CLUSTAL format seed alignment for MF_01145

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PRSA1_LISIN      ---MTKLKKVMISLVAATLLLLAGCG----SSA---VVKTDAGNVTQD------------
PRSA1_LISMO      ---MTKLKKVMISVIAATLLLLAGCG----SSA---VIKTDAGSVTQD------------
PRSA2_LISIN      ----MKKKLILGLVMMMALFSLAACG----GGGN--VVKTDSGDVTQD------------
PRSA2_LISMO      ----MKKKLILGLVMMMALFSLAACG----GGGD--VVKTDSGDVTKD------------
PRSA_BACSU       -----MKKIAIAAITATSILALSACS----SGDKEVIAKTDAGDVTKG------------
PRSA1_BACAN      -----MKKAMLALAATSV-IALSACGT---S-SSDKIVTSKAGDITKD------------
PRSA1_BACCR      -----MKKAMLALAATSV-IALSACGT---S-SSDKIVTSKAGDITKE------------
PRSA2_BACAN      ---MRGKHIFIITALISI-LMLAACGQ---KNSSATVATATDSTITKS------------
PRSA2_BACCR      ---MRGKHIFIITALISI-LMLSACGQ---KNGSATVATATDSTITKD------------
PRSA3_BACAN      ---MKKKKLFLGTIISCVVLALSACG------SSDNVVTSKVGNITEK------------
PRSA3_BACCR      ---MKKKKIFIGTIISCVMLALSACG------SSDNVVTSKVGNVTEK------------
PRSA4_BACCR      ---MKRKKLVIGSILMGMTLSLSACG------SSDNIVTTKSGSISES------------
PRSA_STAAM       ----MKMINKLIVPVTASALLLGACGA---SATDSKENTLISSKAGDV------------
PRSA_STAAN       ----MKMINKLIVPVTASALLLGACGA---SATDSKENTLISSKAGDV------------
PRSA_STAAW       ----MKMINKLIVPVTASALLLGACGA---SATDSKENTLISSKAGDV------------
PRSA_STAES       ----MKLMNKIIVPVTASALLLGACGS---NATESKDNTLISSKAGDV------------
PRSA_CLOAB       ----MKSAKQIATALLVGMFTFSAVGC---SMVEKRPEAINSKVVATIYGNQTITRGEID
PRSA_CLOTE       MKHLKNNTKKFTALLFALLFSMSIAGC---NMIEKTPEAIEKSPVAKV-GKKTITRGELD
PRSA_STRA3       -MKTRSKLAAGFLTLMSVATLAACSGK---TSNGTNVVTMKGDTITVS------------
PRSA_STRA5       -MKTRSKLAAGFLTLMSVATLAACSGK---TSNGTNVVTMKGDTITVS------------
PRSA1_STRP3      -MKNSNKLIASVVTLASVMALAACQS----TNDNTKVISMKGDTISVS------------
PRSA1_STRP1      -MKNSNKLIASVVTLASVMALAACQS----TNDNTKVISMKGDTISVS------------
PRSA1_STRP8      -MKNSNKLIASVVTLASVMALAACQS----TNDNTKVISMKGDTISVS------------
PRSA2_STRP8      -MKQMNKLITGVVTLATVVTLSACQS----SHNNTKLVSMKGDTITVS------------
PRSA2_STRP1      -MKQMNKLITGVVTLATVVTLSACQS----SHNNTKLVSMKGDTITVS------------
PRSA2_STRP3      -MKQMNKLITGVVTLATVVTLSACQS----SHNNTKLVSMKGDTITVS------------
PRSA_STRPN       -MKK--KLLAGAITLLSVATLAACSK----GSEGADLISMKGDVITEH------------
PRSA_STRR6       -MKK--KLLAGAITLLSVATLAACSK----GSEGADLISMKGDVITEH------------
PRSA_ENTFA       -MKK--KLILAAAGAMAVFSLAACSS------GSKDIATMKGSTITVD------------
PRSA_LACLC       -MKKKMRLKVLLASTATALLLLSGCQS---NQTDQTVATYSGGKVTES------------
PRSA_LACPA       -MKKKMRLKVLLASTATALLLLSGCQS---NQADQKVATYSGGKVTES------------
PRSA2_LACJO      -MKRIIKVGALAASSFS-LLFLAGCSS---N--NKEVAQYGDKKISQE------------
PRSA1_LACPL      -MKKW-----LIALAGV---LLTFTLA---GCGSKTVASTSGGKITES------------
PRSA1_LACJO      MNKTWKKAATVLAFAGI---ALSATAC---S-GGKAVVTYKGGKITES------------
PRSA_OCEIH       -----MKKWTIAASLSIGVLALSACN-----SDDEIVAETEAGNITKE------------
PRSA_BACHD       -----MKKRHLLIAGLACMTILGACNNDDAGSSGQAVVEVDGHEISDA------------
PRSA_CALS4       ----MRRKIALFLALIFVGVSLVSCSSKKEAVSGDVVAVVNGEKITNA------------
PRSA_CLOPE       ----MVSVKKIVASALVGVLMFSAVGCNMVEKTQAAIDKTTVATVNGE------KITLGE
PRSA2_LACPL      ----MKYRLIGVGASLVVAVMLTGCQA-----KATTLVKSDAGQVTQA------------
                                                                             

PRSA1_LISIN      ------ELYEAMKTTYG-NEVVQQLTFKKILED-------KYTVTEKEVNAEYKKY----
PRSA1_LISMO      ------ELYEAMKTTYG-NEVVQQLTFKKILED-------KYTVTEKEVNAEYKKY----
PRSA2_LISIN      ------ELYDAMKDKYG-SEFVQQLTFEKILGD-------KYKVSDEDVDKKFKEY----
PRSA2_LISMO      ------ELYDAMKDKYG-SEFVQQLTFEKILGD-------KYKVSDEDVDKKFNEY----
PRSA_BACSU       ------ELYTNMKKTAG-ASVLTQLVQEKVLDK-------KYKVSDKEIDNKLKEY----
PRSA1_BACAN      ------EFYEQMKTQAG-KQVLNNMVMEKVLIK-------NYKVEDKEVDKKYDEM----
PRSA1_BACCR      ------EFYDQMKTQAG-KQVLNNMVMEKVLIK-------NYKVEDKDVDKKFDEM----
PRSA2_BACAN      ------DFEKQLKDRYG-KDMLYEMIAQDVITK-------KYKVSDDDVDKEVQKA----
PRSA2_BACCR      ------NFEKQLKDRYG-KDMLYEMMAQDVITK-------KYKVPDEEVNKEVEKV----
PRSA3_BACAN      ------ELSKELRQKYG-ESTLYQMVLSKALLD-------KYKVSDEEAKKQVEEA----
PRSA3_BACCR      ------ELSKELRQQYG-ESTLYQMMLSKALLD-------KYKVSDEEAKKKVEEA----
PRSA4_BACCR      ------DFNKKLKENYG-KQNLSEMVVEKVLHD-------KYKVTDEEVTKQLEEL----
PRSA_STAAM       -------TVADTMKKIG-KDQIANASFTEMLNKI-LADKYKNKVNDKKIDEQIEKM----
PRSA_STAAN       -------TVADTMKKIG-KDQIANASFTEMLNKI-LADKYKNKVNDKKIDEQIEKM----
PRSA_STAAW       -------TVADTMKKIG-KDQIANASFTEMLNKI-LADKYKNKVNDKKIDEQIEKM----
PRSA_STAES       -------KVADVMKKMG-KEQIANTSFSIVLNKV-LADKYKDKVDTKDIDKDIKKE----
PRSA_CLOAB       K--LAKGTVEQLKSQYG-DSYEKNEEAVAALKKQ-KEQILTSLIDQKIFLKKAKDQKITL
PRSA_CLOTE       TYPILAEQLTKLKEQFG-GDLSKNAEIKDQLIQF-KSQVLEQMIQEEIVFEKSEELKVDN
PRSA_STRA3       ------DFYDQVKTSKAAQQSMLTLILSRVFDT-----QYGDKVSDKKVSEAYNKTAKG-
PRSA_STRA5       ------DFYDQVKTSKAAQQSMLTLILSRVFDT-----QYGDKVSDKKVSEAYNKTAKG-
PRSA1_STRP3      ------DFYNETKNTEVSQKAMLNLVISRVFEA-----QYGDKVSKKEVEKAYHKTAEQ-
PRSA1_STRP1      ------DFYNETKNTEVSQKAMLNLVISRVFEA-----QYGDKVSKKEVEKAYHKTAEQ-
PRSA1_STRP8      ------DFYNETKNTEVSQKAMLNLVISRVFEA-----QYGDKVSKKEVEKAYHKTAEQ-
PRSA2_STRP8      ------DFYNETKNTELAQKAMLSLVISRVFET-----QYANKVSDKEVEKAYKQTADQ-
PRSA2_STRP1      ------DFYNETKNTELAQKAMLSLVISRVFET-----QYANKVSDKEVEKAYKQTADQ-
PRSA2_STRP3      ------DFYNETKNTELAQKAMLSLVISRVFET-----QYANKVSDKEVEKAYKQTADQ-
PRSA_STRPN       ------QFYEQVKSNPSAQQVLLNMTIQKVFEK-----QYGSELDDKEVDDTIAEEKKQ-
PRSA_STRR6       ------QFYEQVKNNPSAQQVLLNMTIQKVFEK-----QYGSELDDKEVDDTIAEEKKQ-
PRSA_ENTFA       ------DFYNQIKEQSTSQQAFSQMVIYKVFEE-----KYGDKVTDKDIQKNFDEAKEQV
PRSA_LACLC       ------SLYKELKQSPTTKTMLANMLIYRALNH-----AYGKSVSTKTVNDAYDSYKQQ-
PRSA_LACPA       ------NFYKELKQSPTTKTMLANMLIYRALNH-----AYGKSVSTKTVNDAYDSYKQQ-
PRSA2_LACJO      ------QFYQELNSSPTSKTILANMLIYGALKE-----AYGSKLNKDQVEADYNSYKKR-
PRSA1_LACPL      ------QYYSSMKGTSSGKQVLQQMILNKVLEK-----DYGSKVSTKQVTKQYNTYKSQ-
PRSA1_LACJO      ------QYYDKMKESQAGQSTLASMIVSDALES-----QYGKDVTQKQVDKEYNKYKKQ-
PRSA_OCEIH       ------EFYEELKDVNG-ESTLQQLVTVKVLED-------NYEVTDEELEEEISTMKEGF
PRSA_BACHD       ------EFVDMLKERYG-EAILQELVQRHLISQ----AADSVEIPQEEIDEELETFKSQI
PRSA_CALS4       ---EYQQIFEQVKEQIESAPTYTKDIWNQDYQGKKFLDFVKENVLDSLVAQKLLVQEAK-
PRSA_CLOPE       VDSHLKGVFAQMKSQYGDKYMDDPQVAQQILQQR--QSVVQGLVTDKVLGIEADKLGIKP
PRSA2_LACPL      ------EVFKQIENQATTQQAVQELTLNKVLNQ-------RYHVSQAEVTAKLKAFKRQ-
                                                            :                

PRSA1_LISIN      ------------------EEQYGDSFESTLSSNNLT----KTSFKENLEYNLLVQKA---
PRSA1_LISMO      ------------------EEQYGDSFESTLSSNNLT----KTSFKENLEYNLLVQKA---
PRSA2_LISIN      ------------------KSQYGDQFSAVLAQSGLT----EKSFKSQLKYNLLVQKA---
PRSA2_LISMO      ------------------KSQYGDQFSAVLTQSGLT----EKSFKSQLKYNLLVQKA---
PRSA_BACSU       ------------------KTQLGDQYTALEKQYG------KDYLKEQVKYELLTQKA---
PRSA1_BACAN      ------------------KKQYGDQFDTLLKQQGIK----EETLKTGVRAQLAQEKA---
PRSA1_BACCR      ------------------KKQYGDQFDTLLKQQGIK----EETIKTGVRAQLAQEKA---
PRSA2_BACAN      ------------------KSQYGDQFKNVLKNNGLKD---EADFKNQIKFKLSMNKA---
PRSA2_BACCR      ------------------KKQYGDQFKKVLENYGLKD---EEDFKNQIKFKLAMNEA---
PRSA3_BACAN      ------------------KDKMGDNFKSTLEQVGLKN---EDELKEKMKPEIAFEKA---
PRSA3_BACCR      ------------------KDKMGENFKSTLEQLGLKN---EDELKEKMKPEIAFEKA---
PRSA4_BACCR      ------------------KDKMGDNFNTYMESNGVKN---EDQLKEKLKLTFAFEKA---
PRSA_STAAM       ----------------QKQYGGKDKFEKALQQQGLT----ADKYKENLRTAAYHKEL---
PRSA_STAAN       ----------------QKQYGGKDKFEKALQQQGLT----ADKYKENLRTAAYHKEL---
PRSA_STAAW       ----------------QKQYGGKDKFEKALQQQGLT----ADKYKENLRTAAYHKEL---
PRSA_STAES       ----------------EKQYGGKDQFESMLKQQGMS----FDDYKEQKKLSAYQKQL---
PRSA_CLOAB       TKDEIKTNVDDVYAQYQQEFKTESEFKSQLSQYGYT----VAEFKDQLKNRAISNKLIQQ
PRSA_CLOTE       AKVEKEVEKNLKNFMDQGFQGNKDKYKEDLKKMGTT----EESIKRFFKAQVITEEVSKQ
PRSA_STRA3       ---------------------YGNSFSSALSQAGLT----PEGYKQQIRTTMLVEYA---
PRSA_STRA5       ---------------------YGNSFSSALSQAGLT----PEGYKQQIRTTMLVEYA---
PRSA1_STRP3      ---------------------YGASFSAALAQSSLT----PETFKRQIRSSKLVEYA---
PRSA1_STRP1      ---------------------YGASFSAALAQSSLT----PETFKRQIRSSKLVEYA---
PRSA1_STRP8      ---------------------YGASFSAALAQSSLT----PETFKRQIRSSKLVEYA---
PRSA2_STRP8      ---------------------YGTSFKTVLAQSGLT----PETYKKQIRLTKLVEYA---
PRSA2_STRP1      ---------------------YGTSFKTVLAQSGLT----PETYKKQIRLTKLVEYA---
PRSA2_STRP3      ---------------------YGTSFKTVLAQSGLT----PETYKKQIRLTKLVEYA---
PRSA_STRPN       ---------------------YGENYQRVLSQAGMT----LETRKAQIRTSKLVELA---
PRSA_STRR6       ---------------------YGENYQRVLSQAGMT----LETRKAQIRTSKLVELA---
PRSA_ENTFA       -------------------EAQGGKFSDALKQAGLT----EKTFKKQLKQRAAYDAG---
PRSA_LACLC       ---------------------YGENFDAFLSQNGFS----RSSFKESLRTNFLSEVA---
PRSA_LACPA       ---------------------YGENFDAFLSQNGFS----RSSFKESLRTNFLSEVA---
PRSA2_LACJO      ---------------------YGSQFDSFLKENSYT----KKSFKQMIELNHLSKIA---
PRSA1_LACPL      ---------------------YGSSFSTVLSQNGLT----TKTFKEQLRSNLLLKEA---
PRSA1_LACJO      ---------------------YGSQFDSVLEQNGMT----ASTFKDNLKTNLLTEAA---
PRSA_OCEIH       P--------------------SEEDFNTTVEQQFGG----EEQLREIMYVSMLQEKA---
PRSA_BACHD       G-----------------VETDDEMLDALSNQFGITVENKEEFVNEYILPPLVLEKL---
PRSA_CALS4       ------------------KKNITVTDKEVEEEYNKEKQFNSKVTKEQIREYLLIDKL---
PRSA_CLOPE       S--EEEIKKKVDEQFENIKKGMGDNFDKALEAEGYT----EDTFKDVIKNQVINQAVQDY
PRSA2_LACPL      ---------------------AGANYHMILERNHVT----EPRLKSQIKANLLMEKA---
                                                             .         .     

PRSA1_LISIN      -------TEANMNVS---ESKLKTYYKTWEPNITVRHILVDDEATAKEIQTKLKNGEK--
PRSA1_LISMO      -------TEANMDVS---ESKLKAYYKTWEPDITVRHILVDDEATAKEIQTKLKNGEK--
PRSA2_LISIN      -------TEANADTS---DKALKEYYKTWQPDITVSHILVADENKAKEVEQKLKDGAK--
PRSA2_LISMO      -------TEANTDTS---DKTLKKYYETWQPDITVSHILVADENKAKEVEQKLKDGEK--
PRSA_BACSU       -------AKDNIKVT---DADIKEYWEGLKGKIRASHILVADKKTAEEVEKKLKKGEK--
PRSA1_BACAN      -------IEKTITD--------KELKDNYKPEIKASHILVKDEATAKKVKEELGQGKS--
PRSA1_BACCR      -------IEKTITD--------KELKENYKPEIKASHILVKDEATAKKVKEELGQGKS--
PRSA2_BACAN      -------IKQSVTE--------KDVKDHYKPEIKASHILVSDENEAKEIKKKLDTGAS--
PRSA2_BACCR      -------IKKSITE--------KDVKDHYKPEIKASHILVSDENEAKEIKSKLDAGAS--
PRSA3_BACAN      -------IKATVTE--------KDVKDNYKPEMKVSHILVKDEKTAKEVKEKVNNGED--
PRSA3_BACCR      -------IKATVTD--------KDVKNNYKPEMKVSHILVKDEKTAKEIKEKVNNGED--
PRSA4_BACCR      -------IKATVTE--------KDIKDHYKPKLQVSHILVKDEKTAKEIKEKLNSGED--
PRSA_STAAM       LSDKIKISDSEIKED---SKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPS
PRSA_STAAN       LSDKIKISDSEIKED---SKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPS
PRSA_STAAW       LSDKIKISDSEIKED---SKKASHILIKVKSKKSDKEGLDDKEAKQKAEEIQKEVSKDPS
PRSA_STAES       LLDKVNVSDKEIKEN---SKKASHILIKVKSKSSDKEGLSDKKAKEKAEKIQKEVEKNPN
PRSA_CLOAB       VVKDVKVSDDEAKKY---YDSHKNSYTQSPNTVHLAHILVKTEKEAKAVKARIDKGED--
PRSA_CLOTE       VVKDVKVDDNTAKKH---YEESKYTFTVNKPTFHAQHVLVKTEEEAKKVKARLDKGED--
PRSA_STRA3       -------VKEAAKKE-LTEANYKEAYKNYTPETSVQVIKLDAEDKAKSVLKDVKADG--A
PRSA_STRA5       -------VKEAAKKE-LTEANYKEAYKNYTPETSVQVIKLDAEDKAKSVLKDVKADG--A
PRSA1_STRP3      -------VKEAAKKE-LTTQEYKKAYESYTPTMAVEMITLDNEETAKSVLEELKAEG--A
PRSA1_STRP1      -------VKEAAKKE-LTTQEYKKAYESYTPTMAVEMITLDNEETAKSVLEELKAEG--A
PRSA1_STRP8      -------VKEAAKKE-LTTQEYKKAYESYTPTMAVEMITLDNDETAKSVLEELKAEG--A
PRSA2_STRP8      -------VKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEEDAKAALEAVKAEG--A
PRSA2_STRP1      -------VKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEEDAKAALEAVKAEG--A
PRSA2_STRP3      -------VKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEEDAKAALEAVKAEG--A
PRSA_STRPN       -------VKKVAEAE-LTDEAYKKAFDEYTPDVTAQIIRLNNEDKAKEVLEKAKAEG--A
PRSA_STRR6       -------VKKVAEAE-LTDEAYKKAFDEYTPDVTAQIIRLNNEDKAKEVLEKAKAEG--A
PRSA_ENTFA       -------LKAHLKIT---DEDLKTAWASFHPEVEAQIIQVASEDDAKAVKKEI-TDG--G
PRSA_LACLC       -------LKKLKKVS---ESQLKAAWKTYQPKVTVQHILTSDEDTAKQVISDLAAG---K
PRSA_LACPA       -------LKKLKKVS---ESQLKAVWKTYQPKVTVQHILTSDEDTAKQVISDLAAG---K
PRSA2_LACJO      -------LKKQMKPT---TSQLKEEWKDYQPKITVQHISTTSRDTANTVIEKLNNG---E
PRSA1_LACPL      -------VKDKVKIT---DKALKKQWKSYEPKVTVQHILVAKSATADKVLDALKKDSSQA
PRSA1_LACJO      -------LKHIKKIT---PAQEKKAWKNYQPEVTVQHILVSKKSTAEDVIKQLQDG---G
PRSA_OCEIH       -------AAEDVEIT---EEDLQELYERKNTEIQAQHILLENEEDVAEVQQKIEDGED--
PRSA_BACHD       -------AVEGVEITDEEKQAYFDENRDSLIEVEASHILVEDEETAEEVLDRLEAGDD--
PRSA_CALS4       ----LAEYTKDVKVTDEELKKYYDEHKESFEVMRARHILVADEKTAEDIYQRLMKGED--
PRSA_CLOPE       IIKDVKVTDEDAQKY---YDENKQQFVAKDSGVLTKHLLFENEEEAQKAYDEIQSGKT--
PRSA2_LACPL      -------VSAKYPVT---KAQLKKARAAYMPMTTVQHIATTNEKQAQKIIAELNAGAS--
                                                                             

PRSA1_LISIN      -FADLAKEYSTDTATSTN--GGLLDPFG--PGEMDETFEKAAYALKNKDD---------V
PRSA1_LISMO      -FTDLAKEYSTDTATSTN--GGLLDPFG--PGEMDETFEKAAYALENKDD---------V
PRSA2_LISIN      -FADLAKEYSTDTATKEN--GGQLAPFG--SGKMDPAFEKAAYALKNKGD---------I
PRSA2_LISMO      -FADLAKEYSTDTATKDN--GGQLAPFG--PGKMDPAFEKAAYALKNKGD---------I
PRSA_BACSU       -FEDLAKEYSTDSSAS-K--GGDLGWFAK-EGQMDETFSKAAFKLKT-GE---------V
PRSA1_BACAN      -FEELAKQYSEDTGSKEK--GGDLGFFG--AGKMVKEFEDAAYKLKK-DE---------V
PRSA1_BACCR      -FEELAKQYSEDTGSKEK--GGDLGYFT--AGKMVKEFEDAAYKLKK-DE---------V
PRSA2_BACAN      -FEELAKQESQDLLSKEK--GGDLGYFH--SGAMTPEFETAAYKLKI-GQ---------I
PRSA2_BACCR      -FEELAKQESQDLLSKDK--GGDLGYFN--SGTMAPEFETAAYKLNV-GQ---------I
PRSA3_BACAN      -FAALAKQYSEDTGSKEQ--GGEITGFA--PGQTVKEFEEAAYKLDA-GQ---------V
PRSA3_BACCR      -FAALANQYSEDTGSKEQ--GGEISGFA--PGQTVKEFEEAAYKLDA-GQ---------V
PRSA4_BACCR      -FAALAKQYSEDPGSKEK--GGELSEFG--PGMMVKEFEDAAYKLEV-GQ---------L
PRSA_STAAM       KFGEIAKKESMDTGSAKK--DGELGYVL--KGQTDKDFEKALFKLKD-GE---------V
PRSA_STAAN       KFGEIAKKESMDTGSAKK--DGELGYVL--KGQTDKDFEKALFKLKD-GE---------V
PRSA_STAAW       KFGEIAKKESMDTGSAKK--DGELGYVL--KGQTDKDFEKALFKLKD-GE---------V
PRSA_STAES       KFGEIAKKESMDSSSAKK--DGSLGYVI--KGQMVDSFEKALFKLKE-GE---------V
PRSA_CLOAB       -FATVAKQVSTDGS-KEK--GGDLGDIQENDSNYDKTFMAAALKLND-NQ---------V
PRSA_CLOTE       -IKKIAKELSIDPSAKEN--SGDLGKAP--YSSMVKPFADAIVKLNK-GE---------I
PRSA_STRA3       DFAKIAKEKTTATDKK------VEYKFDSAGTSLPKEVMSAAFKLDKNGVS----DVVST
PRSA_STRA5       DFAKIAKEKTTATDKK------VEYKFDSAGTTLPKEVMSAAFKLDKNGVS----DVVST
PRSA1_STRP3      DFTAIAKEKTTTPEKK------VTYKFDSGATNVPTDVVKAASSLNEGGIS----DVISV
PRSA1_STRP1      DFTAIAKEKTTTPEKK------VTYKFDSGATNVPTDVVKAASSLNEGGIS----DVISV
PRSA1_STRP8      DFTAIAKEKTTTPEKK------VTYKFDSGAINVPTDVVKAASSLNEGGIS----DVISV
PRSA2_STRP8      DFAAIAKEKTTAADKK------TTYTFDSGETTLPAEVVRAASGLKEGNRS----EIITA
PRSA2_STRP1      DFAAIAKEKTTAADKK------TTYTFDSGETTLPAEVVRAASGLKEGNRS----EIITA
PRSA2_STRP3      DFAAIAKEKTIAADKK------TTYTFDSGETTLPAEVVRAASGLKEGNRS----EIITA
PRSA_STRPN       DFAQLAKDNSTDEKTKEN---GGEITFDSASTEVPEQVKKAAFALDVDGVS----DVITA
PRSA_STRR6       DFAQLAKDNSTDEKTKEN---GGEITFDSASTEVPEQVKKAAFALDVDGVS----DVITA
PRSA_ENTFA       DFTKIAKEKSTDTATKKD---GGKIKFDSQATTVPAEVKEAAFKLKDGEVS----EPIAA
PRSA_LACLC       DFAMLAKTDSIDTATKDN--GGKI-SFELNNKTLDATFKDAAYKLKNGD---------YT
PRSA_LACPA       DFATLAKTDSIDTATKDN--GGKI-SFESNNKTLDATFKDAAYKLKNGD---------YT
PRSA2_LACJO      SFASLASKYSVDSLTSSN--GGKLPAFDMQNRRYDSTFKKGAYKLKNDE---------YT
PRSA1_LACPL      NFTKLAKKYSTDTTTKND--GGKLSAFDNTNTSYSSKFLTAAFKLKNGE---------YT
PRSA1_LACJO      DFKKLAKKYSTDTATKND--AGKLPAFDSTDSTLDSSFKTAAFKLKTGE---------IT
PRSA_OCEIH       -FGELAQEYSTDTGSAEN--GGDLGYFS--AGSMVPEFEEAAFSLEAGEI----------
PRSA_BACHD       -FAELASEYSVDPSAEAN--NGDLGFFG--KGDMVPEFEEAAFNMEIDEV----------
PRSA_CALS4       -FAALAKEYSIDTATKDN--GGDLGEFP--HGVMVPEFEEAAFSLKLGEI----------
PRSA_CLOPE       TFNDLFTKYQNNKSENKKPIAENLGVVPAENSGLVQEFVDGLKPLKEGE----------I
PRSA2_LACPL      -FDSQVRKYQNNRQAHTT--AGKLAQFDSYNQTLAPAIVQATAKLRVGHYVTKPVKTVMA
                  :                                   .  .   :               

PRSA1_LISIN      SGIVKSTYGYHLIQLVKKTE----KGTYAKEKANVKAAYIKSQLT-----SENMTAALKK
PRSA1_LISMO      SGIVKSTYGYHLIQLVKKTE----KGTYAKEKANVKAAYIKSQLT-----SENMTAALKK
PRSA2_LISIN      SAPVKTQYGYHIIQMDKPAT----KTTFDKDKKAVKEAYLASQLT-----TENMQKTLKK
PRSA2_LISMO      SAPVKTQYGYHIIQMDKPAT----KTTFEKDKKAVKASYLESQLT-----TENMQKTLKK
PRSA_BACSU       SDPVKTQYGYHIIK--KTEE----RGKYDDMKKELKSEVLEQKLND----NAAVQEAVQK
PRSA1_BACAN      SEPVKSQFGYHIIKVTDIKEP---EKSFEQSKADIKKELVAKKSQDG----EFMNDLMMK
PRSA1_BACCR      SEPVKSQFGYHIIKVTDIKE----QKPFDEVKGDIKKDLVQKKAQDA----AFMNDLMMK
PRSA2_BACAN      SDPVQSPNGYHIIKLTGKKD----LKPYDEVKNSIRKNLEEERTADP----IFGKKLLQS
PRSA2_BACCR      SNPVKSSNGYHVIKLTDKKA----LKPYDEVKDSIRKNLEEERTADP----VFSKKLLQE
PRSA3_BACAN      SEPVKTTYGYHIIKVTDKKE----LKPFDEVKDSIRKDIEQQRLQDTT--GKWKQQVVNE
PRSA3_BACCR      SDPVKTTYGYHIIKVTDKKE----LKPFDEVKDKIRKDIEQQRLQDTT--GKWKQQVVND
PRSA4_BACCR      SEPVKSSFGYHIIKLTDKKE----LKPYEEEKENIRKELEQQRIQDP----QFHQQVTRD
PRSA_STAAM       SEVVKSSFGYHIIKADKPTDF--NSEKQSLKEKLVDQKVQKNPKL--------LTDAYKD
PRSA_STAAN       SEVVKSSFGYHIIKADKPTDF--NSEKQSLKEKLVDQKVQKNPKL--------LTDAYKD
PRSA_STAAW       SEVVKSSFGYHIIKADKPTDF--NSEKQSLKEKLVDQKVQKNPKL--------LTDAYKD
PRSA_STAES       SKVVKTDYGYHIIKADKETDF--NSEKSNIKQKLIEEKVQKKPKL--------LTDAYKE
PRSA_CLOAB       SAPVHTQFGWHVIKCIKKTEY--PVKDFNSVKDDIKQTVLSTK----------QKSVYQK
PRSA_CLOTE       SQPVKSQFGYHVIKLIDKDEV--TFKDFNSVKEQIKKDLLETE----------KRKVFNE
PRSA_STRA3       VDSTTYKTSYYIIKVTDKTE---KKSDWKSYKNRLKEVILKDKTSDR----SFQNKVISK
PRSA_STRA5       VDSTTYKTSYYIIKVTDKTE---KKSDWKSYKNRLKEVILKDKTSDR----AFQNKVISK
PRSA1_STRP3      LDPTSYQKKFYIVKVTKKAE---KKSDWQEYKKRLKAIIIAEKSKDM----NFQNKVIAN
PRSA1_STRP1      LDPTSYQKKFYIVKVTKKAE---KKSDWQEYKKRLKAIIIAEKSKDM----NFQNKVIAN
PRSA1_STRP8      LDPTSYQKKFYIVKVTKKAE---KKSDWQEYKKRLKAIIIAEKSKDM----NFQNKVIAN
PRSA2_STRP8      LDPATSKRTYHIIKVTKKAT---KKADWKAYQKRLKDIIVTGKLKDP----DFQNKVIAK
PRSA2_STRP1      LDPATSKRTYHIIKVTKKAT---KKADWKAYQKRLKDIIVTGKLKDP----DFQNKVIAK
PRSA2_STRP3      LDPATSKRTYHIIKVTKKAT---KKADWKAYQKRLKDIIVTGKLKDP----DFQNKVIAK
PRSA_STRPN       TGTQAYSSQYYIVKLTKKTE---KSSNIDDYKEKLKTVILTQKQNDS----TFVQSIIGK
PRSA_STRR6       TGTQAYSSQYYIVKLTKKTE---KSSNIDDYKEKLKTVILTQKQNDS----TFVQSIIGK
PRSA_ENTFA       TNMQTYQTTYYVVKMTKNKA---KGNDMKPYEKEIKKIAEETKLADQ----TFVSKVISD
PRSA_LACLC       QTPVKVTDGYEVIKMINHPA---KGT-FTSSKKALTASVYAKWSRDS----SIMQRVISQ
PRSA_LACPA       QTPVKVTNGYEVIKMINHPA---KGT-FTSSKKALTASVYAKWSRDS----SIMQRVISQ
PRSA2_LACJO      KEPIKVTNGYEVIKMINHPK---KGN-FADKQKELTEAIYNKWASNS----RIMNNVISQ
PRSA1_LACPL      TSAVKTSNGYEIIRMIKNPG---KGK-MSDHTADLKKQIWDNDMSDS----TVLQNVVSK
PRSA1_LACJO      TTPVKTQYGYHVIKMIKHPA---KGT-FKEHKKQIDNQIYQSMSEDQ----NVMRSVIAT
PRSA_OCEIH       SDPVQSTHGTHIIKVNDVREKEESIGEFEDVKKELEREILLNRVDQT-----QIQEKINK
PRSA_BACHD       SEPVESTYGYHIILVTDRKD------SYEELEEKIHDTLMRERSR-------TQEEVLRD
PRSA_CALS4       SKPVKTQYGYHIIKSEGITV-----KPFDEVKGTIESYLLNDKKN------KVIKEKYDE
PRSA_CLOPE       SKPIKTQFGYHIIQAGATYEKG-AQLPFDEVKSQIIQILKQQKDSEK------FKADMDQ
PRSA2_LACPL      TADTKDKPTYEIINVVSRRSKTAAVTDDSGKQIDVTNYLREKIQQQRMMDKQTQVATIRS
                            ::                     :                         

PRSA1_LISIN      ELKAANIDIKDSDLKDAFADYTSTSSSSSTSTSN--------------------------
PRSA1_LISMO      ELKAANIDIKDSDLKDAFADYTSTSSTSSTTTSN--------------------------
PRSA2_LISIN      EYKDANVKVEDKDLKDAFKDFDGSASKDS--SK---------------------------
PRSA2_LISMO      EYKDANVKVEDKDLKDAFKDFDGSSSSDSDSSK---------------------------
PRSA_BACSU       VMKKADIEVKDKDLKDTFNTSSTSNSTSSSSSNSK-------------------------
PRSA1_BACAN      EIKKADVKVDDKDLKDLFEEKKADAKKEEKK-----------------------------
PRSA1_BACCR      EIKKADVKVDDKDLKDLFEEKKADDKKEEKK-----------------------------
PRSA2_BACAN      ELKKANIKINDSELEDTFTIVSPQGN----------------------------------
PRSA2_BACCR      ELKKANIKINDSDLKDTFTLVSPQGN----------------------------------
PRSA3_BACAN      LLKDADIKVNDKEFKNTFEFLEKK------------------------------------
PRSA3_BACCR      LLKDADIKVNNKEFKDTFKFLEKK------------------------------------
PRSA4_BACCR      LLKNADIKVSDKDLKDTFKELEK-------------------------------------
PRSA_STAAM       LLKEYDVDFKDRDIKSVVEDKILNPEKLKQGGAQGGQ--SGMSQ----------------
PRSA_STAAN       LLKEYDVDFKDRDIKSVVEDKILNPEKLKQGGAQGGQ--SGMSQ----------------
PRSA_STAAW       LLKEYDVDFKDRDIKSVVEDKILNPEKLKQGGAQGGQ--SGMSQ----------------
PRSA_STAES       LLKEYKVDYKDRDIKKAIEDSILDPDKIKQQQQQQSQGGSGLTNSGS-------------
PRSA_CLOAB       TLKKWESQANID--KNEKNLM---------------------------------------
PRSA_CLOTE       KIEQWKKELKVETKKYEKNII---------------------------------------
PRSA_STRA3       ALEKANVKIKDKAFAGILSQYATTSGSSSLKK----------------------------
PRSA_STRA5       ALEKANVKIKDKAFAGILSQYATTSGSSSLKK----------------------------
PRSA1_STRP3      ALDKANVKIKDKAFANILAQYANLGQKTKAASESSTTSESSKAAEENPSESEQTQTSSAE
PRSA1_STRP1      ALDKANVKIKDKAFANILAQYANLGQKTKAASESSTTSESSKAAEENPSESEQTQTSSAE
PRSA1_STRP8      ALDKANVKIKDKAFANILAQYANLGQKTKAASESSTTSESSKAAEENPSESEQTQTSSAE
PRSA2_STRP8      ALDKANVKIKDKAFANILAQFAKPNQKQPAQK----------------------------
PRSA2_STRP1      ALDKANVKIKDKAFANILAQFAKPNQKQPAQK----------------------------
PRSA2_STRP3      ALDKANVKIKDKAFANILAQFAKPNQKQPAQK----------------------------
PRSA_STRPN       ELQAANIKVKDQAFQNIFTQYIGGGDSSSSSSTSNE------------------------
PRSA_STRR6       ELQAANIKVKDQAFQNIFTQYIGGGDSSSSSSTSNE------------------------
PRSA_ENTFA       ELKAANVKIKDDAFKNALAGYMQTESSSASSEKKESKSSDSKTSDTKTSDSEKATDSSSK
PRSA_LACLC       VLKNQHVTIKDKDLADALDSYKKLATTN--------------------------------
PRSA_LACPA       VLKNQHVTIKDKDLADALDSYKKPATTN--------------------------------
PRSA2_LACJO      VLKEQHVSIKDKDLKSALDMYKGSNKANF-------------------------------
PRSA1_LACPL      VLKGGNVSIKDNDLKDILSSYLSTSSSSSSN-----------------------------
PRSA1_LACJO      VLKRADVSIKDKDLKNVLSQYVSSDSLSK-------------------------------
PRSA_OCEIH       LIQDAGVQINVEGMEDLFEAEETEENTTEEDAQG--------------------------
PRSA_BACHD       LLAQADINVLDDQFEGLFDLPDAPPVEDTPEIDGEDASDEAEDQAEDADENAEEEDES--
PRSA_CALS4       LVKASKIQKFPENIKVKVG-----------------------------------------
PRSA_CLOPE       WKKDLNVKVYDDKLQEGLKISK--------------------------------------
PRSA2_LACPL      VFKAAHVKVVDAHFAPAFNDYLTTQNS---------------------------------
                                                                             

PRSA1_LISIN      ---------------
PRSA1_LISMO      ---------------
PRSA2_LISIN      ---------------
PRSA2_LISMO      ---------------
PRSA_BACSU       ---------------
PRSA1_BACAN      ---------------
PRSA1_BACCR      ---------------
PRSA2_BACAN      ---------------
PRSA2_BACCR      ---------------
PRSA3_BACAN      ---------------
PRSA3_BACCR      ---------------
PRSA4_BACCR      ---------------
PRSA_STAAM       ---------------
PRSA_STAAN       ---------------
PRSA_STAAW       ---------------
PRSA_STAES       ---------------
PRSA_CLOAB       ---------------
PRSA_CLOTE       ---------------
PRSA_STRA3       ---------------
PRSA_STRA5       ---------------
PRSA1_STRP3      EPTETEAQTQEPAAQ
PRSA1_STRP1      EPTETEAQTQEPAAQ
PRSA1_STRP8      EPTETEAQTQEPAAQ
PRSA2_STRP8      ---------------
PRSA2_STRP1      ---------------
PRSA2_STRP3      ---------------
PRSA_STRPN       ---------------
PRSA_STRR6       ---------------
PRSA_ENTFA       TTESSSK--------
PRSA_LACLC       ---------------
PRSA_LACPA       ---------------
PRSA2_LACJO      ---------------
PRSA1_LACPL      ---------------
PRSA1_LACJO      ---------------
PRSA_OCEIH       ---------------
PRSA_BACHD       ---------------
PRSA_CALS4       ---------------
PRSA_CLOPE       ---------------
PRSA2_LACPL      ---------------