CLUSTAL format seed alignment for MF_01129

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

HPPA_STRAW        ------------------------------------------------------------
HPPA_STRCO        ------------------------------------------------------------
HPPA_CHLAA        ------------------------------------------------------------
HPPA_CALS4        ------------------------------------------------------------
A0DVU0_PARTE      ------------------------------------------------------------
A9GFG6_SORC5      ------------------------------------------------------------
HPPA_LEPIC        ------------------------------------------------------------
HPPA_LEPIN        ------------------------------------------------------------
B8BUE1_THAPS      ------------------------------------------------------------
HPPA_BACTN        ------------------------------------------------------------
HPPA_THEMA        ------------------------------------------------------------
HPPA_CLOTE        ------------------------------------------------------------
HPPA_FUSNN        ------------------------------------------------------------
HPPA1_METAC       ------------------------------------------------------------
HPPA1_METMA       ------------------------------------------------------------
HPPA_CARHZ        ------------------------------------------------------------
HPPA_BRUME        ------------------------------------------------------------
HPPA_BRUSU        ------------------------------------------------------------
HPPA_OCHA4        ------------------------------------------------------------
HPPA_RHILO        ------------------------------------------------------------
HPPA_RHIME        ------------------------------------------------------------
HPPA_AGRFC        ------------------------------------------------------------
HPPA_BRADU        ------------------------------------------------------------
HPPA_RHOPA        ------------------------------------------------------------
HPPA_CAUVC        ------------------------------------------------------------
HPPA_RHORT        ------------------------------------------------------------
HPPA_XANAC        ------------------------------------------------------------
HPPA_XANCP        ------------------------------------------------------------
HPPA_RHOPL        ------------------------------------------------------------
HPPA_NITEU        ------------------------------------------------------------
Q609P4_METCA      ------------------------------------------------------------
HPPA2_METAC       ------------------------------------------------------------
HPPA2_METMA       ------------------------------------------------------------
HPPA_PYRAE        ------------------------------------------------------------
HPPA_CHLTE        ------------------------------------------------------------
Q3ATF9_CHLCH      ------------------------------------------------------------
D5UD74_CELFN      MWTTSRVPSVRDVDAPASRDDEVPQTTSVRRRPRRRRAAAPVLGALVLTGCAAPPGDDLA
D4HFG9_CUTAS      ------------------------------MKRLRSCALPILLTTLALAGCGSG-----G
D8DTW4_PREBR      ----------------------------------------------MKKLLMLMLTATCA
D9SV73_CLOC7      ------------------------------MIKKLITIKRTGFICLSTLIIFMALILLLP
B6YQJ7_AZOPC      -----------------------------------------MEKARNIFLLLMVALFKSN
E4T255_PALPW      -----------------------------------------MKQFKRTAMLLFVALIASG
B9XCJ1_PEDPL      -------------MKSTYDVKTVKIGGQTEEYNGHSGSTLMLNKKLWFQVVLLLTLLGNA
                                                                              

HPPA_STRAW        ----MAGLSTPHQFDHPTALAAAVLTDDNRVIVMVIGVVALAALVVAGILVRQVLAAGEG
HPPA_STRCO        ----MAELPTSH-------LAAAVLTDGNRALVAVIAVVALAALVLAGVLVRQVLAAGEG
HPPA_CHLAA        ---------------------MQDLNAVQSLAVWAVLVISLLGIGYAFFIRSQILAQDTG
HPPA_CALS4        ----------------------------MGAYLTLIYGVIVIAALVIIGLIKFIFAQDKG
A0DVU0_PARTE      ------------------------------------------------------MQIKKG
A9GFG6_SORC5      -----------------------------MTELALILSGGLLGLAFAAYLARWVVARPAV
HPPA_LEPIC        ---------------------MNSVTIIIAMSILAIVTAVVYTLKVTSIKVGTLGGNEKE
HPPA_LEPIN        ---------------------MNSVTIIIAMSILAIVTAVVYTLKVTSIKVGTLGGNEKE
B8BUE1_THAPS      ------------------------------------------------------------
HPPA_BACTN        ---------------------------MDSILFWLVPVASVLALCFAYYFHKQMMKESEG
HPPA_THEMA        -----------------------------MYVAALFFLIPLVALGFAAANFAAVVRKPEG
HPPA_CLOTE        ----------------------------MESFIVYSVLAGVIALIFAFMLSSFISKESAG
HPPA_FUSNN        -------------------------MDLLTQVMYIGIAVGIISLLAAFYYAKKVEHYQIN
HPPA1_METAC       ----------------------------MDMLIYLAPICALIGLIFAGISYKNVQNEGAG
HPPA1_METMA       ----------------------------MDMLIYLTPICALIGLIFAGISYKNVRNEGEG
HPPA_CARHZ        -------------------------MENGMTLAYYGLGAGILAILFALYLFSSVLKEDMG
HPPA_BRUME        -------------------------MQMGMAVLVLVIACGVLSVLFAIWAIRSVLAADQG
HPPA_BRUSU        -------------------------MQMGMAVLVLVIACGVLSVLFAIWAIRSVLAADQG
HPPA_OCHA4        -------------------------MQMGVAVLVLVIACGVVSVLFAIWAIRSVLAADQG
HPPA_RHILO        -----------------------------MTILYAVIACGLLSVLYAIWATRSVLASDQG
HPPA_RHIME        -----------------------------MTILLGVIACGLLSVVYAIWATKSVLAADQG
HPPA_AGRFC        ---------------------------MRMTVIPIVILCGVLSVVYAVWTTKSVLDADQG
HPPA_BRADU        -----------------------------MTALWLIVLCGVLSVVYAIWATSSVLSADAG
HPPA_RHOPA        -----------------------------MTALWVIVLCGALSIVYAIWATSSVLAADQG
HPPA_CAUVC        ----------------------------MSLWLYLAIGAGLLAVLYGAVQTASLMRASAG
HPPA_RHORT        ----------------------------MAGIYLFVVAAALAALGYGALTIKTIMAADAG
HPPA_XANAC        --------------------------MLEHYGLWLALGCAVLAIVYGIVSARWVVAQPSG
HPPA_XANCP        --------------------------MLEHYGLMLALGCAVLAIVYGMLSARWVVAQPSG
HPPA_RHOPL        --------------------------MTTSLALYLALGCGLAAVLYGFIQRGWILAQDAG
HPPA_NITEU        ----------------------------MANGLTIAICSAILALIFSGLWIRRIYAQSAG
Q609P4_METCA      --------------------------MNVSNIVVFALGSGAAGVACALMNAGGVLRRSAG
HPPA2_METAC       ----------------------------MESLIFIAPLAGVISLVFAAFFAKSILKEDAG
HPPA2_METMA       ----------------------------MERLIFTAPLAGLISLTFAAFFAKSILKEDAG
HPPA_PYRAE        --------------------------MNMISYALLGVILGISGVIYAVYLAVWVLRQDPG
HPPA_CHLTE        ---------------------------------MYGLVVCLFGMIFGLIQYQGINKLPV-
Q3ATF9_CHLCH      ---------------------------------MYGLAICVFGMIFGAVKFMEIRKLPV-
D5UD74_CELFN      ADVHGGEANLVLPDLGAVTAL---AGVPGRTLLLLGLVVCALGLVFGGFVLTRLRRLPV-
D4HFG9_CUTAS      QTKGGGGGEANLKLPPLNEHV---GNVSGTALLWIGLVICLFGLGFGLVTYAKLQKLPV-
D8DTW4_PREBR      TPLLASEADLVIPE-----------SIHEFGFLHWGFLVTLLGFIFGIYYFAKTKALPV-
D9SV73_CLOC7      STVYAGEADLKIPNL----------TSHQNTLLVIGLVVCVLGMIFSYYQYIKVKNIRA-
B6YQJ7_AZOPC      LSVYASDVNLAIPDLHEGTFCFFGETVTSWSFLFYGALIIMGTLGFSLLLFKQVKQLPS-
E4T255_PALPW      -KAFASEANLKIPDLHDATFPHFGG-MDGWHLLLFGALVIVGTLSISLYLFKQVKSLPA-
B9XCJ1_PEDPL      TGAHASEADIHVPDLTQVSFAGLGG-VSGSTLMYLGILVCAIGAIFGLVQYVQTKALPV-
                                                                              

HPPA_STRAW        TDSMKKIAAAVQEGANAYLGRQMRTLGVFAVVVFFLL-----MLLPADDWNQRAG-----
HPPA_STRCO        TDSMKKIAAAVQEGANAYLARQLRTLGVFAVVVFFLL-----MLLPADDWNQRAG-----
HPPA_CHLAA        TPKMREVWGFIKTGANAYLSQQFRTISILIVILTFVLAASVFIIPPTTEAVERFGSKEAA
HPPA_CALS4        NEKMQQISDAIKEGAMAFLNRQYKTIASLALIVAVIIVVANYYGHLSEGSSQ--------
A0DVU0_PARTE      TKEMKKIAYSIEEGAEGFFKAQYGTICNLSLIFALLIFLVYWQKGSGELEKDEIP---VG
A9GFG6_SORC5      EPEMQRVAAIIQGVAEAYFRRQSSVIGAVSAMLGGAIFLAYGLLRRTGENNP------VP
HPPA_LEPIC        TKKLLEISSAISEGAMAFLVREYKVISLFIAFMAVLIVLLLDNPGSE-------------
HPPA_LEPIN        TKKLLEISSAISEGAMAFLVREYKVISLFIAFMAVLIVLLLDNPGSE-------------
B8BUE1_THAPS      -----------------------MMCAWFVLVFSVIIFVLVSWGTGW-------------
HPPA_BACTN        TPQMIKIAAAVRKGAMSYLKQQYKIVGCVFLGLVILFSIMAYGF----------------
HPPA_THEMA        TERMKEISSYIRSGADSFLAHETKAIFKVAIVIAILLMIFTTWQ----------------
HPPA_CLOTE        NERMQEIAGHIHDGAMAFLKTEYKYLTGFIVIVTVILAIFV-------------------
HPPA_FUSNN        IPKVEEITAAIREGAMAFLAAEYKILIVFVIVVAVALGIFI-------------------
HPPA1_METAC       NDLIKKITASIHGGAMVYLNRQYRAIAVFVVFLAIIIALILPN-----------------
HPPA1_METMA       NELIKKITAAIHGGAMVYLNRQYRAIAVFVVFIAIVLALVLPN-----------------
HPPA_CARHZ        NEKMREISQAIFEGAMAYLNRQYKTLIPFALVVFVLLVVGFGYKEG--------------
HPPA_BRUME        TQRMQEIAEAIREGASAYLTRQYSTIAIVGIVVFL--LAWYLL-----------------
HPPA_BRUSU        TQRMQEIAEAIREGASAYLTRQYSTIAIVGIVVFL--LAWYLL-----------------
HPPA_OCHA4        TQRMQEIAEAIREGASAYLTRQYSTIAIVGVVVFL--AAWYLL-----------------
HPPA_RHILO        NARMQEISAAIREGAQAYLARQYTTIALVGVVVLL--LAWWLL-----------------
HPPA_RHIME        NARMQEIAGFIREGAQAYLTRQYTTIAIVGVVVFI--AAWLLL-----------------
HPPA_AGRFC        NERMREIAGYIREGAQAYLTRQYLTIAIVGLIVAV--LAWYLL-----------------
HPPA_BRADU        SPRMQEIAAAVREGAQAYLRRQYTTIGIVGIVIFV--LLVYFL-----------------
HPPA_RHOPA        NARMQEIAGAVREGAQAYLKRQYMTIAIVGVVIFA--LLAYFL-----------------
HPPA_CAUVC        NARMQEIAAAIQEGAQAYLKRQYTTISIVGVVVIAA-LAFFFK-----------------
HPPA_RHORT        TARMQEISGAVQEGASAFLNRQYKTIAVVGAVVFV--ILTALL-----------------
HPPA_XANAC        NARMQEIAAAIQEGARAYLNRQYLTISVAGAVLFV--LVGLFL-----------------
HPPA_XANCP        NARMQEIAAAIQEGARAYLNRQYLTISIAGVVLFV--LVGLFL-----------------
HPPA_RHOPL        NARMQEIAGAIQQGAAAYLARQYKTIAIVGAVLAI--LIFFFL-----------------
HPPA_NITEU        DSRMQEIAAAVQEGASAYLKRQYLTIGMVGTVLFV--IIGLAL-----------------
Q609P4_METCA      SADVLAVARAIQEGTGAFLKRQYIAVAVVGSLLAL---ALTKL-----------------
HPPA2_METAC       NKRMKEIAGAIQEGAMAYLNRQYKTIAVVSIILSFLILFLLDD-----------------
HPPA2_METMA       NKRMKEIAEAIKEGSTAYMKRQYRTIAVVSVIISLLILFLLDE-----------------
HPPA_PYRAE        NEKMRFISQAIATGARAYLFRQYRTLAVLLVILAVLILVAIDMPRRT-------------
HPPA_CHLTE        HAAMKEISDLIYETCKTYLITQGKFIIILWALVAAIIVAYFGGL-NHLAP----------
Q3ATF9_CHLCH      HSAMLEISELIYETCKTYLLTQGKFILALWLLITPIIIGYFGWL-RQVEV----------
D5UD74_CELFN      HHSMREVSELIYATCREYLLQQGRFLLVLWAVIATVIVVYYKVL-VGFGW----------
D4HFG9_CUTAS      HEAMHEVSELIYETCKTYLKQQAKFLMLLWAFIAAVIVVYFLLL-EHMG-----------
D8DTW4_PREBR      HERMEDIGEVIYKTCSTYLKQQGKFLATLFIFIGVIVALYFGVLSEGTTT----------
D9SV73_CLOC7      HSSMLDVSKIIFETCKTYLVQQGKFIVLLFIFIGSIMIFYFGYL-EKTPF----------
B6YQJ7_AZOPC      HDSMLRVASTIYTTCRTYLFQQGKFLLMLFALVGVVLFIYFLGLLGQSF-----------
E4T255_PALPW      HQSMLDVASTIYKTCRTYLLQQGKFLAILFGIIAVAMVYYLSMANAEATG-----PDALS
B9XCJ1_PEDPL      HESMGNVSNTIWETCKTYLFTQGRFLAILWVLIAVCMVYYFIGLPWNDPNNH---LSHGE
                                                  .                           

HPPA_STRAW        -------RSVFFLIGALFSATTGYTGMWLAVRSNVRVAAAAREATPAEGEPEKDLTAVSH
HPPA_STRCO        -------RSIFFLIGAAFSAATGYIGMWLAVRSNVRVAAAAREATPAPGEPEKDLALVSH
HPPA_CHLAA        TIWVAIGRAVAFLMGSLFSYAVGFVGMNVAVEGNVRVAAAARKGYNP-------------
HPPA_CALS4        ALSFALHVGFAFITGAFCSALSGYIGMYMAVNSNIRAAAGARSGLNR-------------
A0DVU0_PARTE      GLIIGLLEGGSFLFGAFCSGFAGFAGMWVSIKANSRVASAARTCYNK-------------
A9GFG6_SORC5      ALELGVWLTLSFAVGAASAVATGRVAAWIAPRTSVRAASGARRSLDL-------------
HPPA_LEPIC        GFNDGIYTAIAFVSGALISCISGFIGMKIATAGNVRTAEAA--------------KSSMA
HPPA_LEPIN        GFNDGIYTAIAFVSGALISCISGFIGMKIATAGNVRTAEAA--------------KSSMA
B8BUE1_THAPS      DFARGTFTALSFILGACTSILSGYLGMKVAVYSNVRTTVSAQ-------------KSGWK
HPPA_BACTN        -HVQNVWVPIAFLTGGFFSGLSGFLGMKTATYASARTANAA--------------RNSLN
HPPA_THEMA        -------TGVAFLLGAVMSASAGIVGMKMATRANVRVAEAART------------TKKIG
HPPA_CLOTE        ----GWQTAACFILGAIFSIFAGYFGMNVATKANVRTAEAAR-------------HS-QG
HPPA_FUSNN        ----SVPTAGAFILGAITSAIAGNAGMRIATKANGRTAIAAK-------------EGGLA
HPPA1_METAC       ----GALTAACFVFGAVLSATAGYAGMLTATIANGRTTNAAT-------------RG-IG
HPPA1_METMA       ----GVLTAACFVFGAVLSATAGYAGMLTATIANGRTTNAAT-------------RG-IG
HPPA_CARHZ        DFGYGLKVGVSFLVGAIASALAGYAGMTSTTKANARTTQAAR-------------KS-LN
HPPA_BRUME        ----SLNAAMGFLIGAVLSGVTGFIGMHVSVRANVRTAQAAS--------------LSLA
HPPA_BRUSU        ----SLNAAMGFLIGAVLSGVTGFIGMHVSVRANVRTAQAAS--------------LSLA
HPPA_OCHA4        ----SISAAIGFLIGAVLSGVTGFIGMHVSVRANVRTAQAAS--------------LSLA
HPPA_RHILO        ----SITAAIGFLIGAVLSGAAGFIGMHVSVRANVRTAQAAS--------------NSLA
HPPA_RHIME        ----SGAAAIGFLIGAVLSGAAGFIGMHVSVRANVRTAQAAS--------------VSLA
HPPA_AGRFC        ----SAIAAIGFVIGAVLSGVAGFVGMHVSVRANLRTAQAAS--------------HSLG
HPPA_BRADU        ----GFYVAIGFAIGAILSGAAGFIGMNVSVRANVRTAQAAT--------------TSLA
HPPA_RHOPA        ----GILVAIGFAIGAILSGAAGFIGMNVSVRANVRTAQAAT--------------TSLA
HPPA_CAUVC        ----SWEQPVGFALGAILSGAAGFAGMLISVRANVRTAQASS--------------ESLA
HPPA_RHORT        ----GISVGFGFLIGAVCSGIAGYVGMYISVRANVRVAAGAQ--------------QGLA
HPPA_XANAC        ----SWYTAIGFALGAVLSGLAGYIGMNVSVRANVRTAEAAR--------------HGIG
HPPA_XANCP        ----SWYTAIGFAIGAVLSGLAGYIGMNVSVRANVRTAQAAR--------------HGIS
HPPA_RHOPL        ----GGLTAAGFVLGAVLSGACGFIGMNVSVRANVRTAQAAT--------------KGIG
HPPA_NITEU        ----SWNTAIGFALGAILSGLAGFMGMNVSVQSNVRTAEAAR--------------SGLN
Q609P4_METCA      ----GAWTANGFIAGVVASALAGYIGLAVSVRAEARTADAAG--------------AGLG
HPPA2_METAC       ----GLKIAIGFLAGAISSAAAGYIGMSVSVRANIRTAHAAS--------------SGLE
HPPA2_METMA       ----GLKIAAGFLAGAISSAAAGYIGMSISVRANVRTASAAS--------------GGAG
HPPA_PYRAE        ----FGLTALAFIVGALGSMLAGYLGMYVTTRSASRVAQAAA-------------TGGMG
HPPA_CHLTE        --DKVVFILACSLLGIAGSYTVAWFGMRINTFANSRTAFASLG-------------GKPF
Q3ATF9_CHLCH      --AKVVYILVCSLVGIAGSYFVAWFGMRINTFANSRTAFASLA-------------GKPF
D5UD74_CELFN      --GKVAVVIAFSLVGIAGSYAVAWFGIRVNTFANSRTAFASLH-------------GRPL
D4HFG9_CUTAS      --AKVLIILLFSLVGMAGSFGVAWYGIRVNTFANSRTAHASLR-------------GSPW
D8DTW4_PREBR      --GGVLLILLWTIIGICGSYGVAAYGIRMNTYANARMAFASLK-------------RNPL
D9SV73_CLOC7      --TGILIILGWTILGILGSYCVAWYGIRMNTLANSRMAFTSLE-------------HKPL
B6YQJ7_AZOPC      --AVVLQVLLFSIVGMAGSYMVAWYGIRVNTYANARTAFASLR-------------GRPL
E4T255_PALPW      TPVVVILVLLFSIVGMAGSYAVAWYGIRINTYANARTAFASLK-------------KRPW
B9XCJ1_PEDPL      LIRNGIVILLASILGVLGSYGVAWFGIRINTVSNSRTAFSALK-------------GNPL
                                *   :   .  .         * :  :                   

HPPA_STRAW        KAMKIAFRTGGVVGMFTVGLGLLGASCVVLV--------------------YAADAPKVL
HPPA_STRCO        KATKIAFRTGGVVGMFTVGLGLLGACCVVLV--------------------YAADAPKVL
HPPA_CHLAA        -ALQVAYKSGSVTGMLTVGLGLLGGTLIFMV--------------------FGIAAPDAL
HPPA_CALS4        -ALQIALKGGAVTGLAVTALSLFGVATLFLA-----YGGLSGQ------DELIKEAPSLI
A0DVU0_PARTE      -AIQLAFRGGYFAAVINIALAIFGISVLFLVIYFYCYITITDQQK---LNEQIDKIPLLL
A9GFG6_SORC5      -ALQIALRGGAVSGLFVASMSLLGLGGLFAAVLAFRGGFGAEPAE---ALALAPTIPWVI
HPPA_LEPIC        KAFRVAFDSGAVMGFGLVGLAILGMIVLFLVFTGMYPG-----------VEKH-FLMESL
HPPA_LEPIN        KAFRVAFDSGAVMGFGLVGLAILGMIVLFLVFTGMYPG-----------VEKH-FLMESL
B8BUE1_THAPS      HCFNAAFRAGAVMGFALCGLGIFMLYVTLLAFRVHYPA-----------PEDWIYLTECL
HPPA_BACTN        SGLRIAFRSGAVMGLVVVGLGLLDISFWYLLLNAVIPADALTP------THKLCVITTTM
HPPA_THEMA        PALKVAYQGGSVMGLSVGGFALLGLVLVYLIFGKWMGQVDNLNIYTNWLGINFVPFAMTV
HPPA_CLOTE        KALNIAFSGGAVMGMSVVGLGVVGIGIMYYI---FGGNME------------FVT-----
HPPA_FUSNN        KALNVAFSGGAVMGLTVVGLGMFMLSLILLVSRTVGISVN------------DVT-----
HPPA1_METAC       PAFRVSFASGTVMGMSVVGLGLFGLSLSFIILESVYTDLD------------LLTIVNIV
HPPA1_METMA       PAFKVSFASGTVMGMSVVGLGLFGLSLSFIILGNIYTDMD------------LFTLLNII
HPPA_CARHZ        AALNVAFRAGGVMGMSVAGLGLLGVSALYII----FKDVH------------VID-----
HPPA_BRUME        GGLELAFKSGAITGLLVAGLALLGVSVYYFVLTVWLGYAP-----------ADRTVIDSL
HPPA_BRUSU        GGLELAFKSGAITGLLVAGLALLGVSVYYFVLTVWLGYAP-----------ADRTVIDSL
HPPA_OCHA4        GGLELAFKSGAITGLLVAGLALLGVSVYYFILTVWLGYSP-----------SDRTVIDAL
HPPA_RHILO        AGLDIAFKSGAITGMLVAGLALLGVSIYYLILTGPMGLQP-----------NDRIVIDSL
HPPA_RHIME        SGLDIAFKSGAITGMLVAGLALLGVSVYYLILTAGLGHEP-----------AAREVIDAL
HPPA_AGRFC        AGLDIAFKSGAITGMLVAGLALLGVSIYYFVLTSVLGHPP-----------GSRAVIDAL
HPPA_BRADU        GGLELAFKAGAITGMLVAGLALLGVTLYFGFLVYSLKLAP-----------DSRVVVDAM
HPPA_RHOPA        GGLELAFKAGAITGLLVAGLALLGVTLYFIYLIHFAGLQA-----------NSRTVVDAL
HPPA_CAUVC        KGLSMAFTSGAVTGMLVAGFALLGVAGYYYVLLAT-GHEA-----------TGRVVIDSL
HPPA_RHORT        RGLELAFQSGAVTGMLVAGLALLSVAFYYILLVGI---GA-----------TGRALIDPL
HPPA_XANAC        KAMDVAFRGGAITGMLVVGLGLLGVAGYFAVLQGMG---L-----------PLEQNLHAL
HPPA_XANCP        KAMDVAFRGGAITGMLVVGLGLLGVAGYFAILQAMG---L-----------PLEQNLHAL
HPPA_RHOPL        PALDVAFKGGAITGMLVVGLGLLGVSLFFWFLSGGI---H-----------ADPATLKPL
HPPA_NITEU        EALAIAFRGGAVTGMLVVGLGLLGVAGYTALLVSGADETS-----------SISDLIHPL
Q609P4_METCA      AALSTAFRSGTAMGLLVAGLALSAVAGYYALASSAG---------------TPDDVHGGL
HPPA2_METAC       KAMSVAFRGGAVTGLAVVGLALLGTSSFYILYGDV----------------------DLV
HPPA2_METMA       KALKIAFRGGAVTGLAVIGLALLGTSSLYILYGDA----------------------DLV
HPPA_PYRAE        KALLVSWRAGAVMGLSLASIALLLISGFYLVFRSVL----------------PDDWAVPL
HPPA_CHLTE        PTYAIPLRAGMSIGMLLISIELFAMLCILLFIPVDYAGPC-------------------F
Q3ATF9_CHLCH      PTYAIPLRAGMSIGMLLISIELFVMLCILLFVRPDYAGPC-------------------F
D5UD74_CELFN      PVARIPLQAGMAIGMVLISLELLMMLVILLFLPPGVAGAC-------------------F
D4HFG9_CUTAS      ETFDIPMRSGMSIGMVLISVELTLMLFIMLVLPGDLAGPC-------------------F
D8DTW4_PREBR      NLLNIPLNAGMSIGVMLVCVELFLMLVILLFMPTNLAGSC-------------------F
D9SV73_CLOC7      KLLDIPLNTGMSIGVLLICVELFMMLIILLFVPRELAGSS-------------------F
B6YQJ7_AZOPC      DVVNIPLKAGMSVGLFLISLELVLMVIILLFVPRDIVGIC-------------------F
E4T255_PALPW      DVVNIPLRSGISVGLFLISLELVMMIIILLFVPRSIVGYC-------------------F
B9XCJ1_PEDPL      ATLGIPLRSGMSVGLLLVAVELFFMICILMFLPRELVGPC-------------------F
                       .   *   ..    . :                                      

HPPA_STRAW        EGFGLGAALIAMFMRVGGGIFTKAADVGADLVGKVEQGIPEDDPRNAATIADNVGDNVGD
HPPA_STRCO        EGFGLGAALIAMFMRVGGGIFTKAADVGADLVGKVEQGIPEDDPRNAATIADNVGDNVGD
HPPA_CHLAA        LGFGFGGSLIALFMRVGGGIYTKAADVGADLVGKVEAGIPEDDPRNAAVIADLVGDNVGD
HPPA_CALS4        VGFGFGASFVALFAQLGGGIYTKAADVGADLVGKVEAGIPEDDPRNPAVIADLVGDNVGD
A0DVU0_PARTE      IGYGFGASFVAMFAQLGGGIYTKAADVGADLIGKIENDIPEDDPRNPAVIADLVGDNVGD
A9GFG6_SORC5      AGYPLGASFAALMAQLGGGTFSKAADLGADLAG-AEVGLDEDDLQNPATIVDLAGDTVGD
HPPA_LEPIC        AGFGLGGSAVALFGRVGGGIYTKAADVGADLVGKVEKGIPEDDPRNPATIADNVGDNVGD
HPPA_LEPIN        AGFGLGGSAVALFGRVGGGIYTKAADVGADLVGKVEKGIPEDDPRNPATIADNVGDNVGD
B8BUE1_THAPS      TGYGLGGSSIAMFGRVGGGIYTKAADVGADLVGKVVHGIPEDDPRNPATIADNVGDNVGD
HPPA_BACTN        LTFGMGASTQALFARVGGGIYTKAADVGADLVGKVEAGIPEDDPRNPATIADNVGDNVGD
HPPA_THEMA        SGYALGCSIIAMFDRVGGGVYTKAADMAADLVGKTELNLPEDDPRNPATIADNVGDNVGD
HPPA_CLOTE        -GFGLGASSIALFARVGGGIYTKAADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGD
HPPA_FUSNN        -GFGMGASSIALFARVGGGIYTKAADVGADLVGKVEAGIPEDDPRNPATIADNVGDNVGD
HPPA1_METAC       AGFSLGASSIALFARVGGGIFTKAADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGD
HPPA1_METMA       AGFSFGASSIALFARVGGGIFTKAADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGD
HPPA_CARHZ        -SFAFGASAIAFFARVGGGIYTKAADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGD
HPPA_BRUME        VSLGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGD
HPPA_BRUSU        VSLGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGD
HPPA_OCHA4        VSLGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGD
HPPA_RHILO        VALGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGD
HPPA_RHIME        VALGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGD
HPPA_AGRFC        VSLGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGD
HPPA_BRADU        VALGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGD
HPPA_RHOPA        VALGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNPATIADNVGDNVGD
HPPA_CAUVC        VALGFGASLISIFARLGGGIFTKGADVGGDLVGKVEAGIPEDDPRNAATIADNVGDNVGD
HPPA_RHORT        VALGFGASLISIFARLGGGIFTKGADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGD
HPPA_XANAC        VGLAFGSSLISIFARLGGGIFTKGADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGD
HPPA_XANCP        VGLAFGSSLISIFARLGGGIFTKGADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGD
HPPA_RHOPL        LGLAFGSSLISIFARLGGGIFTKGADVGADLVGKVEASIPEDDPRNPAVIADNVGDNVGD
HPPA_NITEU        IGFAFGGSLISIFARLGGGIFTKGADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGD
Q609P4_METCA      LGLALGGSLMSVFARTVGGVWAKTAG---------------GPPLQETSEVAAVGNHVGH
HPPA2_METAC       VGFGFGASLISLFARVGGGIFTKAADVGADLVGKVEAGIPEDDPRNAGVIADNVGDNVGD
HPPA2_METMA       VGFGFGASLISLFARAGGGIFTKAADVGADLVGKIEAGIPEDDPRNPAVIADNVGDNVGD
HPPA_PYRAE        VALGFGASLVTLFMRVGGGIYTKAADLGADLVGKVEAGIPEDDPRNPGVIADNVGDNVGD
HPPA_CHLTE        IGFAIGESLGASVLRIAGGIFTKIADIGSDLM-KIVFKIKEDDARNPGVIADCTGDNAGD
Q3ATF9_CHLCH      IGFAIGESLGAAVLRIAGGIFTKIADIGSDLM-KIVFKIKEDDARNPGVIADCTGDNAGD
D5UD74_CELFN      IGFAIGESLGAAALRIAGGIFTKIADIGSDLM-KIAFRIKEDDARNPGVIADCTGDNAGD
D4HFG9_CUTAS      IGFAIGESLGAACLRIAGGIFTKIADVGADLM-KIAFHIKEDDARNPGVIADCTGDNAGD
D8DTW4_PREBR      VGFAIGESLGASALRIAGGIFTKIADIGSDLM-KVIFKIGEDDPRNPGVIADCTGDNAGD
D9SV73_CLOC7      IGFAIGESLGASALRIAGGIFTKIADIGSDLM-KIIFKIKEDDPRNPGVIADCTGDNAGD
B6YQJ7_AZOPC      LGFAIGESLGASALRIAGGIFTKIADIGSDLM-KVVFKVKEDDPRNPGVIADCTGDNAGD
E4T255_PALPW      LGFAIGESLGASVLRIAGGIFTKIADIGSDLM-KIVFKVKEDDPRNPGVIADCTGDNAGD
B9XCJ1_PEDPL      IGFAVGESLGASVLRICGGIFTKIADIGSDLM-KIVFKLPEDDPKNPGVIADCTGDNAGD
                      .* :  :   :  ** ::* *.               .   :    .  .*: .*.

HPPA_STRAW        CAGMAADLFESYAVTLVAALILG----KAAFGDSG---------------LAFPLIVPAI
HPPA_STRCO        CAGMAADLFESYAVTLVAALILG----KVAFGDFG---------------LAFPLLVPAI
HPPA_CHLAA        CAGMAADVFESFEVTLVSALILGLVLGDAVVGTIGD-------GAYDLRFIIFPLVLRAI
HPPA_CALS4        CAGRGADLFESTAAENIGAMILGV---------GLY-------PIFGWKGILFPLVARAI
A0DVU0_PARTE      CAGQSADLFESITAEILSAMILGAT---LTHEANLH-------INYKVTFMLFPLVVHCL
A9GFG6_SORC5      CAGRAAGVFASTVAENAGAMVVGAM---L-FRNNAG-------LPSALAVVLFPLVSRAF
HPPA_LEPIC        VAGMGADLFGSCAEATCAALVIGATASALSGS---------------VDALLYPLLISAF
HPPA_LEPIN        VAGMGADLFGSCAEATCAALVIGATASALSGS---------------VDALLYPLLISAF
B8BUE1_THAPS      VAGMGSDLFGSFAESTCAALVLGSSI-GLSGG---------------WDAMVFPVAVSAV
HPPA_BACTN        VAGMGADLYESYCGSILATAALGAAAFIHSADTVMQ-----------FKAVIAPMLIAAV
HPPA_THEMA        VAGLGADLLESFVGAIVSSIILASYMFPIYVQKIGENLVHQVPKETIQALISYPIFFALV
HPPA_CLOTE        VAGMGADLFESYVGSIISALTLGTVVYAN----------------KEG--VMFPLILSSI
HPPA_FUSNN        VAGMGADLFESYVGSIIATITLAFLLPVD----------------DATPYVAAPLLISAF
HPPA1_METAC       IAGMGADLYESYVGSILATMLLAASTAATTFP-----------NIPVENVILVPLIISAI
HPPA1_METMA       IAGMGADLYESYVGSIIATMLLAASTAAATFP-----------GIPVMNVVMVPLVIAAV
HPPA_CARHZ        TAGMGADLFESYGATTMAAMLLGLTFAKNH-------------GFSEVLGATFPLLLGAA
HPPA_BRUME        CAGMAADLFETYAVTVVATMVLGAIFF--HGS------------DALTNVMLYPLMICGA
HPPA_BRUSU        CAGMAADLFETYAVTVVATMVLGAIFF--HGS------------DALTNVMLYPLMICGA
HPPA_OCHA4        CAGMAADLFETYAVTVVATMVLGAIFF--NGS------------DILSSVMLYPLMICGA
HPPA_RHILO        CAGMAADLFETYAVTVVATMVLGAIFF--GGT------------AVLGAAMLYPLAICGA
HPPA_RHIME        CAGMAADLFETYAVSVVATMVLASIFF--AGA------------PVLATVMTYPLAICAA
HPPA_AGRFC        CAGMAADLFETYAVSVVATMVLAAIFF--AGT------------PILESAMVYPLAICGA
HPPA_BRADU        CAGMAADLFETYAVTAVATMVLAAIFF--AKT------------PILMSMMTLPLAIGGI
HPPA_RHOPA        CAGMAADLFETYAVTAVATMVLAAIFFGSATP------------DQLQSVMTLPLAIGGI
HPPA_CAUVC        CAGMAADLFETYAVTTVATMVLAAIFF--RGT------------EAVSAMMLLPLAICAV
HPPA_RHORT        CAGMAADLFETYAVTVVATMVLASIFF--AGV------------PAMTSMMAYPLAIGGV
HPPA_XANAC        CAGMAADLFETYAVTVIATMLLGSLTL----A------------DTGSHAVLYPLVLGGV
HPPA_XANCP        CAGMAADLFETYAVTVIATMLLGSLTL----A------------ETGPHAVLYPLVLGGV
HPPA_RHOPL        CAGMAADLFETYAVTLIAAMALGALLL----P------------NAALAAAVYPLVLGGV
HPPA_NITEU        CAGMAADLFETYAVTIIATMLLGALLF----K------------TGTGDAAVYPLALGAA
Q609P4_METCA      AAGTAADVFETLTLALVAAMLLARSVF-----------------GADSPWVEFPLLVAGF
HPPA2_METAC       CAGMGADLFETYVVTSLAAMLLGSLII-----------------GTYENAILYPLVLGSV
HPPA2_METMA       CAGMGADLFETYVVTSLAAMLLGSLII-----------------GTYKNAVLYPLMLGSA
HPPA_PYRAE        VAGMAADVYESYIVTVTAAIFLAAILG------------------LPTQFIEAIILFAAL
HPPA_CHLTE        SVGPTADGFETYGVTGVALISFILLAIK--------------DPSIQVSLLVWIFAMRLV
Q3ATF9_CHLCH      SVGPTADGFETYGVTAVALISFILLAIQ--------------DAAIQVTLLVWIFSISLV
D5UD74_CELFN      SVGPSADGFETYGVTGVALVTFVLLGVH--------------DPGVQAGLLVWLFVVRAV
D4HFG9_CUTAS      SVGPSADGFETYGVTGVALITFVLGAVP--------------DQTEQVQLLVWIFVVRVV
D8DTW4_PREBR      SVGPTADGFETYGVTGVALVSFVLLAV--------------PNAAAQTQLLIWIFSMRIL
D9SV73_CLOC7      SVGPTADGFETYGVTGVAIVSFIVLAVGLNFN-------ESDKLLLQSNFLTWIFVMRIL
B6YQJ7_AZOPC      SVGPTADGFETYGVTGVSLITFIALAV--------------REVDIQAKLIVWIFGMRFL
E4T255_PALPW      SVGPTADAFETYGVTGVALISFITLAIP------------ADQVDLQAKLIVWIFGMRFL
B9XCJ1_PEDPL      SVGPTADGFETYGVTGVALIAFLALAL-------------AANPKICATLIIWLFAMRAL
                   .*  :.   :      .   .                                .     

HPPA_STRAW        GVLTAMIGIFAVAPRRAD-------RSGMSAINRGFFVSAVFSLALVAVAVYVYLPGKYA
HPPA_STRCO        GVLTAMIGIFAVAPRRSD-------RSGMSAINRGFFISAVISLVLVAVAVFVYLPGKYA
HPPA_CHLAA        GVVASVIGNLFVTTDERK-------RNAMAAMNRGFYIAAGLAIAASAAATPVFM-----
HPPA_CALS4        GIIASIIGIFFVNTKDES-------KDPMIALNKGYFVTTVVNLIALFFAVKVMLSGHL-
A0DVU0_PARTE      DIISSTIGMYFVRTQPGIPNKY--IEDPLCIMKKGYRIAMIIGFFGFFFICHHCLNPLQ-
A9GFG6_SORC5      GLIATLFGVMVVKTDDRE--------DAFNALVRGLYVTATLHAVGIAGAAKWLLGAH--
HPPA_LEPIC        GIPASILTSFLAR----VKE----DGNVESALKVQLWVSTLLVAGIMYFVTKTFMVDSFE
HPPA_LEPIN        GIPASILTSFLAR----VKE----DGNVESALKVQLWVSTLLVAGIMYFVTKTFMVDSFE
B8BUE1_THAPS      GIFVCLICSFIATDLRPVKE----EKDVEMSLKVQLISTTVLMIPAVYLAAETFLPGEFM
HPPA_BACTN        GILLSIIGIFSVRT-KENAT----VKDLLGSLAFGTNLSSVLIVAATFLILWLLQLDNWI
HPPA_THEMA        GLGCSMLGILYVIV---KKP----SDNPQRELNISLWTSALLTVVLTAFLTYFYLKDLQG
HPPA_CLOTE        GIVASIIGILFSR--KSK------AKDPQKALNTGTYIGGIIVIVSAAILSNTIFGN---
HPPA_FUSNN        GIISSIIATLTVK--TDD------GSKVHAKLEMGTRIAGILTIIASFGIIKYLGLD---
HPPA1_METAC       GILASIVGTFFVR--TNKTE----SSAIHMAFNMGLIAAIILTVIASYFVTSMLLGEY-G
HPPA1_METMA       GILASVIGTFFVR--TNKTE----SSAIHMAFNMGLIAAIVLTVIASYVVTGHLLGGY-G
HPPA_CARHZ        GIVAAIISTFFVR--TSE------DGNPQMALNIGLWSTNFITAIFTYIIAQYVFGSEWA
HPPA_BRUME        CVITSIAGTFFVKLGVN--------GSIMGALYKGLIATGLLSIVGLGVANTLTVGWGEI
HPPA_BRUSU        CVITSIVGTFFVKLGVN--------GSIMGALYKGLIATGLLSIVGLGVANTLTVGWGEI
HPPA_OCHA4        CVITSIVGTFFVKLGVN--------GSIMGALYKGLIATGLLSIVGLAIANTLTVGWGEI
HPPA_RHILO        CILTSIVGTFFVKLGAN--------GSIMGALYKGLIVTGLLSIVGLAVATSVCFGWGEI
HPPA_RHIME        CIITSIIGTFFVKLGAN--------ASIMGALYRGLIVTGALSILGLGAATSLTIGWGSI
HPPA_AGRFC        CILTSIAGTFFVKLGTN--------NSIMGALYKGLIATGVFSVAGLAVATYATVGWGTI
HPPA_BRADU        CIITSIIGTFFVKLGPS--------QSIMGALYKGLIATGVLSLIGIAVVIYTLIGFGKL
HPPA_RHOPA        CILTSIAGTFFVKLGAS--------QSIMGALYKGLIATGVLSLVGVGVVIHQLIGFGPL
HPPA_CAUVC        CIVTSIIGAFFVRLGKS--------QNIMGALYQGLIVTGVLSIPAVWYVIHQLVPTAVE
HPPA_RHORT        CILASILGTKFVKLGPK--------NNIMGALYRGFLVSAGASFVGIILATAIVPGFGDI
HPPA_XANAC        SIIASIVGAAFVKVKDG--------GSIMGALYKGVIVSGVLAALAYWPITQSLMR----
HPPA_XANCP        SIVASIIGAAFVKVKPG--------GSIMGALYKGVIVSGVLAAIAYLPITQALMR----
HPPA_RHOPL        SIIASIIGCAFVKASPGM-------KNVMPALYKGLIVAGAISLVFFFFVTRMVMP----
HPPA_NITEU        SIVASIIGCYFVKMREG--------GKIMNALYRGLAVAGGIAFFAYLPITVWFMGGATL
Q609P4_METCA      VVAASLAGACFVRLGKS--------RYLVGALYRSVIVTMILAGVGLYYASEWFLGLPAV
HPPA2_METAC       AIFASIISVFFVKIGKE--------GKIMQALYKGVGGSAIISLIAFYFVTNSLMG----
HPPA2_METMA       AIFASIISVFFVKVEKE--------GKVMSALYRGVGGSTVLSLIAFYYITGFLMG----
HPPA_PYRAE        ALVATFAGVNLLKTTGV--------KHPLSSISLAIYATIGLSVVLFFIGAFTLGLDSTK
HPPA_CHLTE        MIVASAVSYWVNDALAKMKYGNADEMNFEKPLITLVWLTSIVSIVLTYIASYMLIAQLG-
Q3ATF9_CHLCH      MIISSALSYGINGAFAKMKYANADEMNFEKPLITLVWLTSLLSIVLIYATSYVLIGYLG-
D5UD74_CELFN      MVVASGLSYVANDAWTRRRFRAAARMDFEAPLTQLVWVTSVLSTVLTFATSWFVLSPLG-
D4HFG9_CUTAS      MLIASFVSYLINNAVAKARYGTVSEMDFEKPLSSLVWITSVMSILLTVLTTRWMLGSMG-
D8DTW4_PREBR      MAVTSVVAFYINKGVSNAKYGGNEDLDFEAPLTNLIWIASILSIIATYAVSYFQLA----
D9SV73_CLOC7      MVLTSIFSFFLNKAVSNIYYGKAENLDFEKPLTNLVWITSILSIFVTFFASYWMIGPNST
B6YQJ7_AZOPC      MDFLSGCSFFINQWISKKLYENREDFDFESPLMRLIVTSSILCISASFFMSHLLLGDMKD
E4T255_PALPW      MDIFSGISYFVNNAISEKQYGKSLDFDFEKPLTRLIWIAAISCIAISFGMSYVLIGDITV
B9XCJ1_PEDPL      MIVTSLVSYFVNEGISKAMFAGKKDFDFEAPLTHLVWLTSAVSIGVTFLASKLLLGDFTD
                                                 :                            

HPPA_STRAW        DLDGVTDVAIRAKDGDPRILAMVAVAIGIVLAALIQQLTGYFTETTRRPVRDIGKSSLTG
HPPA_STRCO        DLDGVTDAAIAGKSGDPRILALVAVAIGIVLAALIQQLTGYFTETTRRPVKDIGKSSLTG
HPPA_CHLAA        ---------VNEATGEVDWRPFFATLSGVVLAIVLDKLTEYFTSTHFSPVKETSKASQTG
HPPA_CALS4        ----------PDGRPVNYLLLYGAVVTGVILSYIFVFLTDYYTSVNKRPVQEIAKASTTG
A0DVU0_PARTE      ----------HKD---AWLYFGMCGLIGIIISYLFIEVTQYYTDYHYEPVKTIAQASKTG
A9GFG6_SORC5      -----------------WVIFFACGVIGIVTGIGVLHVTQYYTEQRHRPVRELAEAARSG
HPPA_LEPIC        IAGK----------TITKWDVYISMVVGLFSGMFIGIVTEYYTSHSYKPVREVAEASNTG
HPPA_LEPIN        IAGK----------TITKWDVYISMVVGLFSGMFIGIVTEYYTSHSYKPVREVAEASNTG
B8BUE1_THAPS      LKATVG----NNVLTLHPWQAFLCVIMGAVGGLIIGLVTEYYTSHSYKPVRELADSCKTG
HPPA_BACTN        WISC-------------------AVVVGLLVGIVIGRSTEYYTSQSYRPTQKLSESGKTG
HPPA_THEMA        LDVVG--------FRFGAISPWFSAIIGIFSGILIGFWAEYYTSYRYKPTQFLSKSSIEG
HPPA_CLOTE        LKAFF------------------AVASGLVVGMIIGKITEMYTSDAYSSVQKIANQSETG
HPPA_FUSNN        MGIFY------------------AIVAGLVAGLVIAYFTGVYTDTGRRAVNRVSDAAGTG
HPPA1_METAC       LNVFF------------------ATVAGLVAGFLIGQITEHYTSYDRKPTLRVANSCQTG
HPPA1_METMA       LNVFF------------------STVAGLVAGFLIGQITEHYTSYDKKPTLTVAHSCQTG
HPPA_CARHZ        PKIFI------------------AVVSGLVVNVAIGSLTEYYTSNLKPPAQKIAEASTTG
HPPA_BRUME        G---T-----VAGKSITGTNLFVCGLIGLIVTGLIVVITEYYTGTNKRPVNSIAQASVTG
HPPA_BRUSU        G---T-----VAGKSITGTNLFVCGLIGLIVTGLIVVITEYYTGTNKRPVNSIAQASVTG
HPPA_OCHA4        G---T-----VAGKSITGTNLFLCGLIGLIVTGLIVVITEYYTGTNKRPVNSIAQASVTG
HPPA_RHILO        G---T-----VAGMVITGKNLFICGLIGLAVTGLIVVITEYYTGTNKRPVNSIAQASVTG
HPPA_RHIME        G---T-----VAGMDITGWNLFLCGIIGLIVTALIVVITEYYTGTNKRPVNSIAQASVTG
HPPA_AGRFC        G---T-----VAGMEITGTNLFFCGLVGLVVTALIVVITEYYTGTNKRPVNSIAQASVTG
HPPA_BRADU        -----------DGVDYTGMSLFECGVVGLIVTALIIWITEYYTGTDYRPVKSIAAASVTG
HPPA_RHOPA        -----------PGVSYTGLALFECGIVGLAVTGLIIWITEYYTGTDFRPVKSIAQASVTG
HPPA_CAUVC        ----------VDGRSYGADALFYCGLAGLVVTAAIVMITEYYTGTGFRPVKSVAQASVSG
HPPA_RHORT        Q---G-----ANGVLYSGFDLFLCAVIGLLVTGLLIWVTEYYTGTNFRPVRSVAKASTTG
HPPA_XANAC        ----D-----NIHGA---TALYACALIGLVLTGLIVWITEYYTGTQYTPVQHVASASTTG
HPPA_XANCP        ----E-----NAHGA---MSLYACALIGLVLTGLIVWITEYYTGTQYGPVQHVAAASTTG
HPPA_RHOPL        ----D-----DALGAGTQMRLFGACVVGLVLTAAMVWVTEYYTGTQFKPVQHVAQASTTG
HPPA_NITEU        TLDGT-----EVGGGELIMRLFASTTIGLVLTGLMVVITEYYTSTEYPPVQHIANASTTG
Q609P4_METCA      Q------------PAFSLLNLFSAACIGLVLAGLNIAATEYHTSKSFGFAKRIAAASRGG
HPPA2_METAC       -----------------DIRLFYATVVGIIITVLMVIITEYYTSTDYRPVKTIAASSETG
HPPA2_METMA       -----------------DSRFFYVTVAGVVITVLMVIVTEYYTSKSCRPVKTIAVSSETG
HPPA_PYRAE        A-----------------LALAATTSLGAVIAPLIVKITDYYTSYNYGPVRKIAEQAKIS
HPPA_CHLTE        ------------DGT-MWWKLASIITCGTIAGALIPELVDRFTSTECAFVRNVVQCSKEG
Q3ATF9_CHLCH      ------------DGT-MWWKLASIISCGTLAGALIPEIVDQFTSTECAHVRNVVQCSKEG
D5UD74_CELFN      ------------DGDGLWWKLAAIVSCGTLAGALVPELVKVFTSTASRHVREVVTSSREG
D4HFG9_CUTAS      ------------DGT-MWWKLSIIISCGTLAGALIPELVKAFTSTNSRHVREVVTSAREG
D8DTW4_PREBR      -----------SMGNDLWWIFATIISLGTLGAAVIPEITKVFTSPKSGHVLEVVKASHHG
D9SV73_CLOC7      V---------GTYSSNIWLVLSIIISCGTLGGALIPEFTKVFTSNHSTYVQECVSASKEG
B6YQJ7_AZOPC      --------------TTLWWKLAIIISCGTLAALLIPEFTKLFTSSKSTHVKEIVSASREG
E4T255_PALPW      G---------GKLLPHLWWHLATIISFGTLAAVLIPEFTKKFTSSKSDHVHEIVTASREG
B9XCJ1_PEDPL      AA--------GAAQPALWWVLSVIISCGTVAGALIPEFTKVFVSTNSRHVREVTNCSKHG
                                             *          .  ..      .         .

HPPA_STRAW        -AATVVLAGISVGLESAVYTALLIGLGVYGAFLL-----------GGTSIMLALFAVALA
HPPA_STRCO        -PATVVLAGISLGLESAVYTALLIGLGVYGAFLL-----------GGTSIMLALFAVALA
HPPA_CHLAA        -SATNILSGLALGMESSVWAILVISASIFTSVLIYAGE------PAATQFTAILYGVSLT
HPPA_CALS4        -AATNIITGTSVGMESTALPVIFISAAIYIAYKLGEMA-----IPHIGT--AGLYGTAIA
A0DVU0_PARTE      -HATNIIAGLSVGLESTGIPILIISVGVLGAYYLGEQSGI---KNHQGELIGGLFGTAIA
A9GFG6_SORC5      -SAMAVLRGLAIGLESSVLPLLVVVGATFGSYLLGARS---------GLAGGGLFGTAVA
HPPA_LEPIC        -AATNIIYGLSLGYHSSVIPVILLVITIVTANLLA-----------------GMYGIAIA
HPPA_LEPIN        -AATNIIYGLSLGYHSSVIPVILLVITIVTANLLA-----------------GMYGIAIA
B8BUE1_THAPS      -AATNMIYGIALGYKSAIIPVLILAVVVYGSFSMC-----------------DMYGVSLA
HPPA_BACTN        -PATVIISGIGLGMLSTAIPVIAVVVGIIASFLLASGFD-------FSNVGMGLYGIGIA
HPPA_THEMA        -TGMVISNGLSLGMKSVFPPTLTLVLGILFADYFA-----------------GLYGVAIA
HPPA_CLOTE        -PATTIISGLAVGMYSTLWPIVLISIGVLVSFFVMGGG---------SNAMVGLYGISLA
HPPA_FUSNN        -AATAIIEGLAIGMESTVAPLIVIAIAIIISFKTGG-----------------LYGISIA
HPPA1_METAC       -SATNIITGFAKGMESTLWPVVIISIAIYIAFQLSG-----------------LYGIAIA
HPPA1_METMA       -SATNVITGFAKGMESTLWPAVIISIAIYIAFQLAG-----------------LYGIAIA
HPPA_CARHZ        -PATNIISGIAVGMRSTYLPIIVIVAAIMVGYWAAG-----------------FYGIALA
HPPA_BRUME        -HGTNVIQGLAVSLESTALPAIVIVGGIISTYQLAG-----------------LFGTAIA
HPPA_BRUSU        -HGTNVIQGLAVSLESTALPAIVIVGGIISTYQLAG-----------------LFGTAIA
HPPA_OCHA4        -HGTNVIQGLAVSLESTALPAIVIVGGIISTYQLAG-----------------LFGTAIA
HPPA_RHILO        -HGTNVIQGLAVSLESTALPAIVIVGGIISTYQLAG-----------------LYGTAIA
HPPA_RHIME        -HGTNVIQGLAVSLESTALPAIVIVGGIIATYQFAG-----------------LFGTAIA
HPPA_AGRFC        -HGTNVIQGLAVSLESTALPAIVIVGGIIGTYQLGG-----------------LFGTGIA
HPPA_BRADU        -HGTNVIQGLAISMEATALPAIVIIAGILVTYSLAG-----------------LFGIAIA
HPPA_RHOPA        -HGTNVIQGLAISMESTALPAIVIIAGILITYSLAG-----------------LFGIAIA
HPPA_CAUVC        -HGTNVIQGLAMSLESTALPALTIIVGIVVTYNLAG-----------------LFGIAIA
HPPA_RHORT        -HGTNVIQGLAISMEATALPALIICAAIITTYQLSG-----------------LFGIAIT
HPPA_XANAC        -HGTNIIAGLGISMKSTALPVIAVCAAIWGAFHFGG-----------------LYGIAIA
HPPA_XANCP        -HGTNIIAGLGISMKSTALPVIAVCAAIWGAFHFGG-----------------LYGIAIA
HPPA_RHOPL        -HGTNIIAGLGVSMKSTAWPVIFVCLAIYGAYALAG-----------------LYGIAIA
HPPA_NITEU        -HATNIIAGLGVGMRATAAPVLAVCASIIVAYSLAG-----------------LYGIAIA
Q609P4_METCA      -PATNVVAGLAAGLKSTGWSVALLCAAFIGPYHLGGGF--------SGHEGTGLFAVGLA
HPPA2_METAC       -AATNIISGLSIGFESTLVPTVVIVIGILISYFIVGG---------AADAGIGLYGIAIA
HPPA2_METMA       -AATNIISGLSAGFESTLVPAVVIAAGILVSYFIVGG---------SADPGTGLYGIAIA
HPPA_PYRAE        -PATVIITGYGVGLMSAIPVIAVIVAVLGISYMIGYYTVPVSGFGELSKYLAGIFGTAMA
HPPA_CHLTE        GAALNILSGLVAGNFSAYWMGLAIIVLMGAAFGFSTLGLDVMMLAP------SVFAFGLV
Q3ATF9_CHLCH      GAPLNILAGLVAGNFSAYWLGLVILALMAAAFGISELGLGSMMLAP------SVFAFGLL
D5UD74_CELFN      GASLNILSGLVAGNFSAYWLGMAVVALMSGAYAVSGLGLAALMAAP------AVFAFGLV
D4HFG9_CUTAS      GASLDILSGLVAGNFSGFWLGIIIVALMGASFLVSGAGSGLGDMGAMSEVKWAVFAFGLV
D8DTW4_PREBR      GASLNILSGFVTGNFSGFWTGLVFVLLMFVGYAASINIEESLMSYP------AIFAFGLI
D9SV73_CLOC7      GASLNILSGLITGNFSAFWEGMVFVLLMFIAYIASTFGLDDIMIYP------SVFAFGLV
B6YQJ7_AZOPC      GASLNILSGIVAGYFSAFWTGLLIVVLMAAAYFTTLT-GLSETLGPH----ATIFAFGLV
E4T255_PALPW      GPSLTILSGIVSGNYAAYWMGLLMVGLMAGGYFISQNLGIGNAMSGY----ESIFAFGLV
B9XCJ1_PEDPL      GASLNILSGFVAGNFSAFWMGLVIMVLMATSYYFSQNSALLSLMPQKFLFAAPIFAFGLV
                       :  *   .  :       .                             .:. .: 

HPPA_STRAW        GTGLLTTVGVIVAMDTFGPVSDNAQGIAEMSGDVTGA-----------------GAQVLT
HPPA_STRCO        GTGLLTTVGVIVAMDTFGPVSDNAQGIAEMSGDVEGA-----------------GAQVLT
HPPA_CHLAA        GIGMLLLTGNTISMDSFGPISDNANGIGEMAG-LDKN-----------------ARNVMD
HPPA_CALS4        TMGMLSTTAYILAMDTFGPITDNAGGITEMSGAPE-------------------EIRRVT
A0DVU0_PARTE      TMGMFCTGHLDLQLIMLE-------AQLEMSGCDE-------------------QVRQIT
A9GFG6_SORC5      TMGMLGTAGYVLAMDAFGPIVDNAGGIVAVTVARERP-----------------DVRGRT
HPPA_LEPIC        ALGMISTIAIGLTIDAYGPVSDNAGGIAEMAELGK-------------------EVRDRT
HPPA_LEPIN        ALGMISTIAIGLTIDAYGPVSDNAGGIAEMAELGK-------------------EVRDRT
B8BUE1_THAPS      AIGFLSNLATGLTIDVYGPVCDNAGGIAEMAELEP-------------------YVREKT
HPPA_BACTN        AVGMLSTLGITLATDAYGPIADNAGGNAEMAGLGA-------------------EVRKRT
HPPA_THEMA        ALGMLSFVATSVSVDSYGPIADNAGGISEMCELDP-------------------EVRKIT
HPPA_CLOTE        AVGMLSTTGLTVAVDAYGPIADNAGGIAEMSELPH-------------------EVREIT
HPPA_FUSNN        AVGMLATTGMVVAVDAYGPVADNAGGIAEMSELPP-------------------EVRETT
HPPA1_METAC       AVGMLATLGISLSVDAYGPVADNAGGIAEMSHQKE-------------------EVRQIT
HPPA1_METMA       AVGMLATLGISLSVDAYGPVADNAGGIAEMSHQKK-------------------EVRQIT
HPPA_CARHZ        AMGMLATAAMVVAVDSFGPVADNAGGIAEMAELGP-------------------EIRNKT
HPPA_BRUME        VTAMLGIAGMIVALDAFGPVTDNAGGIAEMAGLDP-------------------EVRKAT
HPPA_BRUSU        VTAMLGIAGMIVALDAFGPVTDNAGGIAEMAGLDP-------------------EVRKAT
HPPA_OCHA4        VTAMLGIAGMIVALDAFGPVTDNAGGIAEMAGLDP-------------------EVRKAT
HPPA_RHILO        VTTMLGLAGMIVALDAFGPVTDNAGGIAEMAGLPK-------------------EVRHST
HPPA_RHIME        VTAMLGLAGMIVALDAFGPVTDNAGGIAEMSHLPP-------------------EVRKST
HPPA_AGRFC        VTAMLGLAGMIVALDAFGPVTDNAGGIAEMAGLDP-------------------DVRKAT
HPPA_BRADU        TATMLALAGMIVALDAFGPVTDNAGGIAEMAGLPK-------------------EVRKST
HPPA_RHOPA        TTTMLALAGMIVALDAFGPVTDNAGGIAEMAGLPK-------------------EVRKST
HPPA_CAUVC        TTTMLSLAGFIVALDAFGPVTDNAGGIAEMAGLPP-------------------EVRVTT
HPPA_RHORT        VTSMLALAGMVVALDAYGPVTDNAGGIAEMANLPE-------------------DVRKTT
HPPA_XANAC        ATAMLSMAGMIVALDAYGPITDNAGGIAEMAELPP-------------------EVRNIT
HPPA_XANCP        ATAMLSMAGMIVALDAYGPITDNAGGIAEMAELPP-------------------EVRNVT
HPPA_RHOPL        ATSMLSMAGIVVARDAYGPITDNAGGIAEMSGLPD-------------------SVRDIT
HPPA_NITEU        ATAMLSMTGIIVALDAYGPITDNAGGIAEMAGMPE-------------------SVRAVT
Q609P4_METCA      AVAMASLGGVMVAIDGYGIAAEAAHGIAETAGLPD-------------------EVRQAT
HPPA2_METAC       AVAMLSTTGMIVALDSYGPITDNAGGIAQMANLPA-------------------QVRKVT
HPPA2_METMA       SVAMLSTAGMIVALDSYGPITDNAGGIAQMANLPA-------------------QVRKVT
HPPA_PYRAE        SVGLLVVAGIIITADSYGPVSDNAGGVVEMAGLPD-------------------EVREIT
HPPA_CHLTE        AFGFLSMGPVTIAVDSYGPVTDNAQSVYELSLIETLPNISNSIESEFGFKPDFENAKRYL
Q3ATF9_CHLCH      AFGFLSMGPVTIAVDSYGPVTDNAQSVYELSLIENIPNISQNIQNEFGFQPHFENAKYFL
D5UD74_CELFN      AFGFLGMGPVTIAVDSYGPVTDNAQSVYELSTIEDLPGIEHELRRDFDLAPQWASAKRML
D4HFG9_CUTAS      AFGFLGMGAVTIAVDSYGPVTDNAQSVYELSTIEDIPNVSNELKKHYGFAPRWDIAKHIL
D8DTW4_PREBR      AFGMLGMGPVTIAVDSYGPVTDNAQSVYELSLIEDMPNKDQEIEQNYGFTPDWEKSKYYL
D9SV73_CLOC7      AFGLLGMGPITIAVDSYGPVTDNAQSIYELSLIETIPNITKVIKRDFGFEPDFEKAKYYL
B6YQJ7_AZOPC      AFGSLCMGPVTIAVDSYGPVTDNAQSIFELSQIEQIPNIEKSIEKDYGFKPDFKKGKYYL
E4T255_PALPW      AFGFLCMGPVTIAVDSYGPVTDNAQSVFELSQIEQIPNISAEIEKYFGFTPDFERGKHYL
B9XCJ1_PEDPL      AFGFLGMGPVTIAVDSYGPVTDNAQSVYELSQIEARKGIKEDIQVNFGFDPDFENAKYLL
                             :             .                              .   

HPPA_STRAW        D-LDAVGNTTKAITKGIAIATAVLAASALFGSYRDAITTAANDVGEKVSG----------
HPPA_STRCO        D-LDAVGNTTKAITKGIAIATAVLAAAALFGSYRDAITTGAADVGEKLSG----------
HPPA_CHLAA        D-LDAVGNTTKAVTKGIAIGSAVIAAVALYGSYFTDVNKVLQQMINEGR-----------
HPPA_CALS4        DRLDACGNTTKALTKGYAIGSAALATFLLFSAYLDE--------VKKILG----------
A0DVU0_PARTE      DRLDAVGNVTKANAKGYSVGSASLASFLLFRAFIDE--------VNFL------------
A9GFG6_SORC5      LVLDAVGNTTKALTKAYTAGVAALASLLLVAGYLDESRR--RALTSSAPI----------
HPPA_LEPIC        DTLDAAGNTTAAIGKGFAIGSAALTSLALFAAFITRTHTTS-------------------
HPPA_LEPIN        DTLDAAGNTTAAIGKGFAIGSAALTSLALFAAFITRTHTTS-------------------
B8BUE1_THAPS      DALDAAGNTTAAIGKGFAIGSAALVSLALFGAFVTRIRHASN------------------
HPPA_BACTN        DALDSLGNTTAATGKGFAIGSAALTGLALLASYIEEIRIGLTRLGTVDLSMPNGDVVSTA
HPPA_THEMA        DHLDAVGNTTAAIGKGFAIGSAIFAALSLFASYMFSQISPSD------------------
HPPA_CLOTE        DKLDSVGNTTAAIGKGFAIGSAALTALSLFASYAQA------------------------
HPPA_FUSNN        DKLDAVGNSTAAVGKGFAIGSAALTALSLFAAYKEAVDK---------------------
HPPA1_METAC       DTLDAVGNTTAAIGKGFAIGSAALTALALFASYGIA------------------------
HPPA1_METMA       DTLDAVGNTTAAMGKGFAIGSAALTALSLFASYAIA------------------------
HPPA_CARHZ        DKLDAVGNTTAAVAKGFAIGSAALTALALFSAYTDLAKTNPN------------------
HPPA_BRUME        DALDAVGNTTKAVTKGYAIGSAGLGALVLFAAYSNDLAYFAANGQI--------------
HPPA_BRUSU        DALDAVGNTTKAVTKGYAIGSAGLGALVLFAAYSNDLAYFAANGQI--------------
HPPA_OCHA4        DALDAVGNTTKAVTKGYAIGSAGLGALVLFAAYSNDLAYFAANGQT--------------
HPPA_RHILO        DALDAVGNTTKAVTKGYAIGSAGLGALVLFAAYSNDLKFFAANGDK--------------
HPPA_RHIME        DALDAVGNTTKAVTKGYAIGSAGLGALVLFAAYSNDLAYFAANGDK--------------
HPPA_AGRFC        DALDAVGNTTKAVTKGYAIGSAGLGALVLFAAYANDLSYFAANGDT--------------
HPPA_BRADU        DALDAVGNTTKAVTKGYAIGSAGLGALVLFAAYNQDLKFFVADSAH--------------
HPPA_RHOPA        DALDAVGNTTKAVTKGYAIGSAGLGALVLFAAYNEDLKFFIAQKS---------------
HPPA_CAUVC        DALDAVGNTTKAVTKGYAIGSAGLGALVLFAAYTEDLKFFSENAAP--------------
HPPA_RHORT        DALDAVGNTTKAVTKGYAIGSAGLGALVLFAAYTEDLAFFKANVDA--------------
HPPA_XANAC        DPLDAVGNTTKAVTKGYAIGSAALAALVLFADYTHNLQAANP------------------
HPPA_XANCP        DPLDAVGNTTKAVTKGYAIGSAALAALVLFADYTHNLQAANP------------------
HPPA_RHOPL        DPLDAVGNTTKAVTKGYAIGSAGLAALVLFADYTHALEARG-------------------
HPPA_NITEU        DPLDAVGNTTKAVTKGYAIGSAGLAALVLFADYTHGLEHAN-------------------
Q609P4_METCA      ASLDAAGRATRPVVQGYVVGAGGLAMLALFAEYSKCFAVPLA------------------
HPPA2_METAC       DALDAVGNTTKAVTKGYAIGSAALGALALFADYRSKVNLGGQ------------------
HPPA2_METMA       DELDSVGNTTKAVTKGYAIGSTALGALALFADYRNKVSLESQ------------------
HPPA_PYRAE        DVLDSVGNTTKATTKGYAIASAALAALVLFIALIFEIVYSASKILGKGIV----------
HPPA_CHLTE        EANDGAGNTFKATAKPVLIGTAVVGSTTMIFSIIMILTGGLAD-----------------
Q3ATF9_CHLCH      EENDGAGNTFKATAKPVLIGTAVVGATTMIFSIIMVLTNGLSD-----------------
D5UD74_CELFN      EENDGAGNTFKATAKPVLIGTAVVGATTMIFSIIMSLTEGL-------------------
D4HFG9_CUTAS      EAQDGAGNTFKATAKPVLIGTAVVGATTMIFSIIMMLTEGLSN-----------------
D8DTW4_PREBR      EQNDGAGNTFKATAKPVLIGTAVVGATTMIFSIILVIKNVLG------------------
D9SV73_CLOC7      EENDSAGNTFKATAKPVLIGTAVVGATTMIFSLILVIQEVLG------------------
B6YQJ7_AZOPC      ESNDSAGNTFKATAKPVLIGTAVIGATTMIFSIILLLEKV--------------------
E4T255_PALPW      EANDSAGNTFKATAKPVLIGTAVAGATTMIFSIILLLKGV--------------------
B9XCJ1_PEDPL      EKGDGAGNTFKATAKPVLIGTAVVGATTMVFGIIILLENLFG------------------
                     *. *.   .  :    .        :                               

HPPA_STRAW        ----AGAPMNLMMDISQPNNLVGLIAGAAVVFLFSGLAINAVSRSAGAVVYEVRRQFREH
HPPA_STRCO        ----EGAPMTLMMDISQPNNLVGLIAGAAVVFLFSGLAINAVSRSAGAVVYEVRRQFRER
HPPA_CHLAA        ----QGIELLASINVAAPPVFIGLLIGGAVPFLFSALTIRAVSRAAAQIVNEVRRQFR-I
HPPA_CALS4        ----KPIDSWFPVDIGKPEVFIGAFIGAMIVYLFSSTAIRAVGKAAQYVILEVRRQFREI
A0DVU0_PARTE      ----SPTKKILDIDITQPEIFISGLIGACTVFVFSSWALRAVGNAAQDVIKEVRRQFREN
A9GFG6_SORC5      ----RGETTAMVLRLDRPEVYLGALVGILLVFWLAGRCIRNVLQAGRRVLDEVRRQARAR
HPPA_LEPIC        ------------LEVLNAEVFGGLMFGAMLPFLFTAMTMKSVGKAAVDMVEEVRKQFKEI
HPPA_LEPIN        ------------LEVLNAEVFGGLMFGAMLPFLFTAMTMKSVGKAAVDMVEEVRKQFKEI
B8BUE1_THAPS      -----DELFQDGVNMLSPLTFAFLIIGGMIPFAFAAMTMKSVGVAAMEMVLEVQRQFDEK
HPPA_BACTN        NATFVDFMNYYDVTLMNPKVLSGMFLGSMMAFLFCGLTMNAVGRAAGHMVDEVRRQFREI
HPPA_THEMA        --IGKPPSLVLLLNMLDARVIAGALLGAAITYYFSGYLISAVTKAAMKMVDEIRRQAREI
HPPA_CLOTE        -------TELESIDILNTVTLVGLFIGAMLPFLFGALTMESVGKAANEMIEEVRRQFKTI
HPPA_FUSNN        -----LTSEALVIDVTDPEVIAGLFIGGMLTFLFSALTMTAVGKAAIEMVEEVRRQFREF
HPPA1_METAC       -------VGLSAIDVMNPNVFIGLTIGAMLPYLFSSMTILAVGNAAGEVVVEVRRQFREI
HPPA1_METMA       -------VGLTSIDVMNPNVFIGLIIGAMLPFLFSSMTILAVGNAAGEVVVEVRRQFKEI
HPPA_CARHZ        -LQKYLVNGKFDLNITDPWVLVGLFLGGTVAFLVAALTMESVGKAAFDMIEEVRRQFREI
HPPA_BRUME        -YPYFADMGPVSFDLSNPYVVAGLIFGGLIPYLFGGMAMTAVGRAGGAVVQEVRRQFREK
HPPA_BRUSU        -YPYFADMGPVSFDLSNPYVVAGLIFGGLIPYLFGGMAMTAVGRAGGAVVQEVRRQFREK
HPPA_OCHA4        -YPYFADMGPVSFDLSNPYVVAGLIFGGLIPYLFGGMAMTAVGRAGGAVVQEVRRQFREK
HPPA_RHILO        -YPYFQGMGEISFDLSNPYVVAGLIFGGLIPYLFGGIAMTAVGRAAGAIVEEVRKQFRED
HPPA_RHIME        -HPYFADVGTISFDLSNPYVVAGLIFGGLIPYLFGGIAMTAVGRAGSAVVEEVRRQFKEK
HPPA_AGRFC        -YPYFKDIGEISFSLANPYVVAGLLFGGLIPYLFGGIAMTAVGKAASAIVEEVRRQFREK
HPPA_BRADU        -HTYFAGVNP-DFSLNNPYVVVGLLFGGLLPYLFGAMGMTAVGRAASAIVEEVRRQFREK
HPPA_RHOPA        --PYFVGVAP-DFSLNNPYVVVGLLFGGLLPYLFGAMGMTAVGRAAGAIVEEVRRQFREK
HPPA_CAUVC        -GSFFHGMGAVTFDLSNPYVVVGLLFGGLLPFLFGGLSMTAVGRAAESVVAEVRRQFRDN
HPPA_RHORT        -YPAFAGVDV-NFSLSSPYVVVGLFIGGLLPYLFGSMGMTAVGRAAGSVVEEVRRQFREI
HPPA_XANAC        -------DQVYAFDLSDHTVIIGLLIGGLIPYLFGAMAMEAVGRAAGAVVEEVRRQFREL
HPPA_XANCP        -------NEVFAFDLSDHTVIIGLLIGGLIPYLFGAMAMEAVGRAAGAVVEEVRRQFRDI
HPPA_RHOPL        --------MSLSFDLSDHRVIVGLFIGGLIPYLFASMAMEAVGRAAGSVVVEVRRQFRDI
HPPA_NITEU        --------KLMTFDLSNHLVIIGLFIGGMVPFLFGAMSMEAVGRAAGSVVLEVRRQFKEI
Q609P4_METCA      ------------LNLSDPVVLTGLFAGGLMPYLLGSVSLGAVGNVPAGAGGQANGGLR--
HPPA2_METAC       -----------SLNLDDPVVLAGLLLGALLPFVFSAVTMSAVGKAAFEVVNEVRRQFREI
HPPA2_METMA       -----------SISLDSPVVLSGILLGAVLPFLFSAVMMSAVGKAAFEVVNEVRRQFREI
HPPA_PYRAE        ---DMISESLSGLQLINANVLIGAFLGVALVYFFSSRTLEAVGRTAMEIVEEIRRQFREK
HPPA_CHLTE        ------TGAIAKLSILWPPFLLGLLMGGAVIYWFTGASMNAVTTGAYYAVAFIKKNIKLD
Q3ATF9_CHLCH      ------TAAIARLSILSPPFLFGLLMGGAVIYWFTGASINAVSTGAYYAVEFIKQHIHLD
D5UD74_CELFN      ------TVDLDHLSLLHPPFLLGLVTGGAVIYWFTGASIQAVTTGAHRAVAYIKDTIRLD
D4HFG9_CUTAS      ------AAEVNKLGLAHAPFLLGLITGGAVIYWFSGASMQAVTTGAYRAVEFIKNNMQLD
D8DTW4_PREBR      ------IDPASVLNILNPYTILGFLLGGCVIYWFTGASTQAVTVGANRAVAFIKDHIKLD
D9SV73_CLOC7      ------IKPEDTLNLLNPYTLLGFLCGGAIIFWFSGASTQAVATGAYRAVEYIKENIQLD
B6YQJ7_AZOPC      --------GLLNLSLTDAPVVLGLICGGAVVFWFSGASMQAVTTGAYRAVMFIKETFNMD
E4T255_PALPW      --------GMLSLELTQAPILLGLITGGAMVFWFSGASIQAVTTGAYRAVEYIKRHMKLD
B9XCJ1_PEDPL      -------GAVAKLSIVEPKVILGLIMGGSVVYWFTGASTQAVVTGAYRAVVYIKDNMKLD
                              . :           *    : . .     *           .      

HPPA_STRAW        PGIMDYTEQ--PEYGRVVDICTKDALRELATPGLLAVLAPIAIGFT-------------L
HPPA_STRCO        PGIMDYSEK--PEYGKVVDICTRDALRELATPGLLAVMAPIFIGFT-------------L
HPPA_CHLAA        PGLMEGKVQ--PDYARAVQISTTAAQKELISLGLIAVMVPIIVGFT-------------L
HPPA_CALS4        PGIMEGTAK--PDYARAVDIVTKGALKEMVIPGLIVVVTPILVGV-------------IL
A0DVU0_PARTE      EGILQGTAQ--PNYKQCVEIVTKAGLREMIKPGLLSVLTPLILGIALRAINVVRM-QELL
A9GFG6_SORC5      P----PGFV--GDHEPCVEMVSRAALRHMIAPALVSAVVPVVVGLALRFARTED--NPLV
HPPA_LEPIC        PGIMEGKNK--PDYKRCVDISTSAALREMILPGLLVLLTPILVGYLFGVK----------
HPPA_LEPIN        PGIMEGKNK--PDYKRCVDISTSAALREMILPGLLVLLTPILVGYLFGVK----------
B8BUE1_THAPS      PHLLDANPTERPDYDACIGISTKASLKEMVAPGAMVILTPLLTGIFFGVY----------
HPPA_BACTN        KGILTGEAE--PDYERCVAISTKGAQREMVIPSLIAILAPIATGLIFGVT----------
HPPA_THEMA        PGLLEGKAK--PDYNRCIEITSDNALKQMGYPAFIAILTPLVTGFLLGAE----------
HPPA_CLOTE        PGIMEGKAT--PDYKKCVDISTAAAIREMILPGVLAIVVPVAMGLLLGKE----------
HPPA_FUSNN        PGIMDRTQK--PDYKRCVEISTHSSLKQMILPGVLAIIVPVIIGLWSVK-----------
HPPA1_METAC       AGLMEGKAD--PDYGKCIAISTHSALKEMIPPGLLAVIAPLLVGLVLGPG----------
HPPA1_METMA       KGLMEGKAD--PDYSKCITISTHSALKEMIPPGILAVIAPILVGLVLGAG----------
HPPA_CARHZ        PGLMEGKAR--PDYARCVSISTAAAIRQMIAPGLLAVGAPLAIGFILGFK----------
HPPA_BRUME        PGIMTGKER--PDYARAVDLLTKAAIREMIIPSLLPVLAPIVVYFGVLLISGS----KAA
HPPA_BRUSU        PGIMTGKER--PDYARAVDLLTKAAIREMIIPSLLPVLAPIVVYFGVLLISGS----KAA
HPPA_OCHA4        PGIMTGKER--PDYARAVDLLTRAAIREMIIPSLLPVLAPIVVYFGVLLISGS----KAA
HPPA_RHILO        PGIMAGTSK--PNYARAVDLLTKAAIREMIIPSLLPVLAPLVVYFGVLLISGS----KAS
HPPA_RHIME        PGIMEGKDR--PDYGRAVDMLTKAAIREMIIPSLLPVLAPIVVYFGVLLISGS----KAS
HPPA_AGRFC        PGIMAGTEK--PDYGRAVDLLTKAAIREMVIPSLLPVLAPLVVYFGVLLISGS----KAS
HPPA_BRADU        PGIMQGTDK--PDYGKAVDLLTKAAIKEMIIPSLLPVLSPIVVYFLIYAIAGGGATGKSA
HPPA_RHOPA        PGIMKGTDK--PDYGKAVDLLTKAAIKEMIIPSLLPVLSPIFVYFAIYAIAGGGAAGKSA
HPPA_CAUVC        PGIMTGEVK--PEYGKAVDILTKAAIREMIVPSLLPVVSPVALFFVIQAIAGK-----VD
HPPA_RHORT        PGIMEGTAK--PEYGRCVDMLTKAAIKEMIIPSLLPVLAPIVLYFVILGIADK-----SA
HPPA_XANAC        PGIMAGTAK--PQYDRAVDMLTRSAIGEMIVPSLLPVVVPIIVGLLL-------------
HPPA_XANCP        PGIMTGTAK--PQYDRAVDMLTRSAIREMIVPSLLPVVVPVIVGLLL-------------
HPPA_RHOPL        KGIMEGTAK--PEYGTAVDMLTTAAIKEMIVPSLLPVVAPILVGMLL-------------
HPPA_NITEU        PGIMDGSRK--PDYSRAVDMLTKAAIREMIVPSLLPVLIPVLVGVFL-------------
Q609P4_METCA      -----------------------VALKRASILVLVPLAVPLLVGLGG-------------
HPPA2_METAC       PGIMEGTAK--PEYGRCVDIVTKAALHEMAMPGFLAVLVPLLVGLIL-------------
HPPA2_METMA       PGIMEGTAK--PEYGRCVDIVTKAALHDMAMPGFLAVIIPLLTGFFL-------------
HPPA_PYRAE        PGILEWKEQ--PDYARVVDIATRRALGEFLIPGLAAIVLPLITGLLLGWN----------
HPPA_CHLTE        GVT--KAST--EDSKKVVEICTRFAQKGMINLFLTIFFSTLAFACL--------------
Q3ATF9_CHLCH      GSQE-RAST--EDSKKVVEICTKFAQKGMFNLFLTIFFSTLAFACL--------------
D5UD74_CELFN      GVT--RASA--EQSREVVQICTQYAQRGMLTMFLGVFFTTLAFAFV--------------
D4HFG9_CUTAS      QNAT-KASS--KDSKKVVQICTEYAQKGMLNIFLGVFFAALGFAFV--------------
D8DTW4_PREBR      PNAPKKADS--KSSVEVVKICTQYAQKGMWNIFIAIFFFALGFACLASPASIGGN----N
D9SV73_CLOC7      ENADTKAST--EKSKAVVKICTQYAQNGMFNIFIALFSFALAIAFLSAPAN-GNT----H
B6YQJ7_AZOPC      KKE---ANI--EDSKSVVKICTQYAQKGMWNIFIALMSLTLAFAFI--------------
E4T255_PALPW      KTQ---ADE--KDSIEVVRICTQYAQNGMWNIFITLMTATLAFALF--------------
B9XCJ1_PEDPL      AAT---ASD--KDSKEVVRICTEYAQKGMWNIFIVVFCFALALPFF--------------
                                          .              .:                   

HPPA_STRAW        GVGALGAYLAGAIGTGTLMAVFLANSGGAWDNAKKLVEDGHHGGK----------GSEAH
HPPA_STRCO        GVGALGAFLAGAIGAGTLMAVFLANSGGSWDNAKKLVEDGHHGGK----------GSEAH
HPPA_CHLAA        GVEALGGFLAGIILTGQLMAVFQANAGGAWDNAKKYIEEGNFGGK----------HSEPH
HPPA_CALS4        GKEAAAAFLMIGTISGVILALYLNNGGGAWDNAKKFIELGNYGGK----------GSDAH
A0DVU0_PARTE      PAKAICAFLMFSTCTGILQALFLNNAGGAWDNSKKYIETGELGGK----------GSETH
A9GFG6_SORC5      AADSVAALIMAGTVAGVLGSLFLGNTGAIWDNARQYIATGAHGGRYLVDETGARADNPTY
HPPA_LEPIC        ---TLAGVLAGALVAGVVLAISAANSGGGWDNAKKYIEKKAG-----------GKGSDQH
HPPA_LEPIN        ---TLAGVLAGALVAGVVLAISAANSGGGWDNAKKYIEKKAG-----------GKGSDQH
B8BUE1_THAPS      ---AVSGLLVGSLVAAVQLAISMSNSGGAWDNAKKYIEKATPDSDL------KGKGSDIH
HPPA_BACTN        ---GVLGLLIGGLSTGFVLAIFMANAGGAWDNAKKYVEEGNFG----------GKGGEVH
HPPA_THEMA        ---FVGGVLIGTVLSGAMLAILTANSGGAWDNAKKYLEAGNLEG--------YGKGSEPH
HPPA_CLOTE        ---ALGGLLAGALVSGVLVGILMSNAGGAWDNAKKYIEGGAHGGK----------GSEAH
HPPA_FUSNN        ---ALGGLLAGALVTGVLMAIMMANAGGAWDNGKKQIEGGYKGDKK---------GSDRH
HPPA1_METAC       ---ALGGLLAGSVASGFMIAITMSNAGGAWDNAKKYIELGNFGGK----------GSDAH
HPPA1_METMA       ---ALGGLLAGSVVSGFMLAITMSNAGGSWDNAKKFIELGNFGGK----------GSDAH
HPPA_CARHZ        ---ALTGYLAGVTATGVLLAIYMANAGGAWDNAKKYIEAGNLGGK----------GSDTH
HPPA_BRUME        AFAALGASLLGVIINGLFVAISMTSGGGAWDNAKKSFEDGFTDADGVK----HMKGSEAH
HPPA_BRUSU        AFAALGASLLGVIINGLFVAISMTSGGGAWDNAKKSFEDGFTDADGVK----HMKGSEAH
HPPA_OCHA4        AFAALGASLLGVIVNGLFVAISMTSGGGAWDNAKKSFEDGFTDADGVK----HLKGSEAH
HPPA_RHILO        AFAALGASLLGVIVNGLFVAISMTSGGGAWDNAKKSFEDGFTDKDGVK----HLKGSEAH
HPPA_RHIME        AFAALGASLLGVIVNGLFVAISMTSGGGAWDNAKKSFEDGFVDRNGTR----HMKGSEAH
HPPA_AGRFC        AFAALGASLLGVIINGLFVAISMTSGGGAWDNAKKSFEDGFIDKDGVR----HVKGSEAH
HPPA_BRADU        AFSAVGAMLLGVIVTGLFVAISMTSGGGAWDNAKKYIEDGHYGG----------KGSDAH
HPPA_RHOPA        AFSAVGAMLLGVIVTGLFVAISMTSGGGAWDNAKKYIEDGHHGG----------KGSDAH
HPPA_CAUVC        AFAALGAMLMGVIVTGLFVAISMTSGGGAWDNAKKVIEEGFTDKNGVL----HKKGGETH
HPPA_RHORT        AFSALGAMLLGVIVTGLFVAISMTAGGGAWDNAKKYIEDGHYGG----------KGSEAH
HPPA_XANAC        GPRALGGLLIGTIVTGLFLAISMTTGGGAWDNAKKYIEDGHFGG----------KGSEAH
HPPA_XANCP        GPRALGGLLIGTIVTGLFVAISMTTGGGAWDNAKKYIEDGHFGG----------KGSEAH
HPPA_RHOPL        GPAALGGLLMGTIVTGIFVGISMCTGGGAWDNAKKLIEEGFTDANGVL----HKKGSEAH
HPPA_NITEU        GPQALGGVLMGSIVTGLFIAISMTAGGGAWDNAKKYIEDGNYGG----------KGSDAH
Q609P4_METCA      GREALGGMLVGAIVTGLFQAFAMSSGGGAWDSARRYIEDGMYGG----------ADSEAH
HPPA2_METAC       GPKALAGLLIGLIVVGFMLALMMDNGGGAWDNAKKLIEDGNHGG----------RGSEAH
HPPA2_METMA       GPEALAGLLTGLIVVGFMLALMMDNGGGAWDNAKKLIEDGYYGG----------KGSEAH
HPPA_PYRAE        ---ALAGLIMGAIVAGVPRALLMANAGGAWDNAKKYIEIQGLKK------------TEMH
HPPA_CHLTE        ESYLFIGYLISIALFGLYQAIFMANAGGAWDNAKKVVETELHAK-----------GTELH
Q3ATF9_CHLCH      DSFFFIGYLISIALFGLYQAIFMANAGGAWDNAKKVVETELHAK-----------GTPLH
D5UD74_CELFN      EPFFFIGYLVSIAVFGLYQAIFMANAGGAWDNAKKIVEVDLNAK-----------GTPLH
D4HFG9_CUTAS      DPYFFIGYLISIAIFGLYQAIFMANAGGAWDNAKKIVEVDLDAK-----------GTELH
D8DTW4_PREBR      AVSLFVSYLISIALFGLFQAVFMANAGGSWDNAKKVVEVDLALK-----------GTDLH
D9SV73_CLOC7      AVSFFISYLIAISVIGLFQAVFMANAGGCWDNAKKVVEVELKEK-----------GSPLH
B6YQJ7_AZOPC      DANFFVSYLISIAIIGLFQAIYMANAGGSWDNAKKIVEVELKEK-----------NTPLH
E4T255_PALPW      DPNFFVAYLISIAIFGLFQALYMANAGGAWDNAKKLVEVDLQEK-----------NTPLH
B9XCJ1_PEDPL      NAYFFIGYLIGIAFFGLFQAIFMANAGGAWDNAKKIVEVDLRQK-----------GTELH
                        . :      .   ..     *. **..:: .                      :

HPPA_STRAW        AATVIGDTVGDPFKDTAGPAINPLLKVMNLVALLIAPAVVKFSYGEDKNLGVRIAIAVLS
HPPA_STRCO        AATVIGDTVGDPFKDTAGPAINPLLKVMNLVALLIAPAVIKFSYGADKSVVVRVLIAVVA
HPPA_CHLAA        KAAVVGDTVGDPLKDTAGPALNPMIKVINLVALIIAPIVVTIEPGSPG----VIIAMIIC
HPPA_CALS4        KASVVGDTVGDPFKDTAGPSLHVLIKLISTITLVFVALFR--------------------
A0DVU0_PARTE      KAAVTGDTVGDPCKDTAGPSIHILIKLYSTITIVMVPLFVD-------------------
A9GFG6_SORC5      GAAVVGDTIGDPLKDVAGPAIHVLIKMLPAVIIVFLPFFI--------------------
HPPA_LEPIC        KAAVVGDTVGDPFKDTSGPSINILIKLMAITSLVFAEFFVQQ--GGLIFKIFH-------
HPPA_LEPIN        KAAVVGDTVGDPFKDTSGPSINILIKLMAITSLVFAEFFVQQ--GGLIFKIFH-------
B8BUE1_THAPS      KAAVVGDTVGDPFKDTSGPALNIVMKLMAVLSLVFADTFYATNGGAGVFQL---------
HPPA_BACTN        KATVVGDTVGDPFKDTSGPSLNILIKLMSMVAIVMAGLTVAW----SLF-----------
HPPA_THEMA        KALVIGDTVGDPLKDTVGPSLDILIKIMSVVSVIAVSIFKHV----HLF-----------
HPPA_CLOTE        KAAVVGDTVGDPFKDTSGPSMNILIKLMTIVSLVFAPVVLQYGGILLNLIK---------
HPPA_FUSNN        KAAVVGDTVGDPFKDTSGPSLNILIKLMSIVSLVLVPLFVKFM-----------------
HPPA1_METAC       KAGVTGDTVGDPFKDTAGPAINILIKLMSIVAVVFAPLFM--------------------
HPPA1_METMA       KAGVTGDTVGDPFKDTAGPAINILIKLMSIVALVFAPLFI--------------------
HPPA_CARHZ        KAAVVGDTVGDPFKDTSGPAMNPLMKVAGTFALIIVPLLLF-------------------
HPPA_BRUME        KASVTGDTVGDPYKDTAGPAVNPAIKITNIVALLLLAVLAHMA-----------------
HPPA_BRUSU        KASVTGDTVGDPYKDTAGPAVNPAIKITNIVALLLLAVLAHMA-----------------
HPPA_OCHA4        KASVTGDTVGDPYKDTAGPAVNPAIKITNIVALLLLAVLAHMS-----------------
HPPA_RHILO        KASVTGDTVGDPYKDTAGPAVNPAIKITNIVALLLLAVLAHG------------------
HPPA_RHIME        KASVTGDTVGDPYKDTAGPAVNPAIKITNIVALLLLAVLA--------------------
HPPA_AGRFC        KASVTGDTVGDPYKDTAGPAVNPAIKITNIVALLLLAVLAH-------------------
HPPA_BRADU        KSAVTGDTVGDPYKDTAGPAVNPMIKITNIVALLLLAILAH-------------------
HPPA_RHOPA        KAAVTGDTVGDPYKDTAGPAVNPMIKITNIVALLLLAILAH-------------------
HPPA_CAUVC        KAAVTGDTVGDPYKDTSGPAVNPMIKITNIVALLLLAVLAHGV-----------------
HPPA_RHORT        KAAVTGDTVGDPYKDTAGPAVNPMIKITNIVALLLLAVLAH-------------------
HPPA_XANAC        KAAITGDTVGDPYKDTAGPAINPLIKIINIVALLLVPLL---------------------
HPPA_XANCP        KAAITGDTVGDPYKDTAGPAINPLIKIINIVALLLVPLL---------------------
HPPA_RHOPL        KAAVTGDTVGDPYKDTAGPAVNPLIKIINIVALLIVPLLPLASNPVKASHAEPAPMVQPA
HPPA_NITEU        KAAVTGDTVGDPYKDTAGPAINPLIKIINIVALLIIPLL---------------------
Q609P4_METCA      RAALTGDQVGTACQAVAGPALNPLIKLMGLVAVLIAPLLA--------------------
HPPA2_METAC       KAAVVGDTVGDPFKDTAGPALNALIKVVNMVAILFSSLIIHSGLF---------------
HPPA2_METMA       RAAVVGDTVGDPFKDTAGPALNSLIKVVNMVAILFSPLIIGGGFL---------------
HPPA_PYRAE        KAAVIGDTVGDPMKDTVGPSLNPLIKVLNTLSVVFTYVIVSTNIALGIWPSGLLPF----
HPPA_CHLTE        DASVVGDTVGDPFKDTSSVALNPIIKFTTLFGLLAIELAIKLPT----TISVSLAVVFFL
Q3ATF9_CHLCH      DASVVGDTVGDPFKDTSSVALNPIIKFTTLFGLLAIELAIELPP----HIAQTLAAVCFA
D5UD74_CELFN      DATIVGDTVGDPYKDTSSVALNPVIKFTTLFGLLAVELAVSLRDQGHGTLVAVLAVVLGA
D4HFG9_CUTAS      DASVVGDTVGDPFKDTSSVALNPVIKFTTLFGLLAVELAVSIGA---GLLTYILAAVFIL
D8DTW4_PREBR      DASVVGDTVGDPFKDTSSVSLNPIIKFTTLFGLLAMEMAISESF---RELAPYFGILFVL
D9SV73_CLOC7      DATIVGDTVGDPFKDTASVALNPIIKFTTLFGMLAMEIAITEAF---RDIAVYVGVIFLI
B6YQJ7_AZOPC      EAVVVGDTVGDPFKDTSSVSLNPIIKFSTLFGLLATEICIKMKE-TGGNISIYITIPFLI
E4T255_PALPW      DASVIGDTVGDPFKDTTSVALNPIIKFSTLFGLLAVEIAVNMST-VGADGVKHYTLAHFI
B9XCJ1_PEDPL      AATVVGDTVGDPFKDTSSVALNPVIKFTTLFGLLAVEIAVTM---TNNNVKLGIGCFFFL
                   : : ** :* . : . . ::.  :*.     ::                          

HPPA_STRAW        ILVIVGAVYISKRRGIAVGDEGNAERVTKSADPAVVS-----------------------
HPPA_STRCO        FAVIAAAVYVSKRRGIAMGDEDDADPEPKSADPAVVS-----------------------
HPPA_CHLAA        GAALVWAIWQSKRESEALKEIAQA---PASAD----------------------------
HPPA_CALS4        ------------------------------------------------------------
A0DVU0_PARTE      ------------------------------------------------------------
A9GFG6_SORC5      ------------------------------------------------------------
HPPA_LEPIC        ------------------------------------------------------------
HPPA_LEPIN        ------------------------------------------------------------
B8BUE1_THAPS      ------------------------------------------------------------
HPPA_BACTN        ------------------------------------------------------------
HPPA_THEMA        ------------------------------------------------------------
HPPA_CLOTE        ------------------------------------------------------------
HPPA_FUSNN        ------------------------------------------------------------
HPPA1_METAC       ------------------------------------------------------------
HPPA1_METMA       ------------------------------------------------------------
HPPA_CARHZ        ------------------------------------------------------------
HPPA_BRUME        ------------------------------------------------------------
HPPA_BRUSU        ------------------------------------------------------------
HPPA_OCHA4        ------------------------------------------------------------
HPPA_RHILO        ------------------------------------------------------------
HPPA_RHIME        ------------------------------------------------------------
HPPA_AGRFC        ------------------------------------------------------------
HPPA_BRADU        ------------------------------------------------------------
HPPA_RHOPA        ------------------------------------------------------------
HPPA_CAUVC        ------------------------------------------------------------
HPPA_RHORT        ------------------------------------------------------------
HPPA_XANAC        ------------------------------------------------------------
HPPA_XANCP        ------------------------------------------------------------
HPPA_RHOPL        ETAPAMPAAPMAEPSAPAASQ---------------------------------------
HPPA_NITEU        ------------------------------------------------------------
Q609P4_METCA      ------------------------------------------------------------
HPPA2_METAC       ------------------------------------------------------------
HPPA2_METMA       ------------------------------------------------------------
HPPA_PYRAE        ------------------------------------------------------------
HPPA_CHLTE        -------LSLVFVHRSFFSMRIAVDKD---------------------------------
Q3ATF9_CHLCH      -------ISLIFVHRSFFSMRIKVDEH---------------------------------
D5UD74_CELFN      -------ASLWCVHRSFYGMRIGRTRDGGRAPLPPEPETDRGPGTPMPPGEDTPADTHAD
D4HFG9_CUTAS      -------VACVFVYRSFYGMRIDSTKDPDEFGVVAKEAGSGS------------------
D8DTW4_PREBR      -------IAIVFVWRSFYKMRIDDSMENILEQYNNKKTEE--------------------
D9SV73_CLOC7      -------IALIFIWRSFYKMKIGASKLS--------------------------------
B6YQJ7_AZOPC      -------VGLFFVWRSFYRTRIPT------------------------------------
E4T255_PALPW      TAGILLAISMYFAWRSFYKMRIKVEE----------------------------------
B9XCJ1_PEDPL      -------VALIFVYRSFYSMRIPDENTGSEDHLILPHPPHR-------------------
                                                                              

HPPA_STRAW        -------------------------------
HPPA_STRCO        -------------------------------
HPPA_CHLAA        -------------------------------
HPPA_CALS4        -------------------------------
A0DVU0_PARTE      -------------------------------
A9GFG6_SORC5      -------------------------------
HPPA_LEPIC        -------------------------------
HPPA_LEPIN        -------------------------------
B8BUE1_THAPS      -------------------------------
HPPA_BACTN        -------------------------------
HPPA_THEMA        -------------------------------
HPPA_CLOTE        -------------------------------
HPPA_FUSNN        -------------------------------
HPPA1_METAC       -------------------------------
HPPA1_METMA       -------------------------------
HPPA_CARHZ        -------------------------------
HPPA_BRUME        -------------------------------
HPPA_BRUSU        -------------------------------
HPPA_OCHA4        -------------------------------
HPPA_RHILO        -------------------------------
HPPA_RHIME        -------------------------------
HPPA_AGRFC        -------------------------------
HPPA_BRADU        -------------------------------
HPPA_RHOPA        -------------------------------
HPPA_CAUVC        -------------------------------
HPPA_RHORT        -------------------------------
HPPA_XANAC        -------------------------------
HPPA_XANCP        -------------------------------
HPPA_RHOPL        -------------------------------
HPPA_NITEU        -------------------------------
Q609P4_METCA      -------------------------------
HPPA2_METAC       -------------------------------
HPPA2_METMA       -------------------------------
HPPA_PYRAE        -------------------------------
HPPA_CHLTE        -------------------------------
Q3ATF9_CHLCH      -------------------------------
D5UD74_CELFN      AAAPTPRHDAVPTARAPEAAPDAQPVARPAG
D4HFG9_CUTAS      -------------------------------
D8DTW4_PREBR      -------------------------------
D9SV73_CLOC7      -------------------------------
B6YQJ7_AZOPC      -------------------------------
E4T255_PALPW      -------------------------------
B9XCJ1_PEDPL      -------------------------------