYGDHE
ACSA_SHEPC       ATDTKPGSATRPFFGVQPALVDNMGNILEG------ENEGNLVLLDSWPGQMRTVYGDHE
ACSA_SHEB5       ATDTKPGSATRPFFGVQPALVDNMGNILEG------ENEGNLVLLDSWPGQMRTVYGDHE
ACSA_SHEB8       ATDTKPGSATRPFFGVQPALVDNMGNILEG------ENEGNLVLLDSWPGQMRTVYGDHE
ACSA_SHEB9       ATDTKPGSATRPFFGVQPALVDNMGNILEG------ENEGNLVLLDSWPGQMRTVYGDHE
ACSA_SHEFN       ATDTKPGSATRPFFGVQPALVDNMGDIVEG------TGEGNLVILDSWPGQMRTVYGDHD
ACSA_SHEPA       ATDTKPGSATRPFFGVQPALVDNIGNIVEG------ANEGNLVILDSWPGQMRTVFGDHD
ACSA_SHEHH       ATDTKPGSATRPFFGVQPALVDNMGNIVDG------ASEGNLVILDSWPGQMRTVFGDHD
ACSA_SHELP       ATDTKPGSATRPFFGVQPALVDNMGNIIDG------AAEGNLVILDSWPGQMRTVYGDHD
ACSA_SHESH       ATDTKPGSATRPFFGVQPALVDNMGNIIDG------ATEGNLVILDSWPGQMRTVFGDHD
ACSA_SHEAM       ATDTKPGSATRPFFGVQPALVDNEGNILEG------ATEGNLVLLDSWPGQMRTVYGDHE
ACSA_SHEDO       AIATKPGSATRPFFGVKPAIVDSTGQILEG------AVEGNLVMLDSWPGQMRTVYGDHA
ACSA_PSEU2       ATALKPGSATRPFFGVIPALVDNLGNLIEG------AAEGNLVILDSWPGQSRSLYGDHD
ACSA_PSE14       ATALKPGSATRPFFGVIPALVDNLGNLIEG------AAEGNLVILDSWPGQSRSLYGDHD
ACSA_PSESM       ATALKPGSATRPFFGVIPALVDNLGNLIEG------AAEGNLVILDSWPGQSRTLYGDHD
ACSA1_PSEPK      ATGLKPGSATRPFFGVVPALVDNLGNLIDG------AAEGNLVILDSWPGQSRSLYGDHD
ACSA1_PSEAE      AHAMKPGSAAKPFFGVVPALVDNLGNLIEG------AAEGNLVILDSWPGQARTLFGDHD
ACSA_PSEU5       ATALKPGSATRPLFGVVPGLVDNLGNLLEG------PAEGNLVILDSWPGQMRTIYGDHD
ACSA_MARHV       AVDLKPGSATLPFFGVQPALVDNEGNILEG------KTEGNLVILDSWPGQMRTIYGDHE
ACSA2_PSEAE      ATALKPGSATRPFFGVQPVLLDEKGKEIDGA------GSGVLAIKASWPSQIRSVYGDHQ
ACSA2_PSEPK      TQSLKPGCATQPMFGVQPVLLDEKGKLIEGP------GAGVLAIKASWPGQIRSVYGDHQ
ACSA_ALKEH       ATDLKPGSATLPFFGVEPALVDPEGKELEGA------ASGNLVIKRAWPSMMRTVYGDHK
ACSA_HALHL       AMDLKPGSATLPFFGVEPQLVDDKGNVLEGA------TNGNLVINRAWPSMMRTIYGDHE
ACSA_MAGMM       ATPLKPGSATRPFFGVNPKVLSNEGKEMEGP------CEGILVLDHPWPGMMRTVYGDHD
ACSA_SACD2       AIDLKPGSATLPFFGVEPVLLDGEGNIIEGE------GEGSLAIKSSWPGQIRTVYGDHD
ACSA_ALCBS       AVDLKAGSATLPMFGVQPGLMDPDGNELDGA------ASGNLVLKASWPSQIRTVYGDHQ
ACSA_PRB01       ITPTKPGSATLPFFGVKPSLYDEHGNTLEGS------NAGNLVIEQSWPSQIRSIYGDHQ
ACSA_THIDA       AVPTKPGSCTLPLPGIMAAVTDEHGGPVAKG------QGGYLVIKRPFPSQLRTLWGDPE
ACSA_CHRVO       AIATKPGSCTLPLPGVIADIVDESGAQVEPG------RGGFLVIKKPFPSLVRTIWNDPE
ACSA_NITEU       AISTKPGSCTLPLPGIDAAVVDETGHPVEQG------KGGFLVIKRPFPSMLRTLWNDPE
ACSA_NITEC       AIPAKPGSCTLPLPGIDAAVVDETGLPAEQG------KGGFLVIKRPFPSMLRTLWNDPE
ACSA_METFK       AIDLKPGSCTRPLPGIIMDIVEEDGTHIEGT------GGGLLVVKKPWPSMIRNIWGNPE
ACSA_CUPNH       ATPLVPGSCTLPLPGIMAAIVDETGHDVPNG------NGGILVVKRPWPAMIRTIWGDPE
ACSA_CUPPJ       ATPLVPGSCTLPLPGIMAAIVDETGHDVPNG------SGGILVVKRPWPAMIRTIWGDPE
ACSA_CUPMC       ATPLVPGSCTLPLPGIMAAIVDETGQDVPNG------NGGILVVKRPWPSMIRTIWGDPE
ACSA_RALSO       ATPLVPGSCTLPLPGIMAAIVDETGQDLPDG------QGGILVVKRPWPAMIRTIWGDPE
ACSA_BURP0       ATPTVPGSCTLPLPGIMAAVVDETGQDVPNG------QGGILVVKRPWPAMARTIWGDPE
ACSA_BURMA       ATPTVPGSCTLPLPGIMAAVVDETGQDVPNG------QGGILVVKRPWPAMARTIWGDPE
ACSA_BURP6       ATPTVPGSCTLPLPGIMAAVVDETGQDVPNG------QGGILVVKRPWPAMARTIWGDPE
ACSA_BURP1       ATPTVPGSCTLPLPGIMAAVVDETGQDVPNG------QGGILVVKRPWPAMARTIWGDPE
ACSA_BURM7       ATPTVPGSCTLPLPGIMAAVVDETGQDVPNG------QGGILVVKRPWPAMARTIWGDPE
ACSA_BURPS       ATPTVPGSCTLPLPGIMAAVVDETGQDVPNG------QGGILVVKRPWPAMARTIWGDPE
ACSA_BURM9       ATPTVPGSCTLPLPGIMAAVVDETGQDVPNG------QGGILVVKRPWPAMARTIWGDPE
ACSA_BURMS       ATPTVPGSCTLPLPGIMAAVVDETGQDVPNG------QGGILVVKRPWPAMARTIWGDPE
ACSA_BURTA       ATPTVPGSCTLPLPGIMAAVVDETGQDVPNG------QGGILVVKRPWPAMARTIWGDPE
ACSA_BURL3       ATPTVPGSCTLPLPGIMAAVVDETGQDVPNG------QGGILVVKRPWPAMIRTIWGDPE
ACSA_HERAR       ATPMVPGSCTLPLPGIIAAVVDDGGHDLPNG------KGGLLVIKRPWPAMIRNIWNDPE
ACSA_PASMU       VTATKPGSCTLPLPGIMAEVLDENGQKCAVE------QGGALAIKRPFPSMLRTIWNDPE
ACSA_HELPY       ATPIRASCATLPLPGIHAEVLNEDGTKTKPG------EQGFLCITKPWPSMIRNIWGDEK
ACSA_HELPH       ATPIRASCATLPLPGIHAEVLNEDGTKTKPG------EQGFLCITKPWPSMVRNIWGDEK
ACSA_HELAH       ATPIRASCATLPLPGIHAEVLNEDGSKTKPG------EQGFLCITKPWPSMIRNIWGDEK
ACSA_CAMJJ       ATPLKPGCATLPLPGIFAEVIDEEGNKKDEG------EDGLLCITKPWPSMIRGIWGNDE
ACSA_CAMJE       ATPLKPGCATLPLPGIFAEVIDEEGNKKDEG------EDGLLCITKPWPSMIRGIWGNDE
ACSA_CAMJ8       ATPLKPGCATLPLPGIFAEVIDEEGNKKDEG------EDGLLCITKPWPSMIRGIWGNDE
ACSA_WOLSU       ATPIKPGCATLPLPGIFAEVIDEEGNPKPAG------EQGYLCITKPWPSMIRNIWGDPK
ACSA_RUBXD       ITRTKPGSATFPLPGIFAGIYDEEGNEIEGP------GVGNLVIKRPWPGMLRTLYKDPE
ACSA_STRAW       VTETKPGSAQRPLPGISATVVDDEAREVP------NGGGGYLVLTEPWPSMLRTIWGDDQ
ACSA_STRCO       VTHAKPGSAQRPLPGISATVVDDEANEVP------NGGGGYLVLTEPWPSMLRTIWGDDQ
ACSA_MYCBO       IAAAKPGSAMTPLPGISAKIVDDHGDPLPPHTEGAQHVTGYLVLDQPWPSMLRGIWGDPA
ACSA_MYCTU       IAAAKPGSAMTPLPGISAKIVDDHGDPLPPHTEGAQHVTGYLVLDQPWPSMLRGIWGDPA
ACSA_PYRAE       LVPMKPGTNGPPLPGFEVDVVDENGNPAP------PGVKGYLVIKKPWPGMLHGIWGDPE
ACSA_PYRAR       LVPMKPGTNGPPLPGFEVDVVDENGNPVP------PGVKGYLVIKKPWPGMLHGIWGDPE
ACSA_METSH       ITPLKPGSCTFPLPGYDISILDEEGNEVP------LGSGGNIVALKPYPSMLRAFWGDKE
                      ..    *: *    :                   * :    .:*.  : .: :  

ACSA_THET8       RFLQQYFSQHPG------VYFSGDGAKRD-KDGYYMILGRVDDVLNVAGHRLGTMEIESA
ACSA_THET2       RFLQQYFSQHPG------VYFSGDGAKRD-KDGYYMILGRVDDVLNVAGHRLGTMEIESA
ACSA_SYNY3       RFRHTYWEHIQPKE-GQYLYFAGDGARRD-KDGYFWVMGRVDDVINVSGHRLGTMEIESA
ACSA_THEEB       RFRRTYWEHIPPRD-GQYFYFAGDGARRD-EDGYFWVMGRVDDVINVSGHRLGTMEIESA
ACSA_DEIRA       RYRKSYWGEIPH------VYFAGDGARRD-HDGYYTIVGRVDDVLNVSGHRLGTMEIESA
ACSA_CHLTE       RYEKTYWSEFPG------MYFTGDGARKD-DDGYIWIMGRVDDVVNVSGHRLGTSEVESA
ACSA_RHOBA       RFVEQYWSDVPD------KYLTGDNARCD-TDGYYWIMGRIDDVINVSGHRLSTIEVESA
ACSA_LEPIC       RFFETYFSQFK------GYYFTGDGARRD-KDGYFWITGRVDDVINVSGHRIGSAEVESA
ACSA_LEPIN       RFFETYFSQFK------GYYFTGDGARRD-KDGYFWITGRVDDVINVSGHRIGSAEVESA
ACSA_LEPBL       RFFDTYFSQFK------GYYFTGDGARRD-KDGYYWITGRVDDVINVSGHRIGSAEVESA
ACSA_LEPBJ       RFFDTYFSQFK------GYYFTGDGARRD-KDGYYWITGRVDDVINVSGHRIGSAEVESA
ACSA_XANC8       RFIDTYFRTYP------GSYFTGDGCRRD-ADGYYWITGRVDDVINVSGHRIGTAEVESA
ACSA_XANCP       RFIDTYFRTYP------GSYFTGDGCRRD-ADGYYWITGRVDDVINVSGHRIGTAEVESA
ACSA_XANOM       RFIDTYFRTYP------GSYFTGDGCRRD-ADGYYWITGRVDDVINVSGHRIGTAEVESA
ACSA_XANAC       RFIDTYFRTYP------GSYFTGDGCRRD-ADGYYWITGRVDDVINVSGHRIGTAEVESA
ACSA_XYLFA       RFIDTYFRTYP------NTYFTGDGCRRD-ADGYYWITGRVDDVINISGHRIGTAEIEST
ACSA_XYLFT       RFIDTYFRTYP------NTYFTGDGCRRD-ADGYYWITGRVDDVINISGHRIGTAEIEST
ACSA_BDEBA       RFEDTYFSNYP------GYYFTGDGCRRD-QDGYYWITGRVDDVINVSGHRLGTAEIESA
ACSA_NOVAD       RFFQTYFTTFK------GLYFTGDGCRRD-EDGYYWITGRIDDVINVSGHRMGTAEIESA
ACSA_CAUVC       RFFETYFSTYP------GKYFTGDGCRRD-ADGYYWITGRVDDVINVSGHRLGTAEIESA
ACSA_BRADU       RFEQTYFSTYK------GKYFTGDGCRRD-ADGYYWITGRVDDVINVSGHRMGTAEVESA
ACSA_BRASO       RFEMTYFSTYK------GKYFTGDGCRRD-ADGYYWITGRVDDVINVSGHRMGTAEVESA
ACSA_RHOP5       RFEQTYFSAYP------GKYFTGDGCRRD-ADGYYWITGRVDDVINVSGHRMGTAEVESS
ACSA_PARL1       RFVETYFIQYP------GRYFTGDGCRRD-EDGYYWITGRVDDVLNVSGHRMGTAEVESA
ACSA_RHOCB       RFQETYFGQYR------GYYFTGDGCRRD-KDGYYWITGRVDDVINVSGHRMGTAEVESA
ACSA_BRUA2       RFIETYFSTYK------GMYFSGDGCRRD-EDGYYWITGRVDDVLNISGHRLGTAEIESA
ACSA_BRUAB       RFIETYFSTYK------GMYFSGDGCRRD-EDGYYWITGRVDDVLNISGHRLGTAEIESA
ACSA_BRUSU       RFIETYFSTYK------GMYFSGDGCRRD-EDGYYWITGRVDDVLNISGHRLGTAEIESA
ACSA_BRUC2       RFIETYFSTYK------GMYFSGDGCRRD-EDGYYWITGRVDDVLNISGHRLGTAEIESA
ACSA_BRUME       RFIETYFSTYK------GMYFSGDGCRRD-EDGYYWITGRVDDVLNISGHRLGTAEIESA
ACSA_BRUSI       RFIETYFSTYK------GMYFSGDGCRRD-EDGYYWITGRVDDVLNISGHRLGTAEIESA
ACSA_BRUO2       RFIETYFSTYK------GMYFSGDGCRRD-EDGYYWITGRVDDVLNISGHRLGTAEIESA
ACSA_OCHA4       RFIEAYFSTYK------GKYFTGDGCRRD-EDGYYWITGRVDDVLNISGHRLGTAEIESA
ACSA_AGRRH       RFIQTYFSTYE------GKYFTGDGCRRD-ADGYYWITGRVDDVLNVSGHRLGTAEVESA
ACSA_RHIEC       RFIQTYFSTYK------GKYFTGDGCRRD-EDGYYWITGRVDDVLNVSGHRLGTAEVESA
ACSA_RHIME       RFIQTYFSTYK------GKYFTGDGCRRD-EDGYYWITGRVDDVLNVSGHRLGTAEVESA
ACSA_SINMW       RFIQTYFSTYK------GKYFTGDGCRRD-EDGYYWITGRVDDVLNVSGHRLGTAEVESA
ACSA_AGRFC       RFVDTYFSTYK------GKYFTGDGCRRD-EDGYYWITGRVDDVLNVSGHRLGTAEVESA
ACSA_RHILO       RFVQTYFSTYK------GKYFTGDGCRRD-ADGYYWITGRVDDVINVSGHRMGTAEVESA
ACSA_BART1       RFIETYFSTYK------GKYFTGDGCRRD-SDGYYWITGRVDDILNVSGHRLGTAEIESA
ACSA_BARHE       RFIQTYFSTYK------GKYFTGDGCRRD-SDGYYWITGRVDDILNVSGHRLGTAEIESA
ACSA_BARQU       RFIETYFSTYK------GKYFTGDGCKRD-NDGYYWITGRIDDILNVSGHRLGTAEIESA
ACSA_BARBK       RFVETYFSTYK------GKYFTGDGCKRD-KDSYYWITGRVDDILNISGHRLGTAEIESA
ACSA_ECOLI       RFEQTYFSTFK------NMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_ECO57       RFEQTYFSTFK------NMYFSGDGARRD-EDSYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_ECOL6       RFEQTYFSTFK------NMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_SALTI       RFEQTYFSTFK------NMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_SALTY       RFEQTYFSTFK------NMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_CITK8       RFEQTYFSTFK------NMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_CROS8       RFEQTYFSTFK------NMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_YERPA       RFEQTYFSTFK------GMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_YERPN       RFEQTYFSTFK------GMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_YERPE       RFEQTYFSTFK------GMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_YERPP       RFEQTYFSTFK------GMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_YERP3       RFEQTYFSTFK------GMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_YERPS       RFEQTYFSTFK------GMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_YERE8       RFEQTYFSTFK------GMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_SERP5       RFEQTYFSTFK------GMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_PHOLL       RFEQTYFSTFK------GMYFSGDGARRD-EDGYYWITGRVDDVLNISGHRLGTAEIESA
ACSA_SODGM       RFKQTYFYTFK------GMYFSGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTSEIESA
ACSA_AERHH       RFEQTYFSTFP------GRYFTGDGARRD-EDGYYWITGRVDDVLNVSGHRMGTAEIESA
ACSA_AERS4       RFEQTYFSTFP------GRYFTGDGARRD-EDGYYWITGRVDDVLNVSGHRMGTAEIESA
ACSA_VIBVU       RFEQTYFSTFK------GMYFTGDGARRD-EDGYYWITGRVDDVLNVSGHRMGTAEIESA
ACSA_VIBVY       RFEQTYFSTFK------GMYFTGDGARRD-EDGYYWITGRVDDVLNVSGHRMGTAEIESA
ACSA_VIBPA       RFEQTYFSTFK------GMYFTSDGARRD-EDGYYWITGRVDDVLNVSGHRMGTAEIESA
ACSA_VIBCH       RFEQTYFSTFK------GMYFTGDGARRD-EDGYYWITGRVDDVLNVSGHRMGTAEIESA
ACSA_PHOPR       RFEQTYFSTFQ------GMYFTGDGARRD-EDGYYWITGRVDDVLNISGHRMGTAEIESA
ACSA_PSYIN       RFEQTYFSTFK------GMYFTGDGARRD-SDGYYWITGRVDDVLNVSGHRMGTAEIESA
ACSA_SHESR       RFVLTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHESM       RFVLTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHESA       RFVLTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHEON       RFVLTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHESW       RFVLTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHEPC       RFVLTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHEB5       RFVLTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHEB8       RFVLTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHEB9       RFVLTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHEFN       RFALTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHEPA       RFVLTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHEHH       RFVLTYFKTFR------GMYFTGDGAKRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHELP       RFALTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHESH       RFALTYFKTFR------GMYFTGDGAKRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHEAM       RFVLTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SHEDO       RFALTYFSTFK------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_PSEU2       RFVDTYFKTFR------GMYFTGDGARRD-EDGYFWITGRVDDVLNVSGHRMGTAEIESA
ACSA_PSE14       RFVDTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVLNVSGHRMGTAEIESA
ACSA_PSESM       RFVDTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVLNVSGHRMGTAEIESA
ACSA1_PSEPK      RFVDTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVLNVSGHRMGTAEIESA
ACSA1_PSEAE      RFVDTYFKTFK------GMYFTGDGARRD-EDGYYWITGRVDDVLNVSGHRMGTAEVESA
ACSA_PSEU5       RFVDTYFKTFR------GMYFTGDGARRD-EDGYYWITGRVDDVLNVSGHRMGTAEIESA
ACSA_MARHV       RFVQTYFSTYK------GMYFTGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEVESA
ACSA2_PSEAE      RMIDTYFKPYP------GYYFSGDGARRD-EDGYYWITGRVDDVINVSGHRIGTAEVESA
ACSA2_PSEPK      RMVDTYFKPLP------GYYFTGDGARRD-ADGDYWITGRIDDVINVSGHRIGTAEVESA
ACSA_ALKEH       RFMETYLAAYP------GMYFTGDGARRD-EDGYYWITGRVDDVINVSGHRMGTAEVESA
ACSA_HALHL       RFFNTYLAAYP------GKYFTGDGARRD-EDGYYWITGRVDDVINVSGHRMGTAEVESA
ACSA_MAGMM       RFINTYFANYP------GYYFCGDGCRRD-EDGYYWITGRVDDVINVSGHRLGTAEVESA
ACSA_SACD2       RLIQTYFSTYP------GYYFTGDGARRD-ADGYYWITGRVDDVLNVSGHRMGTAEVESA
ACSA_ALCBS       RLIDTYFSAYK------GCYFTGDGARRD-EDGYYWITGRVDDVLNVSGHRLGTAEIESA
ACSA_PRB01       RMIDTYFGMYK------DIYFTGDGARRD-EDGYFWITGRVDDVLNVSGHRLGTAEIESA
ACSA_THIDA       RFKKTYFPEEM----GGKTYLAGDSAHRD-DDGYFWIMGRIDDVLNVSGHRLGTMEIESA
ACSA_CHRVO       RFKKTYFPDEF----DGKYYLAGDSAHRD-ENGYFWIMGRIDDVLNVSGHRLGTMEIESA
ACSA_NITEU       RFRKTYFPTDIA---GGRYYLAGDSAHRD-QDGYFWIMGRVDDVLNVSGHRLGTMEIESA
ACSA_NITEC       RFRNTYFPADIA---GGHYYLAGDSAHRD-QDGYFWIMGRIDDVLNVSGHRLGTMEIESA
ACSA_METFK       RFRKAYFPEEL-----NGLYLAGDSAHRD-EDGYFWIMGRIDDVLNVSGHRLGTMEIESA
ACSA_CUPNH       RFRKSYFPEEL----GGKLYLAGDGSIRDKDTGYFTIMGRIDDVLNVSGHRMGTMEIESA
ACSA_CUPPJ       RFKKSYFPEEL----GGKLYLAGDGSIRDKETGYFTIMGRIDDVLNVSGHRMGTMEIESA
ACSA_CUPMC       RFKKSYYPEEL----GGKLYLAGDGSIRDKETGYFTIMGRIDDVLNVSGHRMGTMEIESA
ACSA_RALSO       RFRKSYFPAEL----GGKLYLAGDGSVRDKETGYFTIMGRIDDVLNVSGHRMGTMEIESA
ACSA_BURP0       RFKKSYFPEEL----GGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRLGTMEIESA
ACSA_BURMA       RFKKSYFPEEL----GGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRLGTMEIESA
ACSA_BURP6       RFKKSYFPEEL----GGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRLGTMEIESA
ACSA_BURP1       RFKKSYFPEEL----GGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRLGTMEIESA
ACSA_BURM7       RFKKSYFPEEL----GGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRLGTMEIESA
ACSA_BURPS       RFKKSYFPEEL----GGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRLGTMEIESA
ACSA_BURM9       RFKKSYFPEEL----GGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRLGTMEIESA
ACSA_BURMS       RFKKSYFPEEL----GGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRLGTMEIESA
ACSA_BURTA       RFKKSYFPDEL----GGRLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRLGTMEIESA
ACSA_BURL3       RFKKSYYPEEL----GGRLYLAGDGTVRDKDTGYFTIMGRIDDVLNVSGHRLGTMEIESA
ACSA_HERAR       RFEKSYFPHEL----GGRTYLAGDGAIRNEETGYFTITGRIDDVLNISGHRMGTAEIESA
ACSA_PASMU       RYKSTYFPAEY----GGKYYIAGDNAHRD-KDGYFWILGRTDDVLNVSGHRLGTMEIESA
ACSA_HELPY       RYIDSYFSQIKLN--GEYVYLSGDGAIVD-ENGYITIIGRTDDIVNVSGHRIGTAEVESA
ACSA_HELPH       RYIDSYFSQIKLN--GEYVYLSGDGAIVD-ENGYITIIGRTDDIVNVSGHRIGTAEVESA
ACSA_HELAH       RYIDSYFSQIQLN--GEYVYLSGDGAIVD-ENGYITIIGRTDDIVNVSGHRIGTAEVESA
ACSA_CAMJJ       RYIESYFSQAKKD--GKAVYFSGDGAFYD-KNGYITITGRTDDVVNVAGHRIGTAEIESA
ACSA_CAMJE       RYIESYFSQAKKD--GKAVYFSGDGAFYD-KNGYITITGRTDDVVNVAGHRIGTAEIESA
ACSA_CAMJ8       RYIESYFSQAKKD--GKAVYFSGDGAFYD-KNGYITITGRTDDVVNVAGHRIGTAEIESA
ACSA_WOLSU       RYESSYFSTCKKN--GKPVYFAGDGAIRD-ERGYITITGRMDDVINVSGHRLGTAEIESA
ACSA_RUBXD       RFRETYWQKYG------DVYFSGDGARRD-EDGYFWVTGRVDDVINVSGHRISTAEVESA
ACSA_STRAW       RFLDTYWSRF------EGKYFAGDGAKKD-EDGDIWLLGRVDDVMLVSGHNISTTEVESA
ACSA_STRCO       RFIDTYWSRF------EGKYFAGDGAKKD-DDGDIWLLGRVDDVMLVSGHNISTTEVESA
ACSA_MYCBO       RYWHSYWSKFSD----KGYYFAGDGARID-PDGAIWVLGRIDDVMNVSGHRISTAEVESA
ACSA_MYCTU       RYWHSYWSKFSD----KGYYFAGDGARID-PDGAIWVLGRIDDVMNVSGHRISTAEVESA
ACSA_PYRAE       RYIKTYWSRF------PGMFYAGDYAIKD-KDGYIWVLGRADEVIKVAGHRLGTYELESA
ACSA_PYRAR       RYVKTYWSRF------PGMFYVGDYAIKD-KDGYIWVLGRADEVIKVAGHRLGTYELESA
ACSA_METSH       RFMKEYWQFYWDVPGRRGVYLAGDKAQRD-KDGYFFIQGRIDDVLSVAGHRIANAEVESA
                 *    *             :  .*    :   .   : ** *::: ::**.:.. *:**:

ACSA_THET8       LVAHPAVAEAAVVGRPDPVKGEAIVAFVTLKEGH----TPSDALKEELRAHVAKVIGPIA
ACSA_THET2       LVAHPAVAEAAVVGRPDPVKGEAIVAFVTLKEGH----TPSDALKEELRAHVAKVIGPIA
ACSA_SYNY3       LVSHPLVAEAAVVGRPDELTGEAIFAFVSLEGNA----EPSEELKKDLVKHVTEEIGAIA
ACSA_THEEB       LVSHPAVAEAAVVGKPDEVKGEEIVAFVILEGSA----TPSDALQQELKQHVVNEIGALA
ACSA_DEIRA       LVAHPDVSEAAVVGRPDPVKGESVVAYVLLQDGH----TAD---PAALRAHVSSEIGALA
ACSA_CHLTE       LVSHEAVAEAAVVSRPDEIKGNALVAFVTLKDGY----EGDAKLRDSLGKHVAKEIGAIA
ACSA_RHOBA       LVSHPDVCEAAVVGRPHDLKGQAIAAFVTSNDR-----GHDDEFRNELKQHVRKQIGALA
ACSA_LEPIC       LVENKSVAEAAVVGFPHDIKGQGIYAYVTVKEG--VTTN--DVLKKELISTVEKMIGKIA
ACSA_LEPIN       LVENKSVAEAAVVGFPHDIKGQGIYAYVTVKEG--VTTN--DVLKKELISTVEKMIGKIA
ACSA_LEPBL       LVENRSVAEAAVVGFPHDIKGQGIYAYVTVKEG--IATN--DTLKKELVAIVEKVIGKIA
ACSA_LEPBJ       LVENRSVAEAAVVGFPHDIKGQGIYAYVTVKEG--IATN--DTLKKELVAIVEKVIGKIA
ACSA_XANC8       LVSHPKVAEAAVVGFPHDVKGQGIYAYVTLIAG--ETPS--EELHKELVSWVRKEIGPIA
ACSA_XANCP       LVSHPKVAEAAVVGFPHDVKGQGIYAYVTLIAG--ETPS--EELHKELVSWVRKEIGPIA
ACSA_XANOM       LVSHPKVAEAAVVGFPHDVKGQGIYAYVTLIAG--ETPS--DELHKELVSWVRKEIGPIA
ACSA_XANAC       LVSHPKVAEAAVVGFPHDVKGQGIYAYVTLIAG--QTPS--EDLHKELVSWVRKEIGPIA
ACSA_XYLFA       LVAHPKVAEAAVVGFPHPIKGQGIYAYVTLITG--ETPS--EALHQELLTWVRKEIGAIA
ACSA_XYLFT       LVAHPKVAEAAVVGFPHPIKGQGIYAYVTLITG--ETPS--EALHQELLTWVRKEIGAIA
ACSA_BDEBA       LVAHHKVAEAAVVGYPHDIKGQGIYAFVTLKSG--ETAS--EELRKELIQTVRKEIGPIA
ACSA_NOVAD       LVAHPKVAEAAVVGMPHDIKGQGIYAFVTCNAE--IEPD--DLLRKELIQWVRHEIGPIA
ACSA_CAUVC       LVAHETVAEAAVVGYPHDIKGQGVYAYVTLKAG--IEAT--DALRKDLVLWVRHEIGPFA
ACSA_BRADU       LVAHEKVSEAAVVGFPHDIKGQGIYAYVTLMAG--VQPT--EDLRKELVTWVRKEIGPIA
ACSA_BRASO       LVAHPKVSEAAVVGYPHDIKGQGIYAYVTLMAG--ETPS--EELRKELVGWVRKEIGPIA
ACSA_RHOP5       LVAHPQVSEAAVVGYPHDIKGQGIYAYVTLMTG--VEPT--EALRKELVAWVRKDIGPIA
ACSA_PARL1       LVAHPKVAEAAVVGYPHDIKGQGIYAYVTLIAG--EAAT--EELRKELVTWVRKEIGPIA
ACSA_RHOCB       LVAHPQVAEAAVVGYPHDIKGQGIYAYVTLMNG--IEPS--EDLRKDLVKWVRTEIGPIA
ACSA_BRUA2       LVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTG--ADAQDPDELRKELVQHVRKEIGPIA
ACSA_BRUAB       LVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTG--ADAQDPDELRKELVQHVRKEIGPIA
ACSA_BRUSU       LVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTG--ADAQDPDELRKELVQHVRKEIGPIA
ACSA_BRUC2       LVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTG--ADAQDPDELRKELVQHVRKEIGPIA
ACSA_BRUME       LVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTG--ADAQDPDELRKELVQHVRKEIGPIA
ACSA_BRUSI       LVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTG--ADAQDPDELRKELVQHVRKEIGPIA
ACSA_BRUO2       LVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTG--ADAQDPDELRKELVQHVRKEIGPIA
ACSA_OCHA4       LVSHHSVSEAAVVGYPHPIKGQGIYCYVTLMTG--EAVQDEDALRKELTQHVRKEIGPIA
ACSA_AGRRH       LVSHHLVSEAAVVGYPHNIKGQGIYCYVTLMAG--SEGS--EELRQQLVKHVRAEIGPIA
ACSA_RHIEC       LVSHNLVSEAAVVGYPHAIKGQGIYCYVTLMAG--HEGT--DTLRQELVKHVRAEIGPIA
ACSA_RHIME       LVSHNLVSEAAVVGYPHPIKGQGIYCYVSLMAG--EVGD--DELRQALVKHVRSEIGPIA
ACSA_SINMW       LVSHQLVSEAAVVGYPHSIKGQGIYCYVSLMAG--EVGN--DELRQALVKHVRSEIGPIA
ACSA_AGRFC       LVSHHQVSEAAVVGYPHPIKGQGIYCYVTLMAG--QSGD--YALREELVKHVRNEIGPVA
ACSA_RHILO       LVSHDKVSEAAVVGYPHDIKGQGIYSYVTLMKG--EEPT--EDLRKELIAHVRKEIGAIA
ACSA_BART1       LVLHPAVSEAAVVGYPHPIKGQGVYSFVTLMEG--TAPS--EELQKDLIKHVRKEIGSIA
ACSA_BARHE       LVSHPAVSEAAVVGYPHTIKGQGIYSFITLMEG--TAPS--EELHQELIRHVRKEIGSIA
ACSA_BARQU       LVSHPAISEAAVVGYPHPIKGQGIYSFVTLMEG--ITPS--EELYKDLIQHVKKEIGSIA
ACSA_BARBK       LISHPAVSEAAVVGYPHPIKGQGIYSFVTLMAG--TQPS--ATLHQNLIQHVRQEIGSIA
ACSA_ECOLI       LVAHPKIAEAAVVGIPHNIKGQAIYAYVTLNHG--EEPS--PELYAEVRNWVRKEIGPLA
ACSA_ECO57       LVAHPKIAEAAVVGIPHNIKGQAIYAYVTLNHG--EEPS--PELYAEVRNWVRKEIGPLA
ACSA_ECOL6       LVAHPKIAEAAVVGIPHNIKGQAIYAYVTLNHG--EEPS--PELYAEVRNWVRKEIGPLA
ACSA_SALTI       LVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHG--EEPS--PELYAEVRNWVRKEIGPLA
ACSA_SALTY       LVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHG--EEPS--PELYAEVRNWVRKEIGPLA
ACSA_CITK8       LVSHPKIAEAAVVGIPHNIKGQAIYAYVTLNHG--EDPS--PELYTEVRNWVRKEIGPLA
ACSA_CROS8       LVSHPKIAEAAVVGIPHSIKGQAIYAYVTLNHG--EEPS--AELYSEVRNWVRKEIGPLA
ACSA_YERPA       LVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHG--EEPT--PELYTEVRNWVRKEIGPLA
ACSA_YERPN       LVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHG--EEPT--PELYTEVRNWVRKEIGPLA
ACSA_YERPE       LVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHG--EEPT--PELYTEVRNWVRKEIGPLA
ACSA_YERPP       LVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHG--EEPT--PELYTEVRNWVRKEIGPLA
ACSA_YERP3       LVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHG--EEPT--PELYTEVRNWVRKEIGPLA
ACSA_YERPS       LVAHPKIAEAAVVGVPHNIKGQAIYAYITLNHG--EEPT--PELYTEVRNWVRKEIGPLA
ACSA_YERE8       LVSHPKIAEAAVVGVPHNIKGQAIYAYITLNHG--EEPT--PELYTEVRNWVRKEIGPIA
ACSA_SERP5       LVSHPKIAEAAVVGIPHNIKGQAIYAYITLNHG--EEPT--PELYTEVRNWVRKEIGPIA
ACSA_PHOLL       LVSHPKIAEAAVVGTPHNIKGQAIYAYVTLNHG--EEPS--PELYTEVRNWVRKEIGPIA
ACSA_SODGM       LVAHPKIAEAAVVGMPHNIKGQAIYAYITLNAG--ETPT--PELYNEVRAWMRKEIGAIA
ACSA_AERHH       LVSHPKIAEAAVVGVPHEIKGQGIYAYVTLIAG--EEPS--RELHKEVKEWVRKEIGAIA
ACSA_AERS4       LVAHPKIAEAAVVGVPHEIKGQGIYAYVTLIAG--EEPS--RELHKEVKEWVRKEIGAIA
ACSA_VIBVU       LVAHPKIAEAAIVGIPHDIKGQAIYAYVTLNAG--EYPT--AELHKEVKDWVRKEIGPIA
ACSA_VIBVY       LVAHPKIAEAAIVGIPHDIKGQAIYAYVTLNAG--EYPT--AELHKEVKDWVRKEIGPIA
ACSA_VIBPA       LVAHHKIAEAAIVGIPHDIKGQAIYAYITLNDG--EFPS--AELHKEVKDWVRKEIGPIA
ACSA_VIBCH       LVAFNKIAEAAVVGVPHDIKGQAIYAYITLNDG--VYPS--AELHKEVKDWVRKEIGAIA
ACSA_PHOPR       LVAFDKIAEAAIVGVPHDIKGQAIYAYITLNDG--EIPS--AELHKEVKDWVRKEIGPIA
ACSA_PSYIN       LVSHPKIAEAAVVGVPHEIKGQGIYAYVTLNEG--EYPS--PELYAEVKQWVRKEIGAIA
ACSA_SHESR       LVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRG--TEES--EELRQELRQWVRKEIGALA
ACSA_SHESM       LVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRG--TEES--EELRQELRQWVRKEIGALA
ACSA_SHESA       LVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRG--TEES--EELRQELRQWVRKEIGALA
ACSA_SHEON       LVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRG--TEES--EELRQELRQWVRKEIGALA
ACSA_SHESW       LVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRG--TEES--EELRQELRQWVRKEIGALA
ACSA_SHEPC       LVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRG--TEES--EELRQELRQWVRKEIGALA
ACSA_SHEB5       LVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRG--TEET--EELRQELRQWVRKEIGALA
ACSA_SHEB8       LVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRG--TEET--EELRQELRQWVRKEIGALA
ACSA_SHEB9       LVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRG--TEET--EELRQELRQWVRKEIGALA
ACSA_SHEFN       LVSHELVAEAAVVGYPHDIKGQGIYAYVTLTRG--IEPT--EELRQELRQWVRKEIGALA
ACSA_SHEPA       LVAHELVAEAAVVGYPHDIKGQGIYAYVTLTKG--SVET--EELRQELRQWVRKEIGALA
ACSA_SHEHH       LVAHEFVAEAAVVGYPHDIKGQGIYAYVTLTKG--SVET--EELRQELRQWVRKEIGALA
ACSA_SHELP       LVAHEHVAEAAVVGYPHDIKGQGIYAYVTLTKG--TQES--EELRQELRQWVRKEIGALA
ACSA_SHESH       LVAHEHVAEAAVVGYPHDIKGQGIYAYVTLTKG--TIET--EELRQELRKWVRKEIGALA
ACSA_SHEAM       LVAHDLVAEAAVVGYPHDIKGQGIYAYVTLTKG--TEAT--EELRQELRQWVRKEIGALA
ACSA_SHEDO       LVAHEQVAEAAVVGYPHDIKGQGIYAYVTLVHD--AEPS--EALRQELRQWVRKEIGALA
ACSA_PSEU2       MVAHPKVAEAAVVGVPHDLKGQGIYVYVTLNGG--EEPS--DALRTELRNWVRKEIGPIA
ACSA_PSE14       MVAHPKVAEAAVVGVPHDLKGQGIYVYVTLNGG--EEPS--DALRTELRNWVRKEIGPIA
ACSA_PSESM       MVAHPKVAEAAVVGVPHDLKGQGIYVYVTLNAG--EEPS--DALRTELRNWVRKEIGPIA
ACSA1_PSEPK      MVAHSKVAEAAVVGVPHDIKGQGIYVYVTLNAG--IEAS--EQLRLELKNWVRKEIGPIA
ACSA1_PSEAE      MVAHPKVAEAAVVGMQHDIKGQGIYVYVTLNSG--VEPS--EALRQELKQWVRREIGPIA
ACSA_PSEU5       LVAHAKVAEAAAVGVPHPLKGQAIYVYVTLVAG--TEPS--DTLRQELQQWVRHEIGPIA
ACSA_MARHV       LVAHDKVAEAAVVGYPHDIKGQGIYVYVTLVQG--EEPS--DELKKELVQWVRKEIGPIA
ACSA2_PSEAE      LVLHDAVAEAAVVGCPHDVKGQAIYAFVTLMAG--SQPS--EALQQELLALVGKEIGSFA
ACSA2_PSEPK      LVLHDSVAEAAVVGYPHDLKGQGVYAFVTTMNG--VTPD--DTLKAELLALVSKEIGSFA
ACSA_ALKEH       LVLHDAVAEAAVVGYPHDIKGQGIYAYVTLMAG--VEPS--DELKKELVKLVSNEIGPIA
ACSA_HALHL       LVLHDKVSEAAVVGYPHDVKGQGIYAYVTLMAG--EEPS--DELKQELVKLCIQEIGPIA
ACSA_MAGMM       LVLHDQVAEAAVVGMPHEIKGQGIYAYVTLMSG--VEPS--DALKTELVKLVRKEIGPIA
ACSA_SACD2       LVLHPKVAEAAVVGYPHDVKGQGIYAYVTLMTG--VEPD--DGLRKELVAMCTQEIGPIA
ACSA_ALCBS       LVLHPSISEAAVVGYQHDVKGQGIYAYVSLMAG--KEGS--EELVKALRDLVTQEIGPIA
ACSA_PRB01       LVLHPKIAEAAVVGFDHPIKGQGIYAFVTLMIN--ESFD--DNFSYELKQFVAKEIGAIA
ACSA_THIDA       LVSNPRVAEAAVVGRPHEVKGEAVVAYVVLKGARAVG-DEAKDIARELRDWVGKEIGPIA
ACSA_CHRVO       LVANPLVAEAAVVGKPHEVKGEAVVAFVVLKGARPQG-DAAKTVAAELKNWVAHEIGKIA
ACSA_NITEU       LVAHPLVAEAAVVGKPHEIKGEVVVAFVTLREKLPDD-QRAAEIAATLREWVASEIGAIA
ACSA_NITEC       LVAHPLVAEAAVVGKPHEIRGEVIVAFVVLRGKLPDD-QQAAEIAETLREWVSSEIGAIA
ACSA_METFK       LVANPLVAEAAIVGKPHDIKGESIVAYVVLKGERPEG-EAAKTIAGQLREWVGKEIGPIA
ACSA_CUPNH       LVSNPLVAEAAVVGRPDDMTGEAICAFVVLKRSRPTG-EEAVKIATELRNWVGKEIGPIA
ACSA_CUPPJ       LVANPIVAEAAVVGRPDDTTGEAICAFVVLKRARPSD-AEAQQIATELRNWVAKEIGPIA
ACSA_CUPMC       LVSNPIVAEAAVVGRPDDTTGEAICAFVVLKRSRPTA-EEAVKIAAELRNWVGKEIGPIA
ACSA_RALSO       LVANPLVAEAAVVGRPDDMTGEAICAFVVLKRTRPNG-DEARQIATDLRNWVGKEIGPIA
ACSA_BURP0       LVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEG-EEAAALAKTLRDWVGKEIGPIA
ACSA_BURMA       LVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEG-EEAAALAKTLRDWVGKEIGPIA
ACSA_BURP6       LVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEG-EEAAALAKTLRDWVGKEIGPIA
ACSA_BURP1       LVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEG-EEAAALAKTLRDWVGKEIGPIA
ACSA_BURM7       LVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEG-EEAAALAKTLRDWVGKEIGPIA
ACSA_BURPS       LVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEG-EEAAALAKTLRDWVGKEIGPIA
ACSA_BURM9       LVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEG-EEAAALAKTLRDWVGKEIGPIA
ACSA_BURMS       LVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEG-EEAAALAKTLRDWVGKEIGPIA
ACSA_BURTA       LVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEG-EEAAALAKTLRDWVGKEIGPIA
ACSA_BURL3       LVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEG-EEAAALAKTLRDWVGKQIGPIA
ACSA_HERAR       LVANPMVAEAAVVGKPDETTGESICAFVVLKRVRPEG-DEAKQIAKELRDWVAKEIGPIA
ACSA_PASMU       LVASPKVAEAAVVGKPDEIKGEAIVAFVVLNDFRPEG-EEARQLAEELKAWVSNEIGKIA
ACSA_HELPY       ISKHEMVAECAVVGIPDAIKGEGLFAFVVLCDGAKCNLGESLELLKEMNHILSIEIGKIA
ACSA_HELPH       ISKHEMVVECAVVGIPDTIKGEGLFAFVVLCDGAKCNLGESLELLKEMNHILSVEIGKIA
ACSA_HELAH       ISKHEMVVECAVVGIPDTIKGEGLFAFVVLCDGAKCNLGESLELLKEMNHILAVEIGKIA
ACSA_CAMJJ       IAKHPSVAESAVVSILDTIKGESLFAFVVLSPASSCDLGGAIETLKELNDILRVEIGPIA
ACSA_CAMJE       IAKHPSVAESAVVSILDTIKGESLFAFVVLSPASSCDLGGAIETLKELNDILRVEIGPIA
ACSA_CAMJ8       IAKHPSVAESAVVSILDAIKGESLFAFVVLSPASSCDLGGAIETLKELNDILRVEIGPIA
ACSA_WOLSU       IAKHPGVAETAVVSRLDEIKGESVYAFIVLKPGYEDNVAEELQLLKEINAVITREIGPLA
ACSA_RUBXD       LVAHPAVAEAAVIGRYDEDTGQAIVAYVILEGG--REGN--DELAQELRQQVRKVIGAHA
ACSA_STRAW       LVSHPSVAEAAVVGAADETTGQAIVAFVILRGTANAEDDN---LVADLRNHVGTTLGPIA
ACSA_STRCO       LVSHPSVAEAAVVGATDETTGQAIVAFVILRGTTAESED----LVAELRNHVGATLGPIA
ACSA_MYCBO       LVAHSGVAEAAVVGVTDETTTQAICAFVVLRANYAPHDR----TAEELRTEVARVISPIA
ACSA_MYCTU       LVAHSGVAEAAVVGVTDETTTQAICAFVVLRANYAPHDR----TAEELRTEVARVISPIA
ACSA_PYRAE       LISHPAVAESAVVGVPDAIKGEVPIAFVVLKQGVAPSDE----LRKELREHVRRTIGPIA
ACSA_PYRAR       FVAHPAVAEAAVVGVPDAIKGEVPIAFVVLKQGVTPTEE----LRKELREHIRKSIGPIA
ACSA_METSH       LVAHPKIAEAAVVGKPDEVKGESIVAFVILRVGNEPSPE----LAKDAIAFVRKTLGPVA
                 :     : * * :.  .    :    ::                           :.  *

ACSA_THET8       RPDEIRFTDALPKTRSGKIMRRLLRQIAAGEKEIKGDTSTLEDRSVVERLKEGA------
ACSA_THET2       RPDEIRFTDALPKTRSGKIMRRLLRQIAAGEKEIKGDTSTLEDRSVVERLKEGA------
ACSA_SYNY3       RPAEIRFTDVLPKTRSGKIMRRLLRSLASGQ-EISGDTSTLEDRTVLDKLREG-------
ACSA_THEEB       RPAEIRFTDALPKTRSGKIMRRLLRSLAAGQ-EVVGDTSTLEDRSVLDRLRQGS------
ACSA_DEIRA       RPDAIYIADALPKTRSGKIMRRFLRQLAAGQ-PVQGDTSTLEDPTVLERLQASPAL----
ACSA_CHLTE       KPDEIRWAKGLPKTRSGKIMRRLLRELATSN-EIKGDVTTLEDLGVIENLREQEDEG---
ACSA_RHOBA       QPDDIRFTAALPKTRSGKIMRRLLRDVAAGR-ELVGDTSTLEDLSSLAKLREED------
ACSA_LEPIC       RPDVIHWAPGLPKTRSGKIMRRILRKIASGEFEGLGDTSTLADPSVVQKLIEDKKKFHS-
ACSA_LEPIN       RPDVIHWAPGLPKTRSGKIMRRILRKIVSGEFEGLGDTSTLADPSVVQKLIEDKKKFHS-
ACSA_LEPBL       RPDVIHWAPSLPKTRSGKIMRRILRKIASGEFEGLGDTSTLADPSVVQKLIEDKRKFHS-
ACSA_LEPBJ       RPDVIHWAPSLPKTRSGKIMRRILRKIASGEFEGLGDTSTLADPSVVQKLIEDKRKFHS-
ACSA_XANC8       SPDHLQWAPGLPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSVVDSLVNERLTR---
ACSA_XANCP       SPDHLQWAPGLPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSVVDSLVNERLTR---
ACSA_XANOM       SPDHLQWAPGLPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSVVDSLVNERLTR---
ACSA_XANAC       SPDHLQWAPGLPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSVVDSLVNERLAR---
ACSA_XYLFA       TPDHVQWAPNLPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSIVDLLLNERLTH---
ACSA_XYLFT       IPDHVQWASNLPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSIVDLLLNERLKH---
ACSA_BDEBA       TPDLIQWAPRLPKTRSGKIMRRILRKIAENHPDQLGDTTTLSEPAVVQELVDNRMNR---
ACSA_NOVAD       TPDVIQFAPGLPKTRSGKIMRRILRKIGENDVSNLGDTSTLADPSVVDNLLANRPQLAGA
ACSA_CAUVC       APDVIQWAPGLPKTRSGKIMRRILRKIAENELGSLGDTSTLADPSVVDDLVKNRAGT---
ACSA_BRADU       SPDQIQFAPGLPKTRSGKIMRRILRKIAEDEPGSLGDTSTLADPAVVDDLVKNRQNKKSA
ACSA_BRASO       SPDQIQFSQGLPKTRSGKIMRRILRKIAEDEPGALGDTSTLADPAVVDDLVQHRQNRKEK
ACSA_RHOP5       SPDLIQFAPGLPKTRSGKIMRRILRKIAEDESSTLGDTSTLADPGVVSELVEHRQNKRHV
ACSA_PARL1       SPDLIQFAPGLPKTRSGKIMRRILRKIAEDDFSNLGDTSTLADPSVVTDLVDNRQNKAG-
ACSA_RHOCB       SPDLIQWAPGLPKTRSGKIMRRILRKIAENDYGALGDISTLADPGVVQELIDNRMNRA--
ACSA_BRUA2       TPDKIQFAPGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADPGVVDDLIENRQNKK--
ACSA_BRUAB       TPDKIQFAPGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADPGVVDDLIENRQNKK--
ACSA_BRUSU       TPDKIQFAPGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADPGVVDDLIENRQNKK--
ACSA_BRUC2       TPDKIQFAPGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADPGVVDDLIENRQNKK--
ACSA_BRUME       TPDKIQFAPGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADRGVVDDLIENRQNKK--
ACSA_BRUSI       TPDKIQFAPGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADPGVVDDLIENRQNKK--
ACSA_BRUO2       TPDKIQFAPGLPKTRSGKIMRRILRKIAEDESGALGDTSTLADPGVVDDLIENRQNKK--
ACSA_OCHA4       TPDKIQFSPGLPKTRSGKIMRRILRKIAEDEFGALGDTSTLADPGVVDDLIENRQNKK--
ACSA_AGRRH       SPDKIQFAPGLPKTRSGKIMRRILRKIAEDDFGSLGDTSTLADPAVVDDLIANRQNRAEA
ACSA_RHIEC       SPDKIQFAPGLPKTRSGKIMRRILRKIAEDDFGALGDTSTLADPAVVDDLIANRQNKATA
ACSA_RHIME       TPDKIQFAPGLPKTRSGKIMRRILRKIAEDDFGSLGDTSTLADPGVVDDLIANRQNRA--
ACSA_SINMW       TPDKIQFAPGLPKTRSGKIMRRILRKIAEDDFGSLGDTSTLADPSVVDDLIANRQNRA--
ACSA_AGRFC       TPDKIQFAPGLPKTRSGKIMRRILRKIAEDDFGALGDTSTLADPAVVEDLIANRQNRTAS
ACSA_RHILO       SPDKIQFAPGLPKTRSGKIMRRILRKIAEDDFSTLGDTSTLADPAVVDDLIANRQNKKG-
ACSA_BART1       ILDKIQFAPQLPKTRSGKIMRRILRKIAENNFDNLGDISTLAEPQVVEDLIANRQN----
ACSA_BARHE       ILDKVQFAPQLPKTRSGKIMRRILRKIAENNFDNLGDISTLSEPQVIDDLIANRQNREIT
ACSA_BARQU       LLDKIQFTPQLPKTRSGKIMRRILRKIAENDFDNLGDISTLAEPQVVDDLIANRQNTEAT
ACSA_BARBK       TLDKIQFAPHLPKTRSGKIMRRILRKIAANNFDNLGDISTLAEPQIVDNLIANRQNIEEA
ACSA_ECOLI       TPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMP
ACSA_ECO57       TPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMP
ACSA_ECOL6       TPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMP
ACSA_SALTI       TPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMP
ACSA_SALTY       TPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMP
ACSA_CITK8       TPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMP
ACSA_CROS8       TPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQSIAMP
ACSA_YERPA       TPDILHWTDSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVEKLLEEKQSMQTP
ACSA_YERPN       TPDILHWTDSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVEKLLEEKQSMQTP
ACSA_YERPE       TPDILHWTDSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVEKLLEEKQSMQTP
ACSA_YERPP       TPDILHWTDSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVEKLLEEKQSMQTP
ACSA_YERP3       TPDILHWTDSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVEKLLEEKQSMQTP
ACSA_YERPS       TPDILHWTDSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVEKLLEEKQSMQTP
ACSA_YERE8       TPDILHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVDKLLEEKQSMQAP
ACSA_SERP5       TPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPAVVDKLLEEKQSMKVP
ACSA_PHOLL       TPDILHWTDSLPKTRSGKIMRRILRKIASGDTNNLGDISTLADPGVVEKLLEEKQTMSIS
ACSA_SODGM       TPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTGNLGDTSTLADPGVVEKLLEEKHTLTLP
ACSA_AERHH       TPDVIHWAEGLPKTRSGKIMRRILRKIATGETDSLGDISTLADPGVVDKLIREKSEAA--
ACSA_AERS4       TPDVIHWAEGLPKTRSGKIMRRILRKIATGETDSLGDISTLADPGVVDKLIREKSEAA--
ACSA_VIBVU       TPDVLHWTDALPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVDKLIAEKAELV--
ACSA_VIBVY       TPDVLHWTDALPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVDKLIAEKAELV--
ACSA_VIBPA       TPDVLHWTDSLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVDKLIAEKAELV--
ACSA_VIBCH       TPDVLHWTDALPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVDRLIAEKAQLK--
ACSA_PHOPR       TPDFLHWTDALPKTRSGKIMRRILRKIATGDTGSLGDTSTLADPSVVDKLIAEKQTIL--
ACSA_PSYIN       TPDILHWAEGLPKTRSGKIMRRILRKIATGESDSLGDISTLADPSVVEQLIKENRETS--
ACSA_SHESR       TPDLIQWATGLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIETRLNRNE-
ACSA_SHESM       TPDLIQWATGLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIETRLNRNE-
ACSA_SHESA       TPDLIQWATGLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIETRLNRNE-
ACSA_SHEON       TPDLIQWATGLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIETRLNRNE-
ACSA_SHESW       TPDLIQWASGLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIETRLNRTE-
ACSA_SHEPC       TPDLIQWASGLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIETRLNRTE-
ACSA_SHEB5       TPDLIQWATGLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIESRLNRTE-
ACSA_SHEB8       TPDLIQWATGLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIESRLNRTE-
ACSA_SHEB9       TPDLIQWATGLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIETLIESRLNRTE-
ACSA_SHEFN       TPDLIQWASGLPKTRSGKIMRRFLRKIAANEVTNLGDSSTLADPAVIDTLIESRLNKTE-
ACSA_SHEPA       TPDLIQWAGGLPKTRSGKIMRRFLRKIAANEVTNLGDSSTLADPAVIDTLIETRLNRSE-
ACSA_SHEHH       TPDLIQWAGGLPKTRSGKIMRRFLRKIAANEVSNLGDSSTLADPAVIDTLIETRLNRSE-
ACSA_SHELP       TPDLIQWAGGLPKTRSGKIMRRFLRKIAANEVTNLGDASTLADPAVIDTLIETRLNRSE-
ACSA_SHESH       TPDLIQWAGGLPKTRSGKIMRRFLRKIAANEVTNLGDSSTLADPAVIDTLIESRLNRSE-
ACSA_SHEAM       TPDLIQWASGLPKTRSGKIMRRFLRKIAANEITNLGDASTLADPSVIDTLIESRLNRAD-
ACSA_SHEDO       TPDLIQWATGLPKTRSGKIMRRFLRKIAANEVTNLGDSSTLADPSVIDTLIASRLNQR--
ACSA_PSEU2       SPDFIQWAPGLPKTRSGKIMRRILRKIATAEYDALGDISTLADPGVVQHLIDTHKTMNAA
ACSA_PSE14       SPDFIQWAPGLPKTRSGKIMRRILRKIATAEYDALGDISTLADPGVVQHLIDTHKTMNAA
ACSA_PSESM       SPDFIQWAPGLPKTRSGKIMRRILRKIATAEYDALGDISTLADPGVVQHLIETHKSMSAA
ACSA1_PSEPK      SPDVIQWAPGLPKTRSGKIMRRILRKIATGEYDALGDISTLADPGVVQHLIDTHKAMNLA
ACSA1_PSEAE      TPDVIQWAPGLPKTRSGKIMRRILRKIAAAEYDTLGDISTLADPGVVQHLIETHRSMQAA
ACSA_PSEU5       VPDTIQWAPGLPKTRSGKIMRRLLRKIATDDYDTLGDTSTLADPGVVDQLIAAHEAVKQR
ACSA_MARHV       SPDVIQWAPGLPKTRSGKIMRRILRKIAANEHDQLGDTSTLADPGVVDELISSRAFK---
ACSA2_PSEAE      KPDHLQWAPSLPKTRSGKIMRRILRKIACNELDSLGDTSTLADPGVVQGLIDNRLNR---
ACSA2_PSEPK      KPELIQWAPALPKTRSGKIMRRILRKIACNELENLGDTSTLADPSVVQGLIDKRLNQ---
ACSA_ALKEH       KPDVIQWAPGLPKTRSGKIMRRILRKVAANELDSLGDTSTLADPTVVDNLIEDRPNK---
ACSA_HALHL       KPDIIQFAPGLPKTRSGKIMRRILRKVASNELDSLGDTSTLADPTVVDTLIEDRANQ---
ACSA_MAGMM       SLDVIQFAPGLPKTRSGKIMRRILRKIAAHEVDTLGDTSTLADPSVVQNLIDNMPK----
ACSA_SACD2       KPDLIQWAPGLPKTRSGKIMRRILRKVAANELDTLGDTSTLADPSVVDDLIENRMNR---
ACSA_ALCBS       KPDLIHFAPGLPKTRSGKIMRRILRKIAADELDSLGDTSTLADPSVVDQLIDNRQNK---
ACSA_PRB01       KPDLIQNAPGLPKTRSGKIMRRILRKIAENDLSNLGDTTTLADPSVVESLIENKQSL---
ACSA_THIDA       KPDEIRFGENLPKTRSGKIMRRLLRAIAKGE-EITQDVSTLENPAILDQLKEAVK-----
ACSA_CHRVO       QPDDIRFGENLPKTRSGKIMRRLLRSIAKGE-EITQDVSTLENPQILQQLQQPL------
ACSA_NITEU       RPEEIRFGENLPKTRSGKIMRRLLRALARGE-TITQDVSTLENPVILEQLSQTV------
ACSA_NITEC       RPEEIRFGENLPKTRSGKLMRRLLRSLARGE-TITQDISTLENPVILEQFSQTI------
ACSA_METFK       KPDEIRFGENLPKTRSGKIMRRLLRSLAKGE-EITSDISTLDNPAILDQLRQSAG-----
ACSA_CUPNH       KPKDIRFGDNLPKTRSGKIMRRLLRSLAKGE-EITQDTSTLENPAILEQLKQAQ------
ACSA_CUPPJ       KPKDIRFGDNLPKTRSGKIMRRLLRSLAKGE-EITQDTSTLENPAILDQLKQAQ------
ACSA_CUPMC       KPKDIRFGDNLPKTRSGKIMRRLLRSLAKGE-DITQDTSTLENPAILDQLKQAQ------
ACSA_RALSO       KPKDIRFGDNLPKTRSGKIMRRLLRSIAKGE-DITQDTSTLENPAILEQLKEAR------
ACSA_BURP0       KPKDIRFGDNLPKTRSGKIMRRLLRSLAKGE-AITQDTSTLENPAILEQLAEVR------
ACSA_BURMA       KPKDIRFGDNLPKTRSGKIMRRLLRSLAKGE-AITQDTSTLENPAILEQLAEVR------
ACSA_BURP6       KPKDIRFGDNLPKTRSGKIMRRLLRSLAKGE-AITQDTSTLENPAILEQLAEVR------
ACSA_BURP1       KPKDIRFGDNLPKTRSGKIMRRLLRSLAKGE-AITQDTSTLENPAILEQLAEVR------
ACSA_BURM7       KPKDIRFGDNLPKTRSGKIMRRLLRSLAKGE-AITQDTSTLENPAILEQLAEVR------
ACSA_BURPS       KPKDIRFGDNLPKTRSGKIMRRLLRSLAKGE-AITQDTSTLENPAILEQLAEVR------
ACSA_BURM9       KPKDIRFGDNLPKTRSGKIMRRLLRSLAKGE-AITQDTSTLENPAILEQLAEVR------
ACSA_BURMS       KPKDIRFGDNLPKTRSGKIMRRLLRSLAKGE-AITQDTSTLENPAILEQLAEVR------
ACSA_BURTA       KPKDIRFGDNLPKTRSGKIMRRLLRSLAKGE-AITQDTSTLENPAILEQLAEVR------
ACSA_BURL3       KPKDIRFGDNLPKTRSGKIMRRLLRSLAKGE-AITQDTSTLENPAILDQLAEVR------
ACSA_HERAR       KPKEIRFGDNLPKTRSGKIMRRLLRVLAKDE-DITQDISTLENPAILEQLKQAQ------
ACSA_PASMU       RPEDIRFADNLPKTRSGKIMRRLLRSIAKNE-MITQDISTLENPQIIGQLQQQWL-----
ACSA_HELPY       KLDNVMYVPGLPKTRSGKIMRRLLKSIAKKE-PITQDLSTLEDVNVVKEIMSIAQMEE--
ACSA_HELPH       KLDNVMYVPGLPKTRSGKIMRRLLKSIAKKE-PITQDLSTLEDVNVVKEIMSIVQMEE--
ACSA_HELAH       KLDNVMYVPGLPKTRSGKIMRRILKSIVKKE-PITQDLSTLEDVNVVKEIINIAQMEE--
ACSA_CAMJJ       KIEKILYTPGLPKTRSGKIMRRILRTIARGE-EIKQDISTLEDSKVVETIVKLAKAEFE-
ACSA_CAMJE       KIEKILYTPGLPKTRSGKIMRRILRTIARGE-EIKQDISTLEDSKVVETIVKLAKAEFE-
ACSA_CAMJ8       KIEKILYTPGLPKTRSGKIMRRILRTIARGE-EIKQDISTLEDSGVVETIVKLAKAEFE-
ACSA_WOLSU       KADTMLFVPGLPKTRSGKIMRRILRSIARGE-EITQDTSTLEDPAIVQKIQQLA------
ACSA_RUBXD       RPQEIIFTPDLPKTRSGKIMRRILRSLSEGR-DDLGDTTTLADPGVVESLKEQVAASR--
ACSA_STRAW       KPKRILPVAELPKTRSGKIMRRLLRDVAENR--ALGDVTTLTDSSVMDLIQSKLPAAPSE
ACSA_STRCO       KPKRILPVSELPKTRSGKIMRRLLRDVAENR--QVGDVTTLADSTVMDLIQTKLPAAPSE
ACSA_MYCBO       RPRDVHVVPELPKTRSGKIMRRLLRDVAENR--ELGDTSTLLDPTVFDAIRAAK------
ACSA_MYCTU       RPRDVHVVPELPKTRSGKIMRRLLRDVAENR--ELGDTSTLLDPTVFDAIRAAK------
ACSA_PYRAE       EPAQIFFVTKLPKTRSGKIMRRLLKAVATGA--PLGDVTTLEDETSVEEAKRAYEEIKAE
ACSA_PYRAR       EPAQIFFVTKLPKTRSGKIMRRLLKAVATGA--PLGDVTTLEDETSVEEAKKAYEELKAE
ACSA_METSH       APTEVHFVNDLPKTRSGKIMRRVVKARALGN--PVGDISTLMNPEAVDGIPKIV------
                     :     ********:***.::           * :** :   .             

ACSA_THET8       ----
ACSA_THET2       ----
ACSA_SYNY3       ----
ACSA_THEEB       ----
ACSA_DEIRA       ----
ACSA_CHLTE       ----
ACSA_RHOBA       ----
ACSA_LEPIC       ----
ACSA_LEPIN       ----
ACSA_LEPBL       ----
ACSA_LEPBJ       ----
ACSA_XANC8       ----
ACSA_XANCP       ----
ACSA_XANOM       ----
ACSA_XANAC       ----
ACSA_XYLFA       ----
ACSA_XYLFT       ----
ACSA_BDEBA       ----
ACSA_NOVAD       ----
ACSA_CAUVC       ----
ACSA_BRADU       ----
ACSA_BRASO       QA--
ACSA_RHOP5       ----
ACSA_PARL1       ----
ACSA_RHOCB       ----
ACSA_BRUA2       ----
ACSA_BRUAB       ----
ACSA_BRUSU       ----
ACSA_BRUC2       ----
ACSA_BRUME       ----
ACSA_BRUSI       ----
ACSA_BRUO2       ----
ACSA_OCHA4       ----
ACSA_AGRRH       A---
ACSA_RHIEC       ----
ACSA_RHIME       ----
ACSA_SINMW       ----
ACSA_AGRFC       ----
ACSA_RHILO       ----
ACSA_BART1       ----
ACSA_BARHE       A---
ACSA_BARQU       A---
ACSA_BARBK       A---
ACSA_ECOLI       S---
ACSA_ECO57       S---
ACSA_ECOL6       S---
ACSA_SALTI       S---
ACSA_SALTY       S---
ACSA_CITK8       S---
ACSA_CROS8       S---
ACSA_YERPA       S---
ACSA_YERPN       S---
ACSA_YERPE       S---
ACSA_YERPP       S---
ACSA_YERP3       S---
ACSA_YERPS       S---
ACSA_YERE8       S---
ACSA_SERP5       S---
ACSA_PHOLL       ----
ACSA_SODGM       S---
ACSA_AERHH       ----
ACSA_AERS4       ----
ACSA_VIBVU       ----
ACSA_VIBVY       ----
ACSA_VIBPA       ----
ACSA_VIBCH       ----
ACSA_PHOPR       ----
ACSA_PSYIN       ----
ACSA_SHESR       ----
ACSA_SHESM       ----
ACSA_SHESA       ----
ACSA_SHEON       ----
ACSA_SHESW       ----
ACSA_SHEPC       ----
ACSA_SHEB5       ----
ACSA_SHEB8       ----
ACSA_SHEB9       ----
ACSA_SHEFN       ----
ACSA_SHEPA       ----
ACSA_SHEHH       ----
ACSA_SHELP       ----
ACSA_SHESH       ----
ACSA_SHEAM       ----
ACSA_SHEDO       ----
ACSA_PSEU2       ----
ACSA_PSE14       ----
ACSA_PSESM       ----
ACSA1_PSEPK      SA--
ACSA1_PSEAE      ----
ACSA_PSEU5       ----
ACSA_MARHV       ----
ACSA2_PSEAE      ----
ACSA2_PSEPK      ----
ACSA_ALKEH       ----
ACSA_HALHL       ----
ACSA_MAGMM       ----
ACSA_SACD2       ----
ACSA_ALCBS       ----
ACSA_PRB01       ----
ACSA_THIDA       ----
ACSA_CHRVO       ----
ACSA_NITEU       ----
ACSA_NITEC       ----
ACSA_METFK       ----
ACSA_CUPNH       ----
ACSA_CUPPJ       ----
ACSA_CUPMC       ----
ACSA_RALSO       ----
ACSA_BURP0       ----
ACSA_BURMA       ----
ACSA_BURP6       ----
ACSA_BURP1       ----
ACSA_BURM7       ----
ACSA_BURPS       ----
ACSA_BURM9       ----
ACSA_BURMS       ----
ACSA_BURTA       ----
ACSA_BURL3       ----
ACSA_HERAR       ----
ACSA_PASMU       ----
ACSA_HELPY       ----
ACSA_HELPH       ----
ACSA_HELAH       ----
ACSA_CAMJJ       ----
ACSA_CAMJE       ----
ACSA_CAMJ8       ----
ACSA_WOLSU       ----
ACSA_RUBXD       ----
ACSA_STRAW       D---
ACSA_STRCO       D---
ACSA_MYCBO       ----
ACSA_MYCTU       ----
ACSA_PYRAE       MART
ACSA_PYRAR       MAGP
ACSA_METSH       ----