CLUSTAL format seed alignment for MF_01140

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TAGU_OCEIH            ------MVSRTERKQHK-KRRKWPFWLGGILLVLLLLISGGIFLIYNQVGAVVDTMHSPL
A0A1G9REL6_9BACI      MKKWGFFVARQAHKKKRGKRWRWLVWLGGVLLVVMIAAAGYGIYLYDKLQDTVKEIHEPL
TAGU_ALKHC            -------------------MKKALIAIGLILGTITVAIIGYGIYLYSSIQNTAGEMHEPL
I3EBB5_BACMM          -------MRVEKRKKKKKKKRTWLRITGAVLLLLIFGAGAYGYSVYKSFTNAVEAMHHPI
A0A0Q3WVF9_9BACI      -------MRADKYKKRKKK-RTWLKAVGIILLLLLIGGGVFAYNIYHSMRAAVDTMHKPV
TAGU_BACAN            ------------------MKKKILFWVLGILGVLIIGGGIYAYNVYSSVSNTLKEVHQPL
TAGU_BACCR            ------------------MKKKILFWILGIIGILIIGGGAYAYSIYSSVSKTLDEVHKPL
D5DY91_BACMQ          --MNMEESQTRKRKRRKPKKKRAFKIIMGIIVLLILGVGAYAYSVWHSVEKTFTQTHEPL
TAGU_BACSU            -----------MRNERRKKKKTLLLTILTIIGLLVLGTGGYAYYLWHKAASTVASIHESI
S4DMF6_ENTFL          --------MAKRTRKSR--GKKIFLIILGIVIVLVLAIVGVGTKLYLDLSNSIKETYQTV
Q3XYS8_ENTFD          --------MARRRRKSR--GKKIFLIILAVLIVLVLAIVGVGAKLYLDLSHSIEKTYESV
TAGU_ENTFA            --------------MSK--GKKIFAIIFGIILVLFLAVVGMGAKLYWDVSKSMDKTYETV
G4L592_TETHN          --------MAKRSHKKTSGGKKVLRIVLIVLLILVLAIVGAVAKLYFDVSGSVDRTYESV
                                                   ::  : .        :: .        : .:

TAGU_OCEIH            S---------------RDSDPDRQK---EINQLYKEKDAVNILLLGVDER---DGDLGRS
A0A1G9REL6_9BACI      NDEQQSEETESNGQTANDQNAERQSSYSDGTDIDDKQKTLNFLLLGVDER---SNDQGRS
TAGU_ALKHC            D---------------RGDKSDKRD---VAFDI-SAQDPFSILIAGVDSRE--DTHAGRS
I3EBB5_BACMM          DRK-------------TSEKRKEQV-------ALEKKQPFSVLMLGVDER---KGDRGRS
A0A0Q3WVF9_9BACI      KSK-------------NS--RAGEL-------NFGKEQPFSVLLLGVDQR---KGDVGRS
TAGU_BACAN            KRD-------------QNNSNVGE--------KVSKSEPVSILLLGADER---GEDKGRS
TAGU_BACCR            KRD-------------KDSKGTEEV-------KISKSEPVSILLLGVDER---GNEKGRS
D5DY91_BACMQ          KRD-------------VSEKRSEKV-------SFSDKDPISILLLGVDQR---AGDRGRS
TAGU_BACSU            D---------------KSKKRDKEV-------SINKKDPFSVLIMGVDER---DGDKGRA
S4DMF6_ENTFL          ERTE--------------GPRTTPV-------DLAKQESFSVLLMGIDTGDLERVDQGRS
Q3XYS8_ENTFD          ERTQ--------------GERTKPV-------DLDKQESFSVLLMGIDTGDLGRVDQGRS
TAGU_ENTFA            ERS-----------------KKSQV-------NLNNKEPFSVLLLGIDTGDDGRVEQGRS
G4L592_TETHN          DRD-----------------NGRDV-------NFSDEEPFSVLLLGIDTGDLGRTEQGRS
                      .                                   ......*: * *       . **:

TAGU_OCEIH            DTMILLSINPNTDKMIMLSIPRDTYVNIPGRG-MDKINHAYPFGIVDGVGGPDLSVQTVE
A0A1G9REL6_9BACI      DTMILVSANPNTNSMLMMSIPRDMYTDIPGKG-MDKINHAYAF------GGTSLAVKTVK
TAGU_ALKHC            DTLIVLTVNPKEESIKMLSIPRDTRTEIVGRGTDDKINHAYAF------GGAQMTIDTVE
I3EBB5_BACMM          DTIIVLTVNPNKNSVKMLSIPRDTRTEIVGKGTEDKINHAYAF------GGVEMSIATVE
A0A0Q3WVF9_9BACI      DTMIVMTVNPNKESVEMLSIPRDTRVEIVGRGTQDKINAAYAY------GGVKMSMDTVQ
TAGU_BACAN            DSLMVITLNPKNNSMKTVSIPRDTYTEIVGKGKSDKINHAYAF------GGVDMSVATVE
TAGU_BACCR            DSLILITLNPKNNSMKTVSIPRDTYTEIVGKGKSDKINHAYAF------GGVDMSVATVE
D5DY91_BACMQ          DSLILMTVNPKDQSMKMVSIPRDTRTEIVGKGTTDKINHAYAF------GGVDMAVNTVE
TAGU_BACSU            DTLIYMTVNPKTNTTDMVSIPRDTYTKIIGKGTMDKINHSYAF------GGTQMTVDTVE
S4DMF6_ENTFL          DTMMVATVSPEDKQTTIVSIPRDTYVDIVGHDTTDKINHAYAF------GGAAMAMDTVQ
Q3XYS8_ENTFD          DTMMVATVSPEDKQTTIVSIPRDTYVDIVGHDTKDKINHSYAF------GGAAMAMDTVQ
TAGU_ENTFA            DTTIVATVNPRDKQTTLVSLARDTYVDIPGQGKQDKLNHAYAF------GGASLAMDTVE
G4L592_TETHN          DTMMVATVDPQENKSTLVSIPRDTYVDIVGHDTQDKINHAYAF------GKAPMSMDTVS
                      *: :  : .*. .    :*:.**  ..* *:.  **:* :*.:      *   ::: **.

TAGU_OCEIH            ETFNLSIHSYIRVNMEGFQQGIDAVGGVTVNNAQAFSTGGYNFDQGQITLD-GKQALEFI
A0A1G9REL6_9BACI      QTFDVPIDFYIKVNMEGFRDGIDALNGVTVENSFAFTQDGKTFPEGEINLN-GEEALAYT
TAGU_ALKHC            NFLDIPIDHYVSINMDGFTQLVDALGGVSVENSFAFSQNGYQFEEGEIFLETGDEALAYA
I3EBB5_BACMM          NFLDIPIDYYMQINMEGFKDILDAVGGVTVNNDLDFTYEGVHFPKGEITLN-GEKALKFS
A0A0Q3WVF9_9BACI      NFLDIPIDYYIKVNMEGFSEIVDALGGVTVNNNLDFSYGGYHFPKGQIDLN-GKKAINYV
TAGU_BACAN            NFLNVPINYYIEVNMEGFKDIVDAVGGVDVKNDLEFTQDGHHFAKGNIHLT-GDQALAFT
TAGU_BACCR            KFLNVPINYYIEVNMAGFKDIVDAVGGVDVNNDLEFKQDKHHFAKGNIHLT-GDEALSFT
D5DY91_BACMQ          KFLDVPVDYYVQVNMESFKDIVDAVGGVTVNNDLDFNYDGYSFKKGKLTLD-GKEALAYS
TAGU_BACSU            NFLDVPVDYFVKVNMESFRDVVDTLGGITVNSTFAFSYDGYSFGKGEITLN-GKEALAYT
S4DMF6_ENTFL          NYLDIPIDHYVSINMKGLKELVDAVGGIEVNNDITFSQDGYDFTIGKIKLD-GDQALAYS
Q3XYS8_ENTFD          KYVDIPIDHYVSINMKGLKELVDAVGGIEVNNDFTFSQDGYDFPIGKITLN-GDQALSYS
TAGU_ENTFA            NYLNIPINHYVSINMAGLKELVNAVGGIEVNNNLTFSQDGYDFTIGKISLD-GEQALSYS
G4L592_TETHN          EFLDIPIDHYVSINMEGIKELVDAVDGVDVNNDLAFEQDGHTYNFGKIHMN-GEEALGYL
                      : .::.:. :: :** .: : ::::.*: *:.   *      :  *:: :  *.:*: : 

TAGU_OCEIH            RMRKQDSRGDLGRNDRQRQVIQAAMNEAASFSSITKAGEILDILGNNVQTDLDMDKLQTL
A0A1G9REL6_9BACI      RMRKKDPQGDLGRNERQRQVIQAALDQAANFSNFTKIGRILDIVGGNVRTNMKLENMRNV
TAGU_ALKHC            RMRKQDSRGDFGRNDRQRQIVEAVIKQSAQFSSITKAGAILDAVGESVRTDLQLDGMWEL
I3EBB5_BACMM          RMRYDDPRGDYGRQLRQREIIQAVIKEGASLSTLTNYDEIFKALGSNVKTNLTFDEMVQI
A0A0Q3WVF9_9BACI      RMRKQDPRGDFGREERQRAVIQGIIDKGASFSSLTHFSDVFQALGKNIETNLSFDDMVSI
TAGU_BACAN            RMRKQDPRGDFGRQMRQRQVMQGVIKKGASFSSLTGYGDVLSAIQKNVKTNLTQDQMFDM
TAGU_BACCR            RMRYEDPRGDFGRQMRQRQVMQAVIKKGATFSSLTSYGDVLTAIQKNVKTNLTQDQMFDM
D5DY91_BACMQ          RMRKEDPRGDFGRQLRQRQIIEGVIEEGASVQSLANYGNILDAIGTNVRTNLTFDDMKQI
TAGU_BACSU            RMRKEDPRGDFGRQDRQRQVIQGIINKGANISSITKFGDMFKVVENNVKTNLTFDNMWDI
S4DMF6_ENTFL          RMRYEDPNGDYGRQERQRKIVEGIARKVLSLNGVSNYQSVLNALETNMRTDMSFTDMRKI
Q3XYS8_ENTFD          RMRYEDPNGDYGRQGRQRKIVEGIAKKVLSLNGVSNYQSILNALESNMKTDMSFDEMKKI
TAGU_ENTFA            RMRYEDPNGDYGRQERQRKVIEGIVQKVLSLNSVSNYQEILTAVSDNMKTDLSFDDMKKI
G4L592_TETHN          RMRHEDPEGDYGRQKRQRKVVEAVIDKSLSLSGATQYRSILDAMEDNMKTDLSFGDMRSI
                      *** .*..** **: *** :::.   :   ..  :    ::  :  .:.*::    :  :

TAGU_OCEIH            LTNYAGARNNITTMEIEGHGETI-NGIWYYIVSDEEINRVNSEITGHMQEQ--
A0A1G9REL6_9BACI      YSHYRQTRKTIHSLQIDGSGKILEDGIWYYMVTKEELARLHTELEAHMEAR--
TAGU_ALKHC            QSNYRGAAKNIEQLEITGEGTRI-NNIYYLIIPQEEIARVQGELKSHLELS--
I3EBB5_BACMM          QKNYKTAGNHIEQMTIKGNGTR-INGVFYLIVSDKEKQRVQSELKKHLELN--
A0A0Q3WVF9_9BACI      QKNYRNARKNIEKFQLQGQGQM-INKIYYFVVPESERQKAHDRLKTHLEL---
TAGU_BACAN            QKNYKDCLKNSEDIQIPGDGHKAADGIWYYYVPDAAKQDLTNKLRTHLEVTK-
TAGU_BACCR            QKNYKNCLENSEDIQIPGDGHKAADGIWYYYVPEAAKQDLTNKLRAHLEVTK-
D5DY91_BACMQ          QSNYKDARHNVEQLQVDGQGEK-INGIYYYAVSDATRQELSAKLKDHLNVK--
TAGU_BACSU            QSDYKGARKHIKQHELKGTGTK-INGIYYYQADESALSDITKELKESLEK---
S4DMF6_ENTFL          ALDYRDAFGTIKQDQMQGEGFM-QDGISYQRVSDQELERVQKELKDQLNLENK
Q3XYS8_ENTFD          ALDYREAFGTIKQDQLQGEGFM-QDNISYQKVSDQELDRVKKELKDQMNLENK
TAGU_ENTFA            ALDYRSAFGKVKQDQLQGTGFM-QDGVSYQRVDEQELTRVQQELKNQLNTK--
G4L592_TETHN          ALDYRGAFSNIDQLQLQGEGFN-QDGVSYQRVDENELKEVQDNLQEQLDQ---
                        .*           : * *    : : *    .        .:   ::