CLUSTAL format seed alignment for MF_01147

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LGT_THEMA         ------------------------------------------------------MKKILA
LGT_SYNY3         ------------------------------------------------------------
LGT_BACSU         ------------------------------------------------------------
LGT_GEOTN         ------------------------------------------------------------
LGT_STAXY         ------------------------------------------------------------
LGT_STAES         ------------------------------------------------------------
LGT_LACPL         ------------------------------------------------------------
LGT_LACGA         ------------------------------------------------------------
LGT_LACLA         ------------------------------------------------------------
LGT_ENTFA         ------------------------------------------------------------
LGT_CHLAD         ------------------------------------------------------------
LGT_CORGL         ------------------------------------------------------------
LGT_COREF         ------------------------------------------------------------
LGT_MYCTU         ------------------------------------------------------------
LGT2_STRCO        ------------------------------------------------------------
LGT_FRAAA         ------------------------------------------------------------
LGT_BIFLO         ------------------------------------------------------------
E3H1X1_ROTDC      ------------------------------------------------------------
LGT_UREPA         ------------------------------------------------------------
LGT_MYCPE         ------------------------------------------------------------
LGT_MYCPN         ------------------------------------------------------------
LGT_AQUAE         ------------------------------------------------------------
LGT_CLOTE         ------------------------------------------------------------
LGT_THET8         ------------------------------------------------------------
D3PSU2_MEIRD      ------------------------------------------------------------
LGT_DEIRA         ---------------------------------------------------------MPR
LGT_ECOLI         ------------------------------------------------------------
LGT_ESCF3         ------------------------------------------------------------
LGT_VIBVU         ------------------------------------------------------------
LGT_SHEON         ------------------------------------------------------------
LGT_PSEA8         ------------------------------------------------------------
LGT_DESVV         ------------------------------------------------------------
LGT_LEGPA         ------------------------------------------------------------
LGT_XYLFT         ------------------------------------------------------------
LGT_GEOSL         ------------------------------------------------------------
LGT_AZOSB         ------------------------------------------------------------
LGT_CAUVC         ------------------------------------------------------------
LGT_RHOPA         ------------------------------------------------------------
LGT_BUCBP         ------------------------------------------------------------
LGT_HELP2         ------------------------------------------------------------
LGT_HELPY         ------------------------------------------------------------
LGT_HELHP         ------------------------------------------------------------
LGT_CHLTR         ------------------------------------------------------------
LGT_CHLMU         ------------------------------------------------------------
LGT_CALS4         ------------------------------------------------------------
LGT_PARUW         ------------------------------------------------------------
E1QE00_DESB2      ------------------------------------------------------------
LGT_TROWT         ------------------------------------------------------------
LGT_DEHMB         ------------------------------------------------------------
LGT_BORBU         ------------------------------------------------------------
LGT_BACTN         ------------------------------------------------------------
LGT_MYCPU         ------------------------------------------------------------
LGT_RHOBA         MEVARTVRIPHAFDGLTLSRQATMRRTLFLIPHEFAGWPIFGIGWALLFLLIAVLAYVGW
LGT_LEPIN         ------------------------------------------------------------
                                                                              

LGT_THEMA         FLLIAAGSTLFFVFLFIFLSKVFSGEIL-LSRYIFRIGG------FELRWYSTLILMGFL
LGT_SYNY3         -----------------MIEQIFFGQFQSPGPVMFQIGG------FALRWYGFLIASAVI
LGT_BACSU         ----------------------MNEAIEPLNPIAFQLGP------LAVHWYGIIIGLGAL
LGT_GEOTN         ---------------------MMEPAIEPLDRVFLQLGP------ITIYWYGVIIGTGVL
LGT_STAXY         -----------------------MLTLNYIDPIAFELGP------ISVRWYGIIIAAGIL
LGT_STAES         ----------------------MNITLGYIDPVAFSLGP------IQVRWYGIIIACGIL
LGT_LACPL         ----------------------MNTVLGALNPIALRLGP------IQVHWYGVIIASAVV
LGT_LACGA         -------------------------MSLALNPVAFNLGP------IQVKWYGILMATGVL
LGT_LACLA         --------------------MNNLFPFLALNKIALQLGP------LAIHWYAIFIVGGAA
LGT_ENTFA         ------------------------MMLAQVNSIAFRLFG------IPVYWYAIIIVSGIA
LGT_CHLAD         -------------------MVLYPPDDPFLISFTLFGLP------IVVRWYGAIIMTGAL
LGT_CORGL         ---------------------MTLATIPSPPQGVWYLGP------IPIRAYAMCIIAGII
LGT_COREF         ------------------MDVMTLAAIPSPPQGVWYLGP------LPIRAYAMCIIAGII
LGT_MYCTU         -------------------MRMLPSYIPSPPRGVWYLGP------LPVRAYAVCVITGII
LGT2_STRCO        ---------------------MDLAYLPSPSTGVLHLGP------IPLRAYAFCIILGVF
LGT_FRAAA         ---------------------MVFAAIPSPSRGVVHLGP------VPLRAYALMIIIGIV
LGT_BIFLO         ---------------------MNLAYIPSPTFSKFEIGP------FTIHMYAICILIGIC
E3H1X1_ROTDC      ------------------------------------------------------------
LGT_UREPA         -----------MQLEIINPESTLVNDVVAHRVAFSIGSN------FNIYWYGIIFVCGFL
LGT_MYCPE         -----------------MTMNNFTTTMQDISTAFTIGS-------LEIKWYGIFITVGFV
LGT_MYCPN         -------------------MNPSVSSRPPWSTAFYLGPG------FPIQWYGIIVAIGIA
LGT_AQUAE         -----------------------------MFPEVISVFG------LKISLYGILVALGVL
LGT_CLOTE         -----------------------------MKPVLFELFG------LKIYGYGAMIALGIL
LGT_THET8         ---------------------------------MVQIGP------LAIRWYGVLLTLAIF
D3PSU2_MEIRD      -----------------------------MDPILIEIGS------LQIRWYGLFLVLAIF
LGT_DEIRA         RGPFLALFAGCVSRGASRSPPGHTLTRRPMDPVFLQIGN------FTIAWYGVLMMLGIA
LGT_ECOLI         ----------------MTSSYLHFPEFDPVIFSIGPV---------ALHWYGLMYLVGFI
LGT_ESCF3         ----------------MTSSYLHFPEFDPVIFSIGPV---------ALHWYGLMYLVGFI
LGT_VIBVU         ----------------MSQGYLPFPNIDPVFFSIGPI---------SVRWYGLMYLFGFL
LGT_SHEON         -------------------MALNFPNIDPVIVKFGPFDIFGQTFEPALRWYGFTYLVGFV
LGT_PSEA8         --------------------MLTYPQIDPVALAIGPL---------KIHWYGLMYLIGIG
LGT_DESVV         --------------------MLTFPRIDPVAITLGPL---------QFRWYGLMYLFGFL
LGT_LEGPA         --------------------MLTYPNINPIAFSLGPL---------KVHWYGLMYLIGFI
LGT_XYLFT         --------------------MIYLHAIDPIAFSLGPV---------KVHWYGLMYLAGFG
LGT_GEOSL         ---------------------MQFPHIDPVFFRLGHL---------EFRWYGLMYILGFI
LGT_AZOSB         --------------------MLVHPQFDPVAIAVGPV---------AVRWYGLMYLLAFV
LGT_CAUVC         ---------------MIFPNIDPVVHIGPWALQFGPL---------ALRWYALAYVAGIL
LGT_RHOPA         ---------------MPFFAVAFPV-FDPVAVAIGPF---------AIRWYALAYIAGIV
LGT_BUCBP         -------------------MYIHFPQFSPIIFSIFSI---------PIRWYGLMYFLAFI
LGT_HELP2         ----------------MNAWNTIYDQFNPIAFSLGSI---------EVHWYGLAYACAIV
LGT_HELPY         ----------------MNAWNTIYDQFNPIAFSLGSI---------EVHWYGLAYACAIV
LGT_HELHP         -------------METYSVWNRIYDYINPIAFKIFDI---------SVHWYGIMYVSAML
LGT_CHLTR         ---------------------MIHWDQSRTLLSFPRVGL-------HLSWYGILFSLGIF
LGT_CHLMU         ---------------------MIHWEQSRTLLSFPQVGL-------HLSWYGIFFSLGIF
LGT_CALS4         ------------------------MDIPSLSPYAFKFGP------IAVHWYGIFMAISIA
LGT_PARUW         -------------MLTEHWLAWLYWNPPREAFTLPFIDH-------PVMWYGICFITGFI
E1QE00_DESB2      -----------------------------MRPILLQLGP------ITLYGYGLMVALGTA
LGT_TROWT         ----------------------MHFYIPPPPISGFWLGP------LYVHMYSVFMLAGAL
LGT_DEHMB         ---------------------MFEINVDPVAFSIGSL---------VVKWYGIMMALGVV
LGT_BORBU         --------------------MPNYINYPSWLHPEVIQGI-------PITWYSLSYILIIL
LGT_BACTN         -----------------MNTLLLSINWNPNPELFNLFGI-------SIRYYGLLWAVGIF
LGT_MYCPU         --------------------MTSNFFPYKEGTATFLIDP-------YVRVYPIAILMGMI
LGT_RHOBA         ESRRGGLGASTAIRQIAGFAVMAAVILVVVVPRTELVNTLGDPVGVAVRGYGMFLMLAAI
LGT_LEPIN         -----------------MIDRIPVPFLNPLFKFLFNREWD------GPSTFSILMMIGFL
                                                                              

LGT_THEMA         ISYFVARKRAKNEGINL-------------------------------------------
LGT_SYNY3         IGLNLCQWLGQKRGINP-------------------------------------------
LGT_BACSU         LGLWIAMRESEKRGLQK-------------------------------------------
LGT_GEOTN         IGLWLATRESVRRGLPK-------------------------------------------
LGT_STAXY         LGYFIAQASVKKIGYDQ-------------------------------------------
LGT_STAES         LGYFIAQAALKQVGLHK-------------------------------------------
LGT_LACPL         IAVALAVREGQRRGVRP-------------------------------------------
LGT_LACGA         VATLMAINEGKKRQIMP-------------------------------------------
LGT_LACLA         LAVWLACKEAPKRNIKT-------------------------------------------
LGT_ENTFA         LAVWLSSREAVRVGLKE-------------------------------------------
LGT_CHLAD         IAALLASRRAVARGYHP-------------------------------------------
LGT_CORGL         VAIWLTRKRYAARGGNP-------------------------------------------
LGT_COREF         VAIWLTRKRYAARGGNP-------------------------------------------
LGT_MYCTU         VALLIGDRRLTARGGER-------------------------------------------
LGT2_STRCO        AAVWLGNRRWVARGGKQ-------------------------------------------
LGT_FRAAA         VAVVVTGRRLRARGMDP-------------------------------------------
LGT_BIFLO         VAVWILATRWKRYGGTF-------------------------------------------
E3H1X1_ROTDC      MCLWLSARRWAQVGGTR-------------------------------------------
LGT_UREPA         IAILTYSLRLKFHYKVPY------------------------------------------
LGT_MYCPE         LAIILACVKLEKWYKISC------------------------------------------
LGT_MYCPN         FGILMFVLKLIYFYKIQD------------------------------------------
LGT_AQUAE         VGYFLVLKLAKREGLNT-------------------------------------------
LGT_CLOTE         AAVILLDKRSKKRGYNE-------------------------------------------
LGT_THET8         LGYELARRRLRAWGWDL-------------------------------------------
D3PSU2_MEIRD      ASFEIAKRILKQWGYNP-------------------------------------------
LGT_DEIRA         AGYWLGLKLARERGLNA-------------------------------------------
LGT_ECOLI         FAMWLATRRANRPGS---------------------------------------------
LGT_ESCF3         FAMWLATRRANRPGS---------------------------------------------
LGT_VIBVU         FAMWLANRRADKPGS---------------------------------------------
LGT_SHEON         AAMWLLNRQADRSNG---------------------------------------------
LGT_PSEA8         GAWLLASRRMKRFDP---------------------------------------------
LGT_DESVV         SGWWLGRRRAAQPGS---------------------------------------------
LGT_LEGPA         GAWLLGYWRIKHYKL---------------------------------------------
LGT_XYLFT         AAWCLGRQRIQAGRLL--------------------------------------------
LGT_GEOSL         AAYFIVRRAAGRRGL---------------------------------------------
LGT_AZOSB         LFVVLGRAHARRRPEL--------------------------------------------
LGT_CAUVC         LGWRYALRLTRTASVWGAR-----------------------------------------
LGT_RHOPA         IGWLYARMLLQRQRLWGGP-----------------------------------------
LGT_BUCBP         FALWRGKTRAEYYNL---------------------------------------------
LGT_HELP2         VAFYMALRMIQKDPKR--------------------------------------------
LGT_HELPY         TAFYMALRMIQKDPKR--------------------------------------------
LGT_HELHP         IALLIAKAFITYRNER--------------------------------------------
LGT_CHLTR         LSSFSGIKLATALCKD-RE-----------------------------------------
LGT_CHLMU         LSSFAGIRLATVLCKD-PN-----------------------------------------
LGT_CALS4         VGGYYLYKQATKLNYDE-------------------------------------------
LGT_PARUW         LGYFIIVPIIALFVNQSKHLSSMDIQDWRSLVNQLKTSSSPLIQKCQNALNRQERQKLNS
E1QE00_DESB2      VAMWVGVRFVRRDGLDL-------------------------------------------
LGT_TROWT         VLFELTNRRFIVLTGNR-------------------------------------------
LGT_DEHMB         ALVSWIFWRIKRGANISY------------------------------------------
LGT_BORBU         ISYKFIWYQIQSDNVDIK------------------------------------------
LGT_BACTN         FAYIIVHYQFRDKKIDE-------------------------------------------
LGT_MYCPU         ISILTVAFFWRKEKFNF-------------------------------------------
LGT_RHOBA         ASVGLAAWRAERAGLGA-------------------------------------------
LGT_LEPIN         TASYLLPKELKRRKLEP-------------------------------------------
                                                                              

LGT_THEMA         -------------------------------------------------EEFDELIFYGV
LGT_SYNY3         -------------------------------------------------DLFNDLVIWLV
LGT_BACSU         -------------------------------------------------DTFIDLVLFAI
LGT_GEOTN         -------------------------------------------------ETFVDLVLFAV
LGT_STAXY         -------------------------------------------------DTLVDIIFWSA
LGT_STAES         -------------------------------------------------DTLIDIIFYSA
LGT_LACPL         -------------------------------------------------DDIYDMILWAL
LGT_LACGA         -------------------------------------------------DDFIDFLLWAV
LGT_LACLA         -------------------------------------------------DDIIDFVLFAF
LGT_ENTFA         -------------------------------------------------DDVFDFMLWGL
LGT_CHLAD         -------------------------------------------------DHVWNQLMLGL
LGT_CORGL         -------------------------------------------------EIVLDAAIVAV
LGT_COREF         -------------------------------------------------EVVLDAAIVAV
LGT_MYCTU         -------------------------------------------------GMTYDIALWAV
LGT2_STRCO        -------------------------------------------------GVIADVTLWAV
LGT_FRAAA         -------------------------------------------------ALAGEIAYWAV
LGT_BIFLO         -------------------------------------------------DQILDTTLVTV
E3H1X1_ROTDC      -------------------------------------------------ERVYDVAMWAI
LGT_UREPA         -------------------------------------------------DPGFYYIFLAI
LGT_MYCPE         -------------------------------------------------NPFYWFVFIGI
LGT_MYCPN         -------------------------------------------------NSFYFFIFIAV
LGT_AQUAE         -------------------------------------------------KAVENTFMIAV
LGT_CLOTE         -------------------------------------------------DHIFNMAIVGI
LGT_THET8         -------------------------------------------------EPFERVVFWAV
D3PSU2_MEIRD      -------------------------------------------------EQFEQIAFWAV
LGT_DEIRA         -------------------------------------------------DLFERMILWML
LGT_ECOLI         ---------------------------------------------GWTKNEVENLLYAGF
LGT_ESCF3         ---------------------------------------------GWTKNEVENLLYAGF
LGT_VIBVU         ---------------------------------------------GWTREQVSDLLFAGF
LGT_SHEON         ---------------------------------------------LWSREQVSDLLFYGF
LGT_PSEA8         ---------------------------------------------TWTKERLSDLVFWVA
LGT_DESVV         ---------------------------------------------RWTGEMVDDMVTYVI
LGT_LEGPA         ---------------------------------------------NWNNDQLSDLIFYSA
LGT_XYLFT         ---------------------------------------------GVNIDGFSDLLFYAM
LGT_GEOSL         ---------------------------------------------ALTQDDVADVIFSLA
LGT_AZOSB         ---------------------------------------------GWNAQAIDDLLLYGV
LGT_CAUVC         -------------------------------------------TPTATALQIDDLVLWIT
LGT_RHOPA         -------------------------------------------SP-ISLEAFDDFILWVT
LGT_BUCBP         -----------------------------------------------TQIEVENLLYSCF
LGT_HELP2         --------------------------------------------FPIERKEFESYFLWAE
LGT_HELPY         --------------------------------------------FPIERKEFESYFLWAE
LGT_HELHP         --------------------------------------------FPITQELLDSFFIWVE
LGT_CHLTR         -------------------------------------------EKKELRTSLENFALGAL
LGT_CHLMU         -------------------------------------------MRKELKTGLENFALGAL
LGT_CALS4         -------------------------------------------------DFLLNLLMIVV
LGT_PARUW         EIQPLNISSDLKNALLIKLNTILKENSIQRKDLEQAFQGAITSAKQISYFLADRLCWFIV
E1QE00_DESB2      -------------------------------------------------DACVNVGVATA
LGT_TROWT         -------------------------------------------------EFTAFAVTSLL
LGT_DEHMB         -------------------------------------------------DTVLTAAIIAI
LGT_BORBU         ------------------------------------------------KEDYEIFMFSLV
LGT_BACTN         -------------------------------------------------KKFDPLFFYCF
LGT_MYCPU         -------------------------------------------------DHFFALLFIII
LGT_RHOBA         -------------------------------------------------DSILQLAPWTF
LGT_LEPIN         -------------------------------------------------EHSDWLLLLGI
                                                                              

LGT_THEMA         IAGIVGARLYYVLFN--------LKYYRSLW-DALKIW--------------EGGLAIHG
LGT_SYNY3         VAAIPSARLYYVAFE--------WPRYAQHWLNIFAIW--------------QGGIAIHG
LGT_BACSU         PIAIICARIYYVAFE--------WDYYAAHPGEIIKIW--------------KGGIAIHG
LGT_GEOTN         PIAIVCARAYYVLFE--------WDYYSKHLAEIPKIW--------------QGGLAIHG
LGT_STAXY         IFGFIVARIYFVIFQ--------WPYYIQNPIEIPMIW--------------HGGIAIHG
LGT_STAES         IVGFIVARIYFVTFQ--------WPYYMNHLSEIPKIW--------------HGGIAIHG
LGT_LACPL         PFTLIAARTYYVIFQ--------WSYYRQNPGEIIRIW--------------DGGIAIYG
LGT_LACGA         PIGFIGARIYYVVFE--------WGYFSQHPDQIIAIW--------------NGGIAIYG
LGT_LACLA         PLGIVGARLYYVIFQ--------WSYYSQHPSQIIAMW--------------DGGGAIYG
LGT_ENTFA         PAAIVGARLYYVAFQ--------WQDYVDNPIEIFFTR--------------NGGLAIYG
LGT_CHLAD         VLGIAGARIYYVAFE--------WERFAPNPWSVFNLT--------------TGGIAIHG
LGT_CORGL         PAGIIGGRIYHVITD-NQKY---FCDT-CNPVDAFKIT--------------NGGLGIWG
LGT_COREF         PAGIIGGRIYHVITD-NQKY---FCET-CDPVDALKIT--------------NGGLGIWG
LGT_MYCTU         PFGLIGGRLYHLATD-WRTY---FGDGGAGLAAALRIW--------------DGGLGIWG
LGT2_STRCO        PFGLVGGRLYHVFTS-PDAY---FGER-GEPVRALYVW--------------EGGLGIWG
LGT_FRAAA         PFGIVGARIYHVLST-PDAY---FGEH-GHVADVVKIW--------------NGGLGIWG
LGT_BIFLO         PCALVGARLYHCITT-PADY---FPPT-GNLVNILKVW--------------EGGMAIFG
E3H1X1_ROTDC      PAGIIGARAYHVLITDPGSY---FGPNVSDPWAFLKIW--------------EGGIGIMG
LGT_UREPA         PMTIIGARLWSLAIG-DAKD-------------FFDFR--------------SGGLAIQG
LGT_MYCPE         PVSLLGARIWSFIIG-DASK---SLATQNFFAAFFNFR--------------EGGLAIEG
LGT_MYCPN         LTMVLGARAWYFLIE-AVDG---RSSGSN----FFDFR--------------NGGLAIQG
LGT_AQUAE         LFGVIGARIAYILEHPYEFH---SLV------DFLALW--------------KGGVSFYG
LGT_CLOTE         IGGILGGKLLYIIVDIKNII---DNP------EILKDL--------------GNGFVIYG
LGT_THET8         VFGVVGARLGYVLTSPGYFL---ENP-----LEALYIW--------------HGGLSFHG
D3PSU2_MEIRD      IWGVVGARVGYVITSPGEFS---GNP-----AAALYIW--------------QGGLSFHG
LGT_DEIRA         FWGFVGARLVFVLTSWHIFE---GIPFPRVLLDIVNLR--------------NGGISIHG
LGT_ECOLI         LGVFLGGRIGYVLFYNFP-------QFMADPLYLFRVW--------------DGGMSFHG
LGT_ESCF3         LGVFLGGRIGYVLFYNFP-------QFLDDPLYLFRVW--------------DGGMSFHG
LGT_VIBVU         LGVVLGGRIGYVLFYNFD-------LFLADPIYLFKVW--------------TGGMSFHG
LGT_SHEON         LGVILGGRIGYVLFYHFD-------YFLASPMYLFKIS--------------EGGMSFHG
LGT_PSEA8         CGVILGGRLGYVLFYNLD-------EYIANPTLIFEVW--------------KGGMSFHG
LGT_DESVV         LGVVLGGRIGYILFYDLA-------YYLSNPTQIFSIW--------------NGGMSFHG
LGT_LEGPA         LGVILGGRVGYMLFYDIQ-------EFIHHPWVLFKIW--------------EGGMSFHG
LGT_XYLFT         MGVVLGGRVGYMLFYAFH-------DFLQEPLLLFRVW--------------EGGMSFHG
LGT_GEOSL         IGVILGGRLGYILFYNLS-------YYLSHPLKLFAVW--------------EGGMSFHG
LGT_AZOSB         LGVIIGGRLGEVLFYQPG-------YYLSHPAEILAVW--------------KGGMSFHG
LGT_CAUVC         LGIIVGGRLGYFVFYMLMNDDQ-RAWLAAHPMDVFKIW--------------EGGMSFHG
LGT_RHOPA         IGIILGGRTGYVLFYNLD-------FFIRHPAEIFELW--------------KGGMSFHG
LGT_BUCBP         IGLFIGGRIGYIIFYNPV-------FFFENMSHILKIW--------------EGGMSFHG
LGT_HELP2         LGIVLGARVGYILIYEPN-----SSYYLTHFWQIFNPFD------SHGNFVGIRGMSYHG
LGT_HELPY         LGIVLGARIGYILIYEPN-----SGYYLTHFWQIFNPFD------SHGNFVGIRGMSYHG
LGT_HELHP         IGVILGGRIGYVLIYSPN-----RWEYLMQPWQMFNPY-------TNGVFVGISGFSYHG
LGT_CHLTR         LAIIIGARLAYVLFYGGS-------FYFENPSEIIKIW--------------KGGLSSHG
LGT_CHLMU         LVIVIGARAFYVLFYGGS-------FYFENPSEIIKIW--------------KGGLSSHG
LGT_CALS4         IFGVIGARLMFVLANYPE-------WFVKDPVQVFKIY--------------EGGLSWHG
LGT_PARUW         FGTLIGARLGAVFFYDWN-------YFKSHPLEIFEVW--------------KGGLASHG
E1QE00_DESB2      LAGLLGARAFYYLIEWES-------LSHLPWYYFFFFW--------------EGGLVFYG
LGT_TROWT         IPVILGARLWHVVSHTQM-------YEHQPFYKVFAIW--------------EGGLGFIG
LGT_DEHMB         PSGIVFAKLLHVIDA--------WEYYSLNPGAIFSGE----------------GLTIFG
LGT_BORBU         LGAILGGRLASTLVYDKS------GIYYSNPWLILLPFD------QHWNFTGFRGMAIHG
LGT_BACTN         FGILIGARLGHCLFYDPGQYLTSGKGFVEMLLPIKFLAG------GGWKFTGYEGLASHG
LGT_MYCPU         PSSIIGARLWFVFERLIYNP-----QNPFPGSAWYAIW--------------EGGLSIQG
LGT_RHOBA         IGGLLGARVFYVTQYYEDFL---RPTWGETLMAMAALN--------------QGGLVVYG
LGT_LEPIN         LGTLVGAKIFFVFEIWDQIFVETPGFDGKYIYPLTHWYGFPGRMSLWDNLFSGSGLVFYG
                     .  .:                                              *    *

LGT_THEMA         AVIGALLTGFLYVRLKKP--------------------------SFTFLQATDLFTSVLP
LGT_SYNY3         ALIGGTIAILVFSRYHQ----------------------------LSFWNLLDVLTPAVI
LGT_BACSU         GLIGAILTGYVFSRVKN----------------------------LSFWKLADIAAPSIL
LGT_GEOTN         GLIGAVATGAVFAQVRG----------------------------LPFWKLADIAAPSII
LGT_STAXY         GLIGGFVTGIIICKQKN----------------------------INPFQIGDVIAPSMI
LGT_STAES         GLIGGLISGIIVCKIKN----------------------------LHPFQIGDIVAPSII
LGT_LACPL         GLIGAGIVVILFCRSRF----------------------------IPTWLMLDIAAPTVI
LGT_LACGA         GLIAGLIVLLVFCHQRM----------------------------LPPFLMLDIIAPGVM
LGT_LACLA         SLIAGAIVLFVFSYYRM----------------------------IHPLDLLDITIPGVF
LGT_ENTFA         GLIGGGLALFFFTRHRF----------------------------ISTWTFLDIAAPSVI
LGT_CHLAD         AIIGALLSTVIYTRYAG----------------------------LPYWDWLDVCVPGFL
LGT_CORGL         AVILGGLAVAVFFRYKK----------------------------LPLAPFADAVAPAVI
LGT_COREF         AVILGGLAVWAYFRYKK----------------------------IPLAPFADAVAPGVI
LGT_MYCTU         AVTLGVMGAWIGCRRCG----------------------------IPLPVLLDAVAPGVV
LGT2_STRCO        AIALGAVGAWIGCRRHR----------------------------IPLPAFADAVAPGIV
LGT_FRAAA         AIAGGALGAWLAARRLG----------------------------ISLALFADAAAPGII
LGT_BIFLO         GISVGTLVAFLWCRHKH----------------------------YPFAIFADAIAPALP
E3H1X1_ROTDC      AVSVGALGAWIACRRYQ----------------------------INYAAFADAVAPGII
LGT_UREPA         GVIAGVLSAAVYFPLILRMPKYHIRDI--------DADGNVVIRQPSMWIYADAIIPTIL
LGT_MYCPE         GVLLTVIAALIYFPLVLKKPQYNVKT---------KIGNEYYVKQVSMWVYADAIVPCIL
LGT_MYCPN         GVLLTTLAGIIYFNVFLNMKTTKTKTTAKLLNNKNQIKTVYVERNISVFVMLDLIAPCVL
LGT_AQUAE         GLIGGIIGALIGIKVFN----------------------------LPLWKSADIAAPAIA
LGT_CLOTE         AIIGGAISVYLYCKKKN----------------------------WDVLKMLDLVVPSVA
LGT_THET8         AILGGGLTFYYFHRRRG----------------------------YPLWPYLDAATPGVA
D3PSU2_MEIRD      AIIGGLIPFVYHYHRNK----------------------------IPIWAYLDAVVPGVA
LGT_DEIRA         GLIGGVLTLIYFARRYR----------------------------LNFYQYADLAVPGVA
LGT_ECOLI         GLIGVIVVMIIFARRTKR----------------------------SFFQVSDFIAPLIP
LGT_ESCF3         GLIGVIVVMFIFAHRTKR----------------------------SFFQVSDFIAPLIP
LGT_VIBVU         GLLGVITAMLWYAKKNGR----------------------------TFFGVADFVAPLVP
LGT_SHEON         GLIGVITAMIYITWKQKR----------------------------TFFAVADMVAPVVP
LGT_PSEA8         GLLGVMLAVWWFGKRHGK----------------------------SFFQLMDFIAPLVP
LGT_DESVV         GLLGVVFAMWLLGRRNGL----------------------------GFMDVSDFVAPLIP
LGT_LEGPA         GLLGVVIAAWLFCRKYGK----------------------------TFLEVGDFVAPLVP
LGT_XYLFT         GLIGVLLAVAWWSRRQRM----------------------------HMFDVVDFCAPLVP
LGT_GEOSL         GLLGVILAGVYVARQKKI----------------------------GFPVLADICAPAAP
LGT_AZOSB         GFLGVLVAMWLYGQRSGR----------------------------GFWQITDFIAPLVP
LGT_CAUVC         GFLGVCAAIILFARQQKI----------------------------DMLRLGDLIAPVAP
LGT_RHOPA         GFMGCVAAVVLFGWKRKV----------------------------PILSLGDITCAVGP
LGT_BUCBP         GLLGVIIVLLFFSKKLNK----------------------------HILEISDFIVPLVP
LGT_HELP2         GLVGFLIASYLYSRKDLK----------------------------KLLIYLDLIAISLP
LGT_HELPY         GLVGFLIASYLYSRKDLK----------------------------KLLIYLDLIAISLP
LGT_HELHP         AMAGFVLAAIIFCYVKKQ----------------------------SFWIFMDLSAISIP
LGT_CHLTR         AVISVVIWAAVFSRLHIRK-----------------------LPMLSVTYICDLCGAVFG
LGT_CHLMU         AIIALVIWSAAFSRFHIRR-----------------------LPMLSVTYICDICGAVFG
LGT_CALS4         AVLGGFLAGLYYCRKKG----------------------------VRINPLEDFAVVGLA
LGT_PARUW         GALGVMLALFFYTSYIKKW-----------------------TPTLSFLRVLDFVAIPSA
E1QE00_DESB2      CLAVGLPTAIVLARHYHL----------------------------PLPRLLDIGAPALA
LGT_TROWT         GVFSGLICFFVIAKIKKV----------------------------PPFTFLDALAPGIL
LGT_DEHMB         AIIGATIGLWIYSRYSHF----------------------------NLGYLLDVAVPGIL
LGT_BORBU         GFLGAIIAPLITINTNLKNT----------------------NVQKYFLKLTDYGSIAFS
LGT_BACTN         GTLGLMIALWLYCRKTKL----------------------------HYMDVVDMIAVATP
LGT_MYCPU         GVALPAILSLVYIYFKRDY--------------------------IDYRKALSMILPTVL
LGT_RHOBA         GFIGGFIASLIALKRHQT----------------------------PIWRIGDVIIPCVF
LGT_LEPIN         GFLFGILFITLYMKYFQL----------------------------DIASYLDAAVPSMA
                                                                      .       

LGT_THEMA         LGQAIGRWGNFFNYE-AFGVPTNLPWK-------------------------MFVPEPYR
LGT_SYNY3         LGQAIGRWGNFFNSE-AFGAPTNLPWK-------------------------LYIPFANR
LGT_BACSU         LGQAIGRWGNFMNQE-AHGEAVSRAFL-----------------------ENLHLPEFII
LGT_GEOTN         LGQAIGRWGNFMNQE-AHGGPVSREFL-----------------------ENLYLPDWII
LGT_STAXY         LGQGIGRWGNFMNHE-AHGGPISRSVL-----------------------ENLHIPNFII
LGT_STAES         LAQGIGRWGNFMNHE-AHGGPVSRAFL-----------------------EHLHLPDFII
LGT_LACPL         MGQGIGRWGNFMNQE-AFGRVTSLSFL-----------------------QGLHLPDWLI
LGT_LACGA         AAQVIARWGNFMNQE-AHGAKTTLSFL-----------------------ESLHLPHFII
LGT_LACLA         LAQAMGRWGNFVNQE-AYGKIVS---------------------------NLDWLPAFIR
LGT_ENTFA         LAQAIGRWGNFMNHE-AYGPATTRQFL-----------------------ENLHLPTFII
LGT_CHLAD         LAQSIGRWGNFFNQE-AYGRPTDLPFGLRID-------------------PEYRVPPYND
LGT_CORGL         LAQGIGRLGNWFNQE-LYGAETTVPWALEIYYRVDEN-------------GKFAP--VTG
LGT_COREF         LAQAIGRLGNWFNQE-LYGAETDVPWALEIYYRVDEN-------------GRFAP--VTG
LGT_MYCTU         LAQAIGRLGNYFNQE-LYGRETTMPWGLEIFYRRDPS-------------GFDVPNSLDG
LGT2_STRCO        LAQAIGRWGNWFNQE-LYGRPTTLPWGLEIDRAHRP------------------------
LGT_FRAAA         LAQAIGRWGNWFNQE-LYGKPTTLPWAVRIDPAHR-------------------------
LGT_BIFLO         VAQAIGRLGNWFNQE-LYGWPTTLPWGLKLNDADAIG--------------KSEICYSGA
E3H1X1_ROTDC      LAQAFGRWGNWFNQE-LFGKPTTLPWGLEISQSSGN-----------------------F
LGT_UREPA         IGQALGRWGNFINGE-IFGAESTVND----------L-------------QWLKKAMPAV
LGT_MYCPE         VGQIIGRWGNFFNQE-VYGPIATEAE----------L-------------AWLKTLMPGV
LGT_MYCPN         IGQAIGRWGNFFNAE-VYGAALVGSKNDTLSAANTTW-------------GFLRILMPKV
LGT_AQUAE         LAHFFGRLGCTSAGC-CYGKPFPYATSNEVGIHFSDK----------------------F
LGT_CLOTE         LAQGFGRIGCFLAGC-CYGKPTKLPIG---------------------------------
LGT_THET8         LGIVAGRIGNLMNGSDTAGRLTTLPIGFTWPEWARGF----------------PGVCPGI
D3PSU2_MEIRD      LGIMAGRLGNIMNGSDTVGRLTNWPIGFTWPASASGF----------------PGVCPGI
LGT_DEIRA         FGIIGGRLGNIMNGTDTVGRVTGWPIGYHWPASARAFHEG----------MCRPNPNPDM
LGT_ECOLI         FGLGAGRLGNFINGE-LWGRVD-PNFPFAMLFPGSRTEDILLLQ---------TNPQWQS
LGT_ESCF3         FGLGAGRLGNFINGE-LWGRVD-PNFPFAMLFPGSRTEDILLLQ---------TNPQWQS
LGT_VIBVU         FGLGVGRLGNFMNGE-LWGRV--TDVPWAMVFP---------------------------
LGT_SHEON         IGLGAGRIGNFINGE-LWGRV--TDVPWAMVFP---------------------------
LGT_PSEA8         IGLGAGRIGNFINSE-LWGKV--SDVPWAMVFP---------------------------
LGT_DESVV         PGLFFGRIGNFINGE-LWGKH--TTLPWGMVFP---------------------------
LGT_LEGPA         LGLAAGRLGNFINGE-LWGRV--TDVPWGMIYP---------------------------
LGT_XYLFT         VGLGFGRLGNFIGGE-LWGKL--THNGWGVIFPRAPLSDVPAGQLAMQDVINFVQIQEHY
LGT_GEOSL         VGLGLGRLGNFINGE-LYGRV--TDVPWGIIFP---------------------------
LGT_AZOSB         TGLAAGRIGNFINGE-LWGRPASPDLPWAMIFP---------------------------
LGT_CAUVC         IGIFFGRIANFINGE-LWGRVTDG--PFGIIFCNETIQANHPQR----------------
LGT_RHOPA         IGLFLGRIANFINGE-LWGRPADASVPWAMVFPN--------------------------
LGT_BUCBP         FGLGAGRLGNFINGE-LWGRIA-PDFKFSVLFPNSREIDLNVAA---------NNLELKS
LGT_HELP2         LGYVFGRIGNFLNQE-LVGRIVPKDSHLGQIIGIMVD-----------------------
LGT_HELPY         LGYVFGRIGNFLNQE-LVGRIVPKDSHLGQIIGIMVD-----------------------
LGT_HELHP         LGYVFGRIGNFFNHE-LFGRVIESDSSLRDI-GILVN-----------------------
LGT_CHLTR         CAALLIRVGNFMNQE-ILGTP--TSMPWGVIFPN--------------------------
LGT_CHLMU         VAALLIRVGNFMNQE-ILGTP--TSMPWGVVFAN--------------------------
LGT_CALS4         LGNMLVRVGNIFNHE-VLGRPTEFFFGR--------------------------------
LGT_PARUW         LTAVFIRIGNFFNQE-IIGTPSAYPWAVLFAQPA--------------------------
E1QE00_DESB2      IGQAIGRVGCFLAGC-CHGLPWPGGACAVVFTDP--------------------------
LGT_TROWT         AALCFARLGNYFNGE-VFGTETTLPWGLKLSHEG--------------------------
LGT_DEHMB         LGQAIGRVGCLLNGC-CYGEFGGTGCSVIYTNPA--------------------------
LGT_BORBU         SGYILGRLANFANAE-LYGRVMKGGIIFPNAEPFDTN----------------IPGVKEF
LGT_BACTN         ITACFIRLANLMNSE-IIGNPTNVPWAFVFE-----------------------------
LGT_MYCPU         IGQAIGRWGNFANHE-VYGKIDPTGQSSLIFGEWLAR----------------HMFIYNA
LGT_RHOBA         VGLLFGRLGCLMNGCCYGGACEAGPLAVQFPAGSQVHAEQLLSGELLGIEGHPVVSDEEP
LGT_LEPIN         IGYAIGRLGCWVSGDGCYGFATNVEIPLLVFNYH--------------------------
                        * .         *                                         

LGT_THEMA         PVVYKDYSFF--------------------------------------------------
LGT_SYNY3         PLNLTSYAYF--------------------------------------------------
LGT_BACSU         NQMYINGQYY--------------------------------------------------
LGT_GEOTN         NQMYINGQYW--------------------------------------------------
LGT_STAXY         DNMYIDGKYY--------------------------------------------------
LGT_STAES         RNMYIEGQYY--------------------------------------------------
LGT_LACPL         NQMYIRGAYR--------------------------------------------------
LGT_LACGA         QQMYIDGSYY--------------------------------------------------
LGT_LACLA         NQMFIDGHYR--------------------------------------------------
LGT_ENTFA         DNMNINGTYH--------------------------------------------------
LGT_CHLAD         LTTYPITTLF--------------------------------------------------
LGT_CORGL         TSTGEVMATV--------------------------------------------------
LGT_COREF         VSTGEVIATV--------------------------------------------------
LGT_MYCTU         VSTGQVAFVV--------------------------------------------------
LGT2_STRCO        -AGTLDIATY--------------------------------------------------
LGT_FRAAA         --ADPGVATY--------------------------------------------------
LGT_BIFLO         QCPDYRTTLF--------------------------------------------------
E3H1X1_ROTDC      PAQYPAGTLF--------------------------------------------------
LGT_UREPA         FEGMKHYFIEGN------------------------------------------------
LGT_MYCPE         YNNMFITTTG--------------------------------------------------
LGT_MYCPN         WDGMFINGSF--------------------------------------------------
LGT_AQUAE         PFFYVVFPKGAV------------------------------------------------
LGT_CLOTE         ----VMFTNSPF------------------------------------------------
LGT_THET8         DDISEVYRCA--------------------------------------------------
D3PSU2_MEIRD      QDISEVVRCAPE------------------------------------------------
LGT_DEIRA         DLSKYCHEVGGQ------------------------------------------------
LGT_ECOLI         IFDTYGVLPR--------------------------------------------------
LGT_ESCF3         IFDTYGVLPR--------------------------------------------------
LGT_VIBVU         ---TGGPLPR--------------------------------------------------
LGT_SHEON         ---SGGPEPR--------------------------------------------------
LGT_PSEA8         ---NGGPLPR--------------------------------------------------
LGT_DESVV         ---DGGPFPR--------------------------------------------------
LGT_LEGPA         ---HVDDQPR--------------------------------------------------
LGT_XYLFT         AAGLLGHYAR--------------------------------------------------
LGT_GEOSL         ---GGGGVPR--------------------------------------------------
LGT_AZOSB         ---WVDALPR--------------------------------------------------
LGT_CAUVC         -ICPAGPLPR--------------------------------------------------
LGT_RHOPA         ----AGPLPR--------------------------------------------------
LGT_BUCBP         LIEKFGVLPR--------------------------------------------------
LGT_HELP2         ------HQLR--------------------------------------------------
LGT_HELPY         ------NELR--------------------------------------------------
LGT_HELHP         ------GELR--------------------------------------------------
LGT_CHLTR         ---GGGQIPR--------------------------------------------------
LGT_CHLMU         ---DSSLIAR--------------------------------------------------
LGT_CALS4         ------------------------------------------------------------
LGT_PARUW         --DGSLPIPR--------------------------------------------------
E1QE00_DESB2      HSLAPRGVEL--------------------------------------------------
LGT_TROWT         FKDLNVEKYF--------------------------------------------------
LGT_DEHMB         -TAAPYGVEV--------------------------------------------------
LGT_BORBU         ASSVGLEISPHD------------------------------------------------
LGT_BACTN         ---RVDMLPR--------------------------------------------------
LGT_MYCPU         NESAASAAFR--------------------------------------------------
LGT_RHOBA         PAGQSQMVVDSVRPDSLANQAGVKKGETLTIALDPSYRDQVPLDRPAEEALPGVVVLRDD
LGT_LEPIN         -GAHPSGVPV--------------------------------------------------
                                                                              

LGT_THEMA         ------------------HPTFLYESIWDLLVFFML-SVYFKRYRK--------------
LGT_SYNY3         ------------------HPTFLYESVWNLGIFAILIALFFYGLRNP-------------
LGT_BACSU         ------------------HPTFLYESLWSFVGVIVLLLLRRA------------------
LGT_GEOTN         ------------------HPTFLYESLWNLVGFCLLLWLRRV------------------
LGT_STAXY         ------------------QPTFLYESLWDILGFVILILLRK-------------------
LGT_STAES         ------------------HPTFLYESIWDVIGFVILITLRK-------------------
LGT_LACPL         ------------------QPTFLYESVWDLLGFALLMLTRHRT-----------------
LGT_LACGA         ------------------QPTYLYESALNLVGLILILSLRHRK-----------------
LGT_LACLA         ------------------MPTFLFESIGTLSGFILVMVFRHRI-----------------
LGT_ENTFA         ------------------QPTFLYESVWNVLGFIVLVLLRKKP-----------------
LGT_CHLAD         ------------------HPTFLYESVWNLVGVGILLWLDRRFGRLAP---------PER
LGT_CORGL         ------------------HPTFLYELLWNLLIFALLMWADKRF-----------------
LGT_COREF         ------------------HPTFLYEMLWNLLIFGLLIWADRRF-----------------
LGT_MYCTU         ------------------QPTFLYELIWNVLVFVALIYIDRRF-----------------
LGT2_STRCO        ------------------HPTFLYESLWNIGVAALILWAAKRF-----------------
LGT_FRAAA         ------------------QPTFLYEFLWNLVVAAILLLVDRRH-----------------
LGT_BIFLO         ------------------HPTFLYEMIWNLIGAALIIYLGHKLA----------------
E3H1X1_ROTDC      ------------------HPTFLYESLWNLVGAFLLIFLGNRF-----------------
LGT_UREPA         -----------KTLFTIYQPLFLYESFFNVIVFVFIYFGLSYIK----------------
LGT_MYCPE         ---------------NLHHPFFLYESFINFWFFLAIYIGGEFIK----------------
LGT_MYCPN         -----------------RIPLFLIESFFNTIFFVFIYFVMDHIK----------------
LGT_AQUAE         -----------APPFTPLYPTQLMEAFGNLLIFFVLLFAYRYKPFS--------------
LGT_CLOTE         -----------APSNIHLHPTQIYSSIFDFLLAFFLLWYSRKAEKS--------------
LGT_THET8         -----------ELLRGPVHLTQVYGAVVGLILLFLSLYWLRKRPFY--------------
D3PSU2_MEIRD      -----------TLVRGPVHFTQLYGVLIGLALLLLSLYWLRQNRAY--------------
LGT_DEIRA         -----------IMMTAPVHFTQLYGVIIGIILAVASYFWL-KSRVP--------------
LGT_ECOLI         ------------------HPSQLYELLLEGVVLFIILNLYI------------------R
LGT_ESCF3         ------------------HPSQLYELLLEGVVLFIILNLYI------------------R
LGT_VIBVU         ------------------HPSQLYEMALEGVVLFFILNWFI------------------R
LGT_SHEON         ------------------HPSQLYQFALEGVALFLLLYWFS------------------K
LGT_PSEA8         ------------------HPSQLYQFALEGVALFVILWLFT------------------R
LGT_DESVV         ------------------HPSQLYECALEGVILFLALWVFS------------------S
LGT_LEGPA         ------------------HPSQLYEFGLEGVALFILIWCYA------------------S
LGT_XYLFT         ------------------HPSQLYEAFLEGLVMFIVLWLFS------------------R
LGT_GEOSL         ------------------HPSQLYEAVLEGPVLFLILMAVG------------------R
LGT_AZOSB         ------------------HPSQLYQAAGEGLLLFAIVWVFA------------------A
LGT_CAUVC         ------------------HPSQLYEAALEGLVLFLILAFAIYRL---------------K
LGT_RHOPA         ------------------HPSQLYEAGLEGIGLFVILALMI-RA---------------G
LGT_BUCBP         ------------------HPSQIYEFVLEGLVLFFVLNYFS------------------K
LGT_HELP2         ------------------YPSQLIEAFLEGVIVFLMVMWAK------------------K
LGT_HELPY         ------------------YPSQLIEAFLEGVIVFLMVMWAK------------------K
LGT_HELHP         ------------------YPSQLFEAFAEGIIVFILLICLL------------------R
LGT_CHLTR         ------------------HPVQLYE-GLGYLVLSCILYRLCYRG---------------V
LGT_CHLMU         ------------------HPVQLYE-GVSYLLLSLVLYWLCYRG---------------S
LGT_CALS4         ------------------WPAQLVGVAIGAFLLIRYFYVQKKH-----------------
LGT_PARUW         ------------------HPVQLYEAFAYLMTFFLLFTLWKKCN----------------
E1QE00_DESB2      ------------------HPTQLYTSAALLLIFGALIWLWPRR-----------------
LGT_TROWT         ------------------HPIFLYEIILNVFIIVILLVLEKRVFVK--------------
LGT_DEHMB         ------------------APTQAYEIIFLLCLLTFSLFIAKKLR----------------
LGT_BORBU         -----------LLINLPRIPSQLIEGFFEGPVTFLLLWFLFKKI----------------
LGT_BACTN         ------------------HPGQLYEAIAYLILFFIMIYLYKNYS----------------
LGT_MYCPU         ------------------YPLFLYESISSIIGYIIIVWIIQERN----------------
LGT_RHOBA         EVVARFSPRDLPSIADPVWGTQIISSVFAAIMFVVLLIVERILHRPSKQTDDAVTERAIT
LGT_LEPIN         ------------------WNTPLIESIISFLFFFYFQFWARNQN----------------
                                                                              

LGT_THEMA         ---RHGEVTCLYFVLYSLGRIVIE-RLRVDSLMIG-------------------------
LGT_SYNY3         EKIKTGTITCVYLIGYSLGRVWIE-GLRLDSLMLG-------------------------
LGT_BACSU         -NLRRGEMFLIYIIWYSIGRYFIE-GMRTDSLMLT------------------------D
LGT_GEOTN         -NLRRGELFLSYVIWYSLGRFWIE-GMRTDSLMLA------------------------E
LGT_STAXY         -HLRVGDTFCLYLIWYSIGRFFVE-GMRTDSLMLT------------------------S
LGT_STAES         -RLKLGETFFGYLIWYSVGRFFVE-AMRTDSLMLT------------------------S
LGT_LACPL         HWYKQGDVFLTYVAWYAFGRFFTE-GMRTDSLMLF------------------------N
LGT_LACGA         HLFKRGEVFFSYVIWYAAVRFFVE-GMRTDSLYIA------------------------N
LGT_LACLA         KGLKRGDIFSFYLVWYGAVRFIVE-GMRTDSLML-------------------------G
LGT_ENTFA         HFLKEGEVFLGYIIWYSFGRFFIE-GLRMDSLYAF------------------------S
LGT_CHLAD         RRLNPGDLLFLYGIIYSSGRFWIE-GLRIDSLCANGVGGSC-----------------EG
LGT_CORGL         -KLGHGRVFALYVAGYTLGRFWIE-QMRVDEATLI------------------------G
LGT_COREF         -RLGHGRVFALYVAGYTLGRFWIE-QMRTDEATMV------------------------F
LGT_MYCTU         -IIGHGRLFGFYVAFYCAGRFCVE-LLRDDPATLI------------------------A
LGT2_STRCO        -PLGHGRTFALYVAAYTVGRFGTE-YLRIDEAHTF------------------------L
LGT_FRAAA         -RLGRGRLFALYVALYTFGRLWIE-MLRIDTADEI------------------------L
LGT_BIFLO         DRLKAGQQFAMYLMWYGLGRTWIE-NVRINYSTVI------------------------L
E3H1X1_ROTDC      --LKRGQTFWLYVLYYGIGRFFIEVFLRIDTSETL------------------------L
LGT_UREPA         -QLKIGFISMSYFFFYGVTRFSTE-SARAPQFSFE------------------------G
LGT_MYCPE         -KRKAGDLAIAYFICYGLLRSCME-PFRYSDYQFA------------------------T
LGT_MYCPN         -GIRSGTIGFSYFLATGIVRLILE-TQRDEAFKYN------------------------T
LGT_AQUAE         -----GFVFSLYLMLYGFERFFLEFFRGVTPPIPGIGLT---------------------
LGT_CLOTE         -----GRVFSLYVIIYGVGRVIVEFLRG-DPRGNVSMLS---------------------
LGT_THET8         -----GYAFWQFVLWYSVLRSVLEEPFRLNPLWLPVYRN------DE---------LGIG
D3PSU2_MEIRD      -----GYVFWQFVLWYSVLRSVFEETFRLNPLWVKVYLN------EQ---------AGIG
LGT_DEIRA         -----GWAFWQFWLWYSILRAGWEETFRLNPLTIKTYLNQGL---DA---------PGIG
LGT_ECOLI         KPRPMGAVSGLFLIGYGAFRIIVEFFRQPDAQFTGAWVQ---------------------
LGT_ESCF3         KPRPMGAVSGLFLIGYGAFRIIVEFFRQPDAQFTGAWVQ---------------------
LGT_VIBVU         KPRPLGSVSGLFLAGYGTFRFLVEYVREPDAQL-GLFGG---------------------
LGT_SHEON         RTKKVGAVSGMFLLGYGIFRVIVETVRQPDAQL-GLYWG---------------------
LGT_PSEA8         KPRPTASVSGLFVLCYGIFRFVVEFVRVPDAQLGYLAWG---------------------
LGT_DESVV         RKRPTGHVSGLFALLYGVFRFTVEFVREPDVQLGYLAFG---------------------
LGT_LEGPA         KPRQQGRVCALFLMGYAICRLIAESFRQPDSQLGFVAFG---------------------
LGT_XYLFT         KPRPRYAVSGLFALLYGVFRFLVEFVRMPDNGV-YVAFG---------------------
LGT_GEOSL         RERPAGVVFWTFIAFYGLFRFLVEFFREPDAQL-GLLAG---------------------
LGT_AZOSB         KPRPLRAVSAVFLIGYGSLRFVAEFFRTPDPGIFSDLVP---------------------
LGT_CAUVC         WLRRRGALVATFLLGYGLARLALENVRNPDVGM-PEFPL---------------------
LGT_RHOPA         ALKRPGLIIGAFLTFYGLARITGEFFREPDPQL-GFLWG---------------------
LGT_BUCBP         KSMPFGFVSSIFLILYGCFRIFLEIFRQPDRQI-GLFLN---------------------
LGT_HELP2         HTKTHGLLIVVYGLGYSLMRFIAEFYREPDSQM-GVYFL---------------------
LGT_HELPY         HTKTHGLLIVVYGLGYSLMRFIAEFYREPDSQM-GVYFL---------------------
LGT_HELHP         YAKKPGTLLVAYGVFYALARFVCEYFREADSQM-GYFVF---------------------
LGT_CHLTR         IRLGSGYSAAGALIGVAVIRFCAEFFKTHQGAWLGEEN----------------------
LGT_CHLMU         IRLGSGYSAAGALIGVASIRFCAEFFKTHQGSWLGEES----------------------
LGT_CALS4         --MPDGYQFWSFIFYYQLLRGVFEETVKDVPLVWPVYLNEE---------------WGIG
LGT_PARUW         TCLAAGTYAGFLFIFNFSSRFLLEFWKANLDSILTNP-----------------------
E1QE00_DESB2      --RFYGQIFFSYAVLHAVARIIIEQFRGDFRGEPIC-----------------------G
LGT_TROWT         TVFPKGSVFAAFLVLYGLGRFALEPMRYNLQQNSF-------------------------
LGT_DEHMB         ---PDGQLFLLYISLYAAWRVAIGFVRVNDDFALG-------------------------
LGT_BORBU         -KKYDGFIFGVYVMLYAFFRFFIEYLREPDKELGFIITYKPITSLSE---------FSFL
LGT_BACTN         KKLHRGFFFGLCLAYIFTFRFFIEFVKQNQEAFEDNM-----------------------
LGT_MYCPU         -LLKPGSNGGLYFVYYGTVRLAMEPLREESYFYYSLAAM--------------------F
LGT_RHOBA         GGRRPGVLMLVGFIAYGVLRIVLEWIRVDEKGQFGT------------------------
LGT_LEPIN         --FKKFSIGAQYLVLHGFARLLVEFLRVNKAVFPLMDPPAFVNIPNAEQNPEFLTQYYWH
                                     *                                        

LGT_THEMA         NIKAAQLLSAVLILLGFTGFLILRS-----------------------------------
LGT_SYNY3         PLRIAQVVSITLVLLGTAGIVWLYL-----------------------------------
LGT_BACSU         SLRIAQVISIVLIVLAVAAIIFRRV-----------------------------------
LGT_GEOTN         HLRMAQVMSITLIIIALVLWMVRRA-----------------------------------
LGT_STAXY         DIRVAQLMSIILILIGVIIMIIRRV-----------------------------------
LGT_STAES         HIRVAQLVSVVLILISVIFVIYRRV-----------------------------------
LGT_LACPL         VIRVSQALSVVLFFGSIGLMIWRRH-----------------------------------
LGT_LACGA         TIRVSQALSLILFFGAIILWVYRRK-----------------------------------
LGT_LACLA         PARVSQWLSVLLVIVGLVLFIYRRM-----------------------------------
LGT_ENTFA         NIRVSQLLSLVMFVAAIVIVIVRRR-----------------------------------
LGT_CHLAD         SIRVAQLVSMVAIVVCGVLIFLNHR-----------------------------------
LGT_CORGL         GIRINTIVSAVVFAGAIIVFFLLKK--GRETPEEV-------------DPTFAASVAADA
LGT_COREF         GMRINTLVSAVVFILAVIVFLRLGK--GREAPAEV-------------DPAYHAAQAERD
LGT_MYCTU         GIRINSFTSTFVFIGAVVYIILAPK--GREAPGALRGSEYVVDEALEREPAELAAAAVAS
LGT2_STRCO        GLRLNNWTSVLVFLGAVACLVV--------------------------------------
LGT_FRAAA         GLRVNIWTSAIVCVGAVVALLVVRRPVDPDVSPQEQRALGLVQDRTRRQPTDAAGETAGE
LGT_BIFLO         GLRTNVWTAIIVFVLGCILFVVLYQ----------------------YGPDPKAQARGLA
E3H1X1_ROTDC      GLRVHVWTSGALVVLGLIGFVAAGM------------------------RARSKAAAGIA
LGT_UREPA         TYIINSLLLIFGVLGALYVQFIAPLLR---------------------------------
LGT_MYCPE         SIVMSVLFALFGIILLVCNHLVFSKHRDFKFWEFIIYK----------------------
LGT_MYCPN         SIVFSALLILVGIVGIIYCQTLAIKLRGYFWTYFFLYG----------------------
LGT_AQUAE         ---WNQVVSLVLIAGSILLMFLLKN-----------------------------------
LGT_CLOTE         ---TSQFISLFTIIIGIFVFNIDRF-----------------------------------
LGT_THET8         LFTATQVVSLPLVLLSLYMLRRLG------------------------------------
D3PSU2_MEIRD      FFTATQIISIPLIALSIYFLTRWKG-----------------------------------
LGT_DEIRA         LWTDTQIFSVPLILVSLWMLWRLRQ-----------------------------------
LGT_ECOLI         YISMGQILSIPMIVAGVIMMVWAYRRSP-QQHVS--------------------------
LGT_ESCF3         YISMGQILSIPMIVAGVIMMVWAYRRSP-QQHVS--------------------------
LGT_VIBVU         FISMGQILSSPMIIGGLALMAWAYKRGHYQDKVTVK------------------------
LGT_SHEON         LMTMGQILSVPMILFGLYLILRPEGKQ---------------------------------
LGT_PSEA8         WLTMGQVLCVPMVLAGIALMVWAYRRDAAQPKAA--------------------------
LGT_DESVV         WLTMGQVLCLPLIMLGLWLLR---PGGDKGTKAA--------------------------
LGT_LEGPA         WLTMGQVLSIPMLLIGIWLWW------AKR------------------------------
LGT_XYLFT         WLTRGQILSLPLIVIGLFLFWLSCRSPVLQPVPAPEVAK---------------------
LGT_GEOSL         PFSMGQLLSFPMFLLGLTMAVLVSRRKVGP------------------------------
LGT_AZOSB         GLSTAQWLCVPMVVVGLALLKHAAHARARG------------------------------
LGT_CAUVC         GLTMGMMLSIPMILAGGWLLWKSLKEPIRDDAEAHEPA----------------------
LGT_RHOPA         DMTMGMLLSIPMVIVGILVMITTWRRGRGAPAAATPSSEAAS------------------
LGT_BUCBP         TFSMGQLLSMPMIVLGILIAINIYVKVL--------------------------------
LGT_HELP2         NLSMGQILSLFMVIVS--LGILLYATK--NSKKIKENQ----------------------
LGT_HELPY         NLSMGQILSLFMVIVS--LGILLYATK--NSKKIKENQ----------------------
LGT_HELHP         GLSMGQILSLVMLVISIFLGLFVFVQKPISSQKIKHQRKKK-------------------
LGT_CHLTR         ILTIGQWLSIPMIFLGVGIIWIASKKK---------------------------------
LGT_CHLMU         LLTIGQWLSIPMVFLGIGILWIASKKREP-------------------------------
LGT_CALS4         LFTMTQVATPFILILAYWMIKRVLNDPNRQYYD---------------------------
LGT_PARUW         ILQMGQLLSIPFILFGICLVWRKQNWQNLFCCHR--------------------------
E1QE00_DESB2      AVTPTAFFAGCLALAGVVALIWLWRKQGRHRSEQ--------------------------
LGT_TROWT         GLDLNYVGAAAMIIVGVLIACRHTIASGKLRNSGD-------------------------
LGT_DEHMB         -LEQAQVVGLILMAVAVPLFIYRLRKQKQTDKIT--------------------------
LGT_BORBU         NISMGQILSLTLMLSGLIWIIVTKKIADKKIKNNTNLAYKN-------------------
LGT_BACTN         MFNMGQWLSVPFIIIGFYFMFFYDRKKVAKK-----------------------------
LGT_MYCPU         SILIGGMMMIYFEIWANPSRYVKTKIGKFRYQYDWTKVVVD-------------------
LGT_RHOBA         SLSISQWVSLVVIAASLVTLFIRWRGVDSTSEQTP-------------------------
LGT_LEPIN         GFSQSQLVSIIIILVGAFFILKWKLWKKENTSNI--------------------------
                                                                              

LGT_THEMA         ----------------SQEPKRAF------------------------------------
LGT_SYNY3         ----------------LQKNLPDWSERKLVKN----------------------------
LGT_BACSU         ----------------KGYSKERYAE----------------------------------
LGT_GEOTN         ----------------KGWARERYMD----------------------------------
LGT_STAXY         ----------------KYRSP-RYKDVGPLSWPNPKVK----------------------
LGT_STAES         ----------------KYQPI-KYENSGPLTWPIKKAK----------------------
LGT_LACPL         ----------------HNPNNRWYLAGSGQKVVAENK-----------------------
LGT_LACGA         ----------------VI-KPKWYLAGSGLKYPYNRD-----------------------
LGT_LACLA         ----------------KKN-----------------------------------------
LGT_ENTFA         ----------------NPNLKFYNREKQKKKITTS-------------------------
LGT_CHLAD         ----------------RPFAGTPTVRPDGDASPVSEAR----------------------
LGT_CORGL         VASPDGKP-------LPKAGEGIDGETPSTR-----------------------------
LGT_COREF         DTETAG---------LDATTGTVPGDSPETTGKKRK------------------------
LGT_MYCTU         AASAVGPVGPGEPNQPDDVAEAVKAEVAEVTDEVAAESVVQVADRDGESTPAVEETSEAD
LGT2_STRCO        --SAHRH---------PGIENVARLQGAGADGRTDD------------PRPADASVGLAS
LGT_FRAAA         TRTATRH---------DDATDGVDVNGADVDGADPSNVNGANVNG---ADPVNVNVNDAD
LGT_BIFLO         AVTADELE--------RQSIEEEQLRQKKQTNRTK-------------------------
E3H1X1_ROTDC      EAPVQGSS-------VQQTPNSEKTAAQDPDEVSNQGKETLEESRISEKKVTEEKKATKD
LGT_UREPA         ----------------KKFLLDAIIEMFYKK-------------KDQIHK--------FG
LGT_MYCPE         ---------------TKKFFKQDIKEFLDSKRNADNLKVQKQINKNITKE--------PN
LGT_MYCPN         ---------------WYKVAAFFTTLFMKDRTQACSSKFAFYEKSLPEKERSFFQLKYYN
LGT_AQUAE         ----------------QKS---------NVVDYEV-------------------------
LGT_CLOTE         ----------------RKQ-----------------------------------------
LGT_THET8         ---------------------------KGEASRR--------------------------
D3PSU2_MEIRD      ----------------PREQPAPSPMLSGSAESKKIKR----------------------
LGT_DEIRA         ----------------RRQ----VTVPTVPVQSQS-------------------------
LGT_ECOLI         ------------------------------------------------------------
LGT_ESCF3         ------------------------------------------------------------
LGT_VIBVU         ------------------------------------------------------------
LGT_SHEON         ------------------------------------------------------------
LGT_PSEA8         ------------------------------------------------------------
LGT_DESVV         ------------------------------------------------------------
LGT_LEGPA         ------------------------------------------------------------
LGT_XYLFT         ------------------------------------------------------------
LGT_GEOSL         ------------------------------------------------------------
LGT_AZOSB         ------------------------------------------------------------
LGT_CAUVC         ------------------------------------------------------------
LGT_RHOPA         ------------------------------------------------------------
LGT_BUCBP         ------------------------------------------------------------
LGT_HELP2         ------------------------------------------------------------
LGT_HELPY         ------------------------------------------------------------
LGT_HELHP         ------------------------------------------------------------
LGT_CHLTR         ------------------------------------------------------------
LGT_CHLMU         ------------------------------------------------------------
LGT_CALS4         ------------------------------------------------------------
LGT_PARUW         ------------------------------------------------------------
E1QE00_DESB2      ------------------------------------------------------------
LGT_TROWT         ------------------------------------------------------------
LGT_DEHMB         ------------------------------------------------------------
LGT_BORBU         ------------------------------------------------------------
LGT_BACTN         ------------------------------------------------------------
LGT_MYCPU         ----------------KKDKKIKFQSNNNKNKTEGKIKKYVTK-----------------
LGT_RHOBA         -----------------GGGNTNVVGGSDAAAAGL-------------------------
LGT_LEPIN         ------------------------------------------------------------
                                                                              

LGT_THEMA         ------------------------------------------------------------
LGT_SYNY3         ------------------------------------------------------------
LGT_BACSU         ------------------------------------------------------------
LGT_GEOTN         ------------------------------------------------------------
LGT_STAXY         ------------------------------------------------------------
LGT_STAES         ------------------------------------------------------------
LGT_LACPL         ------------------------------------------------------------
LGT_LACGA         ------------------------------------------------------------
LGT_LACLA         ------------------------------------------------------------
LGT_ENTFA         ------------------------------------------------------------
LGT_CHLAD         ------------------------------------------------------------
LGT_CORGL         ------------------------------------------------------------
LGT_COREF         ------------------------------------------------------------
LGT_MYCTU         IEREQPGDLAGQAPAAHQVDAEAASAAPEEPAALASEAHDETEPEVPEKAAPIPDPAKPD
LGT2_STRCO        GPPGNS--TPRRATESWNVRNRS-------------------------------------
LGT_FRAAA         GAGAGAGEQPVAGAENGAAAVSSGRTRVERPPAT--------------------------
LGT_BIFLO         ------------------------------------------------------------
E3H1X1_ROTDC      KEPGTQEEPADRVQAGDKQDKTPEIPWKKSKS----------------------------
LGT_UREPA         ELRKPEEFLFYCHK----------------------------------------------
LGT_MYCPE         FYRKPSEIFYYNGY----------------------------------------------
LGT_MYCPN         DVLPPKIYRLYDHEMLMFDKLEAVPEA---------------------------------
LGT_AQUAE         ------------------------------------------------------------
LGT_CLOTE         ------------------------------------------------------------
LGT_THET8         ------------------------------------------------------------
D3PSU2_MEIRD      ------------------------------------------------------------
LGT_DEIRA         ------------------------------------------------------------
LGT_ECOLI         ------------------------------------------------------------
LGT_ESCF3         ------------------------------------------------------------
LGT_VIBVU         ------------------------------------------------------------
LGT_SHEON         ------------------------------------------------------------
LGT_PSEA8         ------------------------------------------------------------
LGT_DESVV         ------------------------------------------------------------
LGT_LEGPA         ------------------------------------------------------------
LGT_XYLFT         ------------------------------------------------------------
LGT_GEOSL         ------------------------------------------------------------
LGT_AZOSB         ------------------------------------------------------------
LGT_CAUVC         ------------------------------------------------------------
LGT_RHOPA         ------------------------------------------------------------
LGT_BUCBP         ------------------------------------------------------------
LGT_HELP2         ------------------------------------------------------------
LGT_HELPY         ------------------------------------------------------------
LGT_HELHP         ------------------------------------------------------------
LGT_CHLTR         ------------------------------------------------------------
LGT_CHLMU         ------------------------------------------------------------
LGT_CALS4         ------------------------------------------------------------
LGT_PARUW         ------------------------------------------------------------
E1QE00_DESB2      ------------------------------------------------------------
LGT_TROWT         ------------------------------------------------------------
LGT_DEHMB         ------------------------------------------------------------
LGT_BORBU         ------------------------------------------------------------
LGT_BACTN         ------------------------------------------------------------
LGT_MYCPU         ------------------------------------------------------------
LGT_RHOBA         ------------------------------------------------------------
LGT_LEPIN         ------------------------------------------------------------
                                                                              

LGT_THEMA         --------------------------------------
LGT_SYNY3         --------------------------------------
LGT_BACSU         --------------------------------------
LGT_GEOTN         --------------------------------------
LGT_STAXY         --------------------------------------
LGT_STAES         --------------------------------------
LGT_LACPL         --------------------------------------
LGT_LACGA         --------------------------------------
LGT_LACLA         --------------------------------------
LGT_ENTFA         --------------------------------------
LGT_CHLAD         --------------------------------------
LGT_CORGL         --------------------------------------
LGT_COREF         --------------------------------------
LGT_MYCTU         ELAVAGPGDDPAEPDGIRRQDDFSSRRRRWWRLRRRRQ
LGT2_STRCO        --------------------------------------
LGT_FRAAA         --------------------------------------
LGT_BIFLO         --------------------------------------
E3H1X1_ROTDC      --------------------------------------
LGT_UREPA         --------------------------------------
LGT_MYCPE         --------------------------------------
LGT_MYCPN         --------------------------------------
LGT_AQUAE         --------------------------------------
LGT_CLOTE         --------------------------------------
LGT_THET8         --------------------------------------
D3PSU2_MEIRD      --------------------------------------
LGT_DEIRA         --------------------------------------
LGT_ECOLI         --------------------------------------
LGT_ESCF3         --------------------------------------
LGT_VIBVU         --------------------------------------
LGT_SHEON         --------------------------------------
LGT_PSEA8         --------------------------------------
LGT_DESVV         --------------------------------------
LGT_LEGPA         --------------------------------------
LGT_XYLFT         --------------------------------------
LGT_GEOSL         --------------------------------------
LGT_AZOSB         --------------------------------------
LGT_CAUVC         --------------------------------------
LGT_RHOPA         --------------------------------------
LGT_BUCBP         --------------------------------------
LGT_HELP2         --------------------------------------
LGT_HELPY         --------------------------------------
LGT_HELHP         --------------------------------------
LGT_CHLTR         --------------------------------------
LGT_CHLMU         --------------------------------------
LGT_CALS4         --------------------------------------
LGT_PARUW         --------------------------------------
E1QE00_DESB2      --------------------------------------
LGT_TROWT         --------------------------------------
LGT_DEHMB         --------------------------------------
LGT_BORBU         --------------------------------------
LGT_BACTN         --------------------------------------
LGT_MYCPU         --------------------------------------
LGT_RHOBA         --------------------------------------
LGT_LEPIN         --------------------------------------