CLUSTAL format seed alignment for MF_01148

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

LNT_NOSS1       ------------------------------MGLTVAPFAAWFLAWIALAPLWIFVVSSK-
LNT_SYNY3       ------------------------------MGLATAPLGWTYVAWFGQIPLWIWIFRANT
LNT_THEEB       MWRLPPKSNANAKVLSRWLLFVGLGIAGWGTQLALPPVSGWFLAFVGIVPLWWQCQVLAP
LNT_PROMM       -------------------------MGNDRSLALVQGAVGGVLAGIGIAHG-GLLWMAPA
LNT_SYNPX       -------------------------MGDLRSQPLLRAVLGGLLAGLAPGVA-GPLSMLPA
LNT_PROMA       ----------------------MLALSRSKYFAFLTGTVGGLLAGVGLSQG-GVVFIWIS
LNT_PROMP       ----------------------MINTQNKKFNKYFVPCLGGIFGGIATSTHFWLLFMPLS
LNT_BRUME       ----------------MIARLAGRIILLNGWRRALAAFLSGAFATLTQPPFDIFVAGFVS
LNT_BRUSU       ----------------MIARLAGRIILLSGWRRALAAFLSGAFATLTQPPFDIFVAGFVS
LNT_RHILO       -----------------MERLAGRIILLWGWRRALVAFLAGALAVLGQAPYDFFAACFIS
LNT_AGRFC       -----------------MERLAGRVMLAGGMSRAVMAIAAGAVGALALPPFGFFAALFFS
LNT_BRADU       -----------MSAFQRLRQIALAIILTWGWKRALVAITAGALSVLALAPFNLFPVLFIT
LNT_RHOPA       -----------MTRRGVLSRIASGIILAWGWKRAVIALLAGALSSLAMEPFNAWPVLFIT
LNT_RICCN       -----------------------------MYKPKIICLLLGILSGLVFAPT-FFIPALLT
LNT_RICPR       -----------------------------MYKTKIICLLLGILSGLVFAPI-FFIPALFT
LNT_BORBR       --------MSPAGKGPAWRQPAI---LAAAGAAHALSFAPDPLPAWSLAP-----VQVIA
LNT_BORPA       --------MSPAGKGPAWRQPAI---LAAAGAAHALSFAPDPLPAWSLAP-----VQVIA
LNT_BORPE       --------MSPAGKGPAWRQPAI---LAAAGAAHALSFAPDPLPAWSLAP-----VQVIA
LNT_RALSO       ----MRALFSSPAADTAGQQEALAVPLARLRFAAPLAALLGVMHTLAFAPNRWWWLQILS
LNT_NEIMA       -------MVSKLDKYWQHPA------LYWPLLILFAAA-----TPFTFAPYYHFWLMPLI
LNT_NEIMB       -------MVSKLDKYWQHPA------LYWPLLILFAAA-----TPFTFAPYYHFWLMPLI
LNT_CHRVO       -------MLNAAGGAGCDPSSPTATSPMRILILLLAAALAGAFTLFAFAPYRLFWLMPLC
LNT_NITEU       ---------------------------MNGYFRLIAAFALGVATVSGFAPFYLYPIPVVT
LNT_ECOLI       --------------------MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIIS
LNT_ECO57       --------------------MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIIS
LNT_SHIFL       --------------------MDFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIIS
LNT_ECOL6       --------------------MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIIS
LNT_SALTI       --------------------MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIVS
LNT_SALTY       --------------------MAFASLIERQRIRLLLALLFGACGTLAFSPYDVWPAAIVS
LNT_YERPE       --------------------MSIALFLQRQWVRALLALFFGACGTLAYSPFDHWPAAIVS
LNT_PHOLL       --------------------MNKASLLNCQRLRALLALFFGASGTLAFSPFDFWPAAIIS
LNT_BLOFL       ----------------------MFISKAKYFFQLILSLTFGICGVFAFSPYDFWPLSIIS
LNT_WIGBR       ------------------------------MIKIFTALFFGSLNVISFSPYNFWPASIIS
LNT_VIBVU       ----------------------MKNTLFHRLKRPIAAAFVGALTTLAFAPYQIWLVALIT
LNT_VIBVY       ----------------------MKNTLFHRLKRPIAAAFVGALTTLAFAPYQIWLVALIT
LNT_VIBPA       ----------------------MMNLLFHRLKRPLAAAFVGASTTLAFAPYQLWPIAILS
LNT_VIBCH       ----------------------MNSVLSHRLMRPLAAAFVGVITPLAFAPYQFWPLALLS
LNT_SHEON       --------------MLTNIRAFAQQKSRLSALRLVLAFILGASTALSFAPYSLWIIYPIA
LNT_HAEIN       --------------MKNLNRILLSIKFMNKYFTYLIAIISGLLGVFAFSPFDYWPLAYVS
LNT_PASMU       -------------------MLHYLKKMKKKIFTYFIAIFSGIIGVLAFSPFDYWGCAYLS
LNT_HAEDU       ----------------------MNLVNPSILVACILSFCLGAIGCLAFSPFDIWLIAYLS
LNT_PSEPK       ----------------------MRWITRPGWPGNLLALAAGASTLLALAPFDIWPLAVLS
LNT_PSESM       ----------------------MRWITRPGWPGNLLALAAGGLTTLALAPFDFWPLVLVS
LNT_PSEAE       ----------------------MRWISRPGWPGHLLALAAGALTPLALAPFDYWPLAILS
LNT_COXBU       -------------------------------MNSVLALIAGAILPLAFAPFNWFPIAFVS
LNT2_TREDE      -----------------------MRFFLSFFIIFISSVLFSFGIPNEILNFGSAIAGFSG
LNT2_TREPA      -----------------------MLCTAPLVSSAASAVLLAFAIPNEFWLAGSSVLGLGA
LNT1_TREDE      ------------------MKNKFIFFTLNLLLAVLGAVLFALSHPNYLNLNGFPFFAYIA
LNT1_TREPA      ----------------MRIEEWCRSRLGEFLLFVLAVSLFALSHPNPLLPRGCALLAYGA
LNT_CHLCV       ------------------MFRILSFL-CSWILIAFAQPDMSWFFSLLGSAVGYGLL-WYS
LNT_CHLPN       ------------------MLRIFCFV-ISWCLIAFAQPDLSGFVSILGAACGYGFF-WYS
LNT_CHLMU       ------------------MFKSVLYIGLSWVLVCFAQPDISTLASVICCMCGYGLL-WRG
LNT_CHLTR       ------------------MFKLVSYIILSWVLVCLAQPDVSVVASVVSCICGYSLL-WAG
LNT_HELPJ       ----------------------MRLILFNRNAFLLACMFVSSVYANAV-LDAYAVENPYI
LNT_HELPY       ----------------------MRLLLFNQNAFLLACMFVSSVYVNAV-LDAYAIENPYI
LNT_WOLSU       --------------------MKFRSILAIFGDFRPKSLGIALFGAILFSLFIYLHHFGIT
LNT_HELHP       -------------------------------------------MLPFYAQWVLESYDKAI
LNT_CAUVC       -------------------MIAWTRFRERPWSGPALALIAGLAAALAHPPFGVLPGLLGY
LNT_GLOVI       ------------MSGIALRRRREQAQRRRSIAGVLAAVGGGTALGLAAPPTGWGVLVWVA
LNT_CAMJE       -------MKLKLNFLPYFSFIPKKLNTNSIIFKIIKVFFIAILLSNSIYLSFFENIFTQT
LNT_BORBU       ------------------------MKTRCFCLAAFSGILTTLAIPNEIKETGYSILGFVA
LNT_GEOSL       ----------------------MPGFNAVPRRDYVMAALSGVLLALSFPKPGFSILAWVA
LNT_RHOBA       -----------------------------MRWLSAASSAFAVVLWLSGPPFAIGPLVFIA
LNT_THEMA       --------------MNRRRWWRSSERRWRGLVSLFLSVLSGFLTALSMPGFLSGALIWFS
LNT_AQUAE       -------------------------MLTDRHKEVLKGLLAGILFYLSFSKLNLYFLVFPA
LNT_BDEBA       -------MDSLTLYVTNTMMKRWFQFFKHKAYDFRWAILSGILVGTSYIPFPPWALIFCY
LNT_CHLTE       --------------MNGAYRGALSRLLSKPFFLPLLSGLLLGISFPTWPAVHLEPLAWIA
LNT1_LEPIN      -------------------MFYNFISKDSILYRLILCFGIGIGTVFGLSPFSFFSAGVFA
LNT2_LEPIN      ---------------MDTLHHRFQQFQKTIWFNIFCYLWTGIFSFLAFAPVSLTHFVWIA
                                                                            

LNT_NOSS1       -RKNYPP-----SSLLLL--GLTWGIGYHGVALFWITGIHPMDWLGVPWWPSLAITIFCW
LNT_SYNY3       TRLNFTQLKQFLISRSLT--AIAWGGGFYGVALFWITGVHPLTWLGVPWLASLAIAAFCW
LNT_THEEB       ------------LWAAIA--GLCWGWGFYGSSLVWVWDLHPLTWIGIDPVPSWLISRGIW
LNT_PROMM       LALLWSA-----CRFPVA--ASLWGFVAVLLSHRWLLALHPLTWVGVPAPLSVPVAASIW
LNT_SYNPX       LALLWSL-----VERPRD--AALWGLFGVLLSHRWLLGLHPLTWMGLPAWLSLPVAVAIW
LNT_PROMA       TACLWAS-----MAFPSA--VFLWGLFAILLSYRWLLYLHPLTWIGVPIAFSLPIAILIW
LNT_PROMP       LFILWSR-----SDKKLA--NFLWGFFFILVSHSWLYELHPLTWLGFSWISSLIISISIL
LNT_BRUME       FPVLVWLIDGAIARTDAGPLRRLLLAAKVGWWFGFGYFVSGLWWIGTALLVDADQFAWAL
LNT_BRUSU       FPVLVWLIDGAIARTDAGPLRRLLPAAKVGWWFGFGYFVSGLWWIGTALLVDADQFAWAL
LNT_RHILO       FPLLVWLLDGATGEASGSLFRRLLPAFAVGWWFGFGYFLAGLWWIGSALLVEADEFAWAL
LNT_AGRFC       FTLLVWLVDGCTGKPGGGLFSRILPAFGIGWCFGFGYFVAGLWWLGNALLLEADEFAWAL
LNT_BRADU       FPVLVWLIDGAGA----GRYRGIPAAALTGYWFGLGYFVPGLYWIGYAFFVDADVFAWLT
LNT_RHOPA       FPIAVWLIDGSAA----GKRRGVPAAAMAGWWFGFGYFVPGLYWIGYAFLVDADTFAWLL
LNT_RICCN       LSYLCYIVQKSEN---------WQEATKFGYLFGFGHFLSGIYWISIGVSVYIADFWWAI
LNT_RICPR       FSYLCYIVQKSQN---------WQVAAKFGYLFGFGHFLSGMYWISIGVSVYIADFWWAI
LNT_BORBR       LAVAAHASLQAPSA---------RRALARGWLFAMFSFSLGLYWLYVSMHDYGGLAAPLA
LNT_BORPA       LAVAAHASLQAPSA---------RRALARGWLFAMFSFSLGLYWLYVSMHDYGGLAAPLA
LNT_BORPE       LAVAAHASLQAPSA---------RRALARGWLFAMFSFSLGLYWMYVSMHDYGGLAAPLA
LNT_RALSO       LAGLAALVRQAPRL---------RDVAWVGYAFGLGWFLSGIWWLYISMHVYGDMPAWMA
LNT_NEIMA       FGAFVRLIELR--P---------RFAVSSAYLFGLTAYTTQFYWIHTALHDVSGLPDLYA
LNT_NEIMB       FGAFVRLIELR--P---------RFAVSSAYLFGLTAYTTQFYWIHTALHDVSGLPDLYA
LNT_CHRVO       LAALVELLQRE--P---------RRAFWLGYAWGLGAYVSNFRWIYDSLHDVAGLPAWIA
LNT_NITEU       LALLALLWRRSRTP---------GQAALTGFTFGMGLFGAGVTWLYVSLHDFGHMEPALA
LNT_ECOLI       LMGLQALTFNRRP----------LQSAAIGFCWGFGLFGSGINWVYVSIATFGGMPGPVN
LNT_ECO57       LMGLQALTFNRRP----------LQSAAIGFCWGFGLFGSGINWVYVSIATFGGMPGPVN
LNT_SHIFL       LMGLQALTFNRRP----------LQSAAIGFCWGFGLFGSGINWVYVSIATFGGMPGPVN
LNT_ECOL6       LMGLQALTFNRRP----------LQSAAIGFCWGFGLFGSGINWVYVSIATFGGMPGPVN
LNT_SALTI       LIGLQALTFNRRP----------LQSAAIGYCWGLGLFGSGINWVYVSIAQFGGMPGPVN
LNT_SALTY       LIGLQALTFNRRP----------LQSAAIGYCWGLGLFGSGINWVYVSIAQFGGMPGPVN
LNT_YERPE       LFGLLSLTLNRTT----------KQATFIGFCWGMGLFGSGINWVYVSISEFGGMPTAIN
LNT_PHOLL       LFGLQLLTLNRTP----------RQAAFIAFCWGFGLFGSGTNWVYVSIANFGGMPTTVN
LNT_BLOFL       ITGLLIIILSNITW---------KQIIWNTLFWGIGFFSVGLHWIYIGIDQFIPTHKNMN
LNT_WIGBR       IFGLLIITTNCKNL---------INSAKLGFLWGIGNFFNEIYWIYISINKFFGINLFFS
LNT_VIBVU       PALLLILIHGQSR----------RQALWTGYAWGFGQFASGISWVYVSIAGFGGMPLAAN
LNT_VIBVY       PALLLILIHGQSR----------RQAIWTGYAWGLGQFASGISWVYVSIAGFGGMPLAAN
LNT_VIBPA       PAILLILLANQTP----------KRALWIGYAWGLGQFATGVSWVYVSISGFGGMPLIAN
LNT_VIBCH       PFILLLLLHQQSA----------KRAALIAYLWGIGQFAVGISWVHVSIDTFGGMPKIAS
LNT_SHEON       MSLALWQSESLNP----------KASFFHWLSFGFGCFAVGISWVHVSMDTFGGLPLPAS
LNT_HAEIN       LLGLLYVAKNPKK----------STALLSTFLWAMGFFCFGVSWLNVSIHQFGGASLGVS
LNT_PASMU       LLGLIFVAKTAEK----------KTALWSAFLWGLAFFTFGINWVHVSIHQFGGASVVVS
LNT_HAEDU       AAGLIWAATLVER----------KTAMLATFAWSIGYFGVGVQWVNVSMTQFGGVPVIVS
LNT_PSEPK       IAVLYLGLRELSP----------RQAMWRGWWFGFGLYGAGTWWIYVSMNTYGGASPLLA
LNT_PSESM       VAMFYLGLRELSP----------RQALARGWCYGFGLYGAGTSWIYVSIHTYGGASALLA
LNT_PSEAE       IALLYLGLRGLPG----------KSALWRGWWYGFGAFGAGTSWIYVSIHDYGAASVPLA
LNT_COXBU       PAILLAVWLRSRP----------LVAWWRGWLFGFGFFGAGASWVYVSIHHFGNANVPLA
LNT2_TREDE      LVLVYYALLNCGSH--------KRAAFLYGFFVSFVHLMSSFWLAFFEDFAIFTLGASTL
LNT2_TREPA      LVPLYVGFLLSPAK--------KHVACSYGLFVALVHACSSFWLKNFQGFALFTLGASTV
LNT1_TREDE      LIPFFL-LLKRTKL--------KFSFLWGAFSGALSYFIFNFWIIFFHPLAIYIIIAKYC
LNT1_TREPA      LAPLFL-LVRWASG--------FAVVFWGGAYGAFSYGAFSYWLFVFHPVALCVVAGFSA
LNT_CHLCV       LEPQKSPKLSWRQL--------TSLLFLWSVTVYGVHFSWMLSDLYVGKFIYVVWGVLIS
LNT_CHLPN       LEPLKKPSLPLRTL--------FVSCFFWIFTIEGIHFSWMLSDQYIGKLIYLVWLTLIT
LNT_CHLMU       LLSLVD-SSSWRKI--------WCLAFFWTWSVEGFHFSWMLEDFYVGTSIYFVWCLLIS
LNT_CHLTR       LFALVE-QLSWKKV--------WCIAFIWTWTVEGAHFSWMLEDLYVGTSIYFVWGILLS
LNT_HELPJ       TITLTSLLAPLSML--------AFLKTPRNSAFALGFFVGALLFYWCALSFRYSDFTYLL
LNT_HELPY       SITLTSLLAPLSML--------AFLKTPRNSAFALGFFVGALLFYWCALSFRYSDFTYLL
LNT_WOLSU       SPLLYSLLALLALA--------FYLKLPRESGFAFGFWVGIAWFYWMALSFRYYELTYLI
LNT_HELHP       SPLLVSLLGLFSIA--------SVLFVPKNRRFGVGFFIGMLWFYWISLGLRYFDMSFLI
LNT_CAUVC       AGLLHLLDNADVQRP-------LRSVFWRGWLAGVGYFGLGTWWVGEAFLVDAATHGWMA
LNT_GLOVI       LVPLLVYLRAEHRPRAFW-LGTLAGMVYYAILLRWLLGFHPLTWLGIEWWPSLAIALGAW
LNT_CAMJE       ISPFLAIWGLVLLL----------KSKTSKQYFWIGFFVGILWFWWIGLSSIYFNLNYLV
LNT_BORBU       YVPLFIALNKLEDK--------KALMGLTVFYFIIANSLQNFWLGFFHAFGWITFIGVII
LNT_GEOSL       LVPLLLACGRKAPA----------VAFRLGFTAGLVAYAGILYWINIAVVTYGRLHWSVS
LNT_RHOBA       LVPLLAIAEVSPSS----------SWKRPLYAASLAYWLLSLQGLRYAHPLMFLPWIALS
LNT_THEMA       LIPLLYAVEGRGVW----------KRAFLSFVYFFTHVLISFFWVLPTLTENVPLVFGRY
LNT_AQUAE       LFLGI------------------RKNFLRLFSFGFSAFFLSLLWIRIPLIDYGNINPFIA
LNT_BDEBA       TPLWIYVTEESSS---------VKKSFWAGWVTQFILTLIGFHWIAYTAHEFGQLPWAVS
LNT_CHLTE       LVPLLLSLEHEERF---------GPFFRKSWMSMLLFCLIALWWVCLATFVGGILTVFVQ
LNT1_LEPIN      SISCIFLFFSLNRTS-------IWKAFLWLLILSQILNFTAFYWIPGAISRISGVNTFVS
LNT2_LEPIN      PFGFFWLSLKYHGK--------YKKLFFHGLLIGVVFYAISFHWIIHMAITFGNFPYVVA
                                                                            

LNT_NOSS1       SFISFYGGLFGAIWAACLTHISEQ---------------KSWLRILIGTAMWCVLESLWS
LNT_SYNY3       LAITAWGVVLVFVWLLAMAVWEVTTART-----KVNSTFKKYLFILWGTASWCGLETLWS
LNT_THEEB       LCLSSWGAVLSGSWALLMARYGVRR--------------SAPWQLLWGVTLWCALEALWS
LNT_PROMM       LFCGAAAAVLVGLWAWLGTSIAHLATR------EAGIRAQLS-HALLMASIWGLAEVLLA
LNT_SYNPX       LSCGVAAALLLLLWSLL----ARLCRR------RDG-TWRFG-AVLLLALVWGAAELLLE
LNT_PROMA       FSCGLLGGLLVALWSLIGQIPFFQRRL------NSSTKDQLL-YVIALSLIWGLVEVGLA
LNT_PROMP       FGCSIIGGILVYLWGLLVKKILQKKEI------SNMNSLRLTIKVLLLSFAWGIGEFILS
LNT_BRUME       PLAVLGLPAFLALFYAFAAMI------------ARLLWSDGLGRILAFAFGFALAEWLRT
LNT_BRUSU       PLAVLGLPAFLALFYAFAAMI------------ARLLWSDGLGRILALAFGFALAEWLRT
LNT_RHILO       PFAVVGIPFALAFFYGFATLV------------ARLLWSSDIGRIAALAFGFGLTEWLRG
LNT_AGRFC       PLAILGLPALLALFYGFAVAA------------ANLLWSDGLGRIAALAAAFGVSEWLRS
LNT_BRADU       PFAVLGLPAYLSIFTAIGFAL------------ARLLWTKNATRVLALAASLTIAEWLRG
LNT_RHOPA       PAAICGLPAYLALFTALGFAL------------ARLLWRPDSLRILSLAVSLTISEWLRG
LNT_RICCN       PFALFGLPIVLACFISASCTL------------SFFAKNNK-YYQFIFCLCWVLFEWVRS
LNT_RICPR       PFALFGLPIILAFFISANCTL------------SFFAKNNK-YYQLIFCLLWVLFEWIRS
LNT_BORBR       AAGVLALSAFLALFPGLACAAARWLCPPHWDASPPARARRTLYTAATWAACWAALEWLRA
LNT_BORPA       AAGVLALSAFLALFPGLACAAARWLCPPHWDASPPARARRTLYTAATWAACWAALEWLRA
LNT_BORPE       AAGVLALSAFLALFPGLACAAARWLCPPHWDASPPARARRTLYTAATWAACWAALEWLRA
LNT_RALSO       AAAVLLFSAYLALHPALAA----WL----WQRLARGRQLSGAASALVFGAAWLVSEWLRG
LNT_NEIMA       VPLTFLLPAYLALYPALCF-----------WLWKKFTLPRGIKIGLVLPILWTLTEFARE
LNT_NEIMB       VPLTFLLPAYLALYPALCF-----------WLWKKFTLPRGIKIGLVLPILWTLTEFARE
LNT_CHRVO       APLVLLLPAYLALYPGLAS-----------WLACRIDPRPGVRWLLAFPAAWELGEWLRG
LNT_NITEU       VLALIILCAYLALFPALTG-----------WITAFRHFRASWAWPGMVAALWALAEWLRG
LNT_ECOLI       IFLVVLLAAYLSLYTGLFAGV--------LSRLWP--KTTWLRVAIAAPALWQVTEFLRG
LNT_ECO57       IFLVVLLAAYLSLYTGLFAGV--------LSRLWP--KTTWLRVAIAAPALWQVTEFLRG
LNT_SHIFL       IFLVVLLAAYLSLYTGLFAGV--------LSRLWP--KTTWLRVAIATPALWQVTEFLRG
LNT_ECOL6       IFLVVLLAAYLSLYTGLFAGV--------LSRLWP--KTTWLRVAIAAPALWQVTEFLRG
LNT_SALTI       VFLVVLLAAYLSLYTGLFAGI--------LSRLWP--KTNWLRVAIAAPAIWQITEFLRG
LNT_SALTY       VFLVVLLAAYLSLYTGLFAGI--------LSRLWP--KTNWLRVAIAAPAIWQITEFLRG
LNT_YERPE       IVLVILLAAYLSLYTMLFAGL--------LARLCP--KATWWRLAIAAPVLWQLTEFLRG
LNT_PHOLL       ILLVILLAAYLSLYPALFAAL--------LNRFFA--KTNGLRLAVAAPALWQLTEFLRG
LNT_BLOFL       FFLIAFLIIYLTCYSVLFSII--------LVTLRLF-ITQWSFLSITAATLWLIIDRLRG
LNT_WIGBR       IIIILLLSSYLSLYPTIFVIL--------TKFFFP--KINFFLFCVGAPSAWMISEILRS
LNT_VIBVU       LFLMGALIAYLAIYPALFTWS--------YQRFFAKATLL--NLLLAAPALWLIADWLRG
LNT_VIBVY       LFLMGALIAYLAIYPALFTWS--------YQRFFAKATLL--NLLLAAPALWLIADWLRG
LNT_VIBPA       LFLMGMLIAYLAVYSGLFAWL--------NNKFFPQFSLS--KALLAAPALWLITDWLRG
LNT_VIBCH       LFLMTLLVGYLALYPSLFGWL--------LNRLFPNNSRS--KWLCAAPALWLITDWLRG
LNT_SHEON       VALMALLALYLALYPALTGLG--------LAWFTRTNSHSLWRNLLLFPALWTLTEWARG
LNT_HAEIN       YFLVGLLAAYLALYPMLFTYL--------VHHFKV-------QSAVIFAVIWTLTEFLRG
LNT_PASMU       YVLVLVLAAYLALYPMLFAYL--------IQRFQI-------SSLAMFPVIWTFTEFLRG
LNT_HAEDU       YLAVLLLASYLGLYNLLFSYL--------ARRFGL-------ISPFVLASLFTFTEYLRG
LNT_PSEPK       IVLLLAFFAALAWFFALPTWL--------WARWLRR-NEAPLADALCFAALWLLQEAFRG
LNT_PSESM       GLLMLLFIAAIALFFALPAWV--------WARWLRR-NEAPLADSLAFAALWLWQEAFRG
LNT_PSEAE       SLLMLGFTAGVAFFFALPAWL--------WARCLRR-DNAPLGDALAFAALWLALELFRS
LNT_COXBU       VLITVLFVFVLALFIAFQGLS--------FSLFFRK-RKAALTALFAFPAWWVVWEWLRS
LNT2_TREDE      AYFFIAMPFGFLLY---HSLQ-----------------KRENLRPFFFAAIWLLWEFAKS
LNT2_TREPA      GYFFYALPFGVAFA---CILR-----------------KQAPARACAFALVWTLWEWVKS
LNT1_TREDE      ILYSVLFFVLKIID---SYFS-----------------RYS---FIFQTIAWVAFEYLNT
LNT1_TREPA      LFLAALCLALKAGG---AFWQ-----------------RRA---LLVQCLVWLGYEYAKT
LNT_CHLCV       LLALLFTAFSCLLF---FIVR-----------------KKHTKILWCLPGLWVAVEMVRF
LNT_CHLPN       ILSVLFSGFSCLLV---AIVR-----------------QKRTAFLWSLPGVWVAIEMLRF
LNT_CHLMU       YLAVTFASFSCLVV---LCFR-----------------KQYWGALFWLPGVWVAIESVRY
LNT_CHLTR       YLATLFASFSCLVV---WCCR-----------------KQYRGALVWLPGVWVAIEAIRY
LNT_HELPJ       PLIIVLVALVYGVLFYLLLYF---------------------ENPYFRLLSFLGSSFIHP
LNT_HELPY       PLIIVLIALVYGVLFYLLLYF---------------------ENPYFRLLSFLGSSFIHP
LNT_WOLSU       PFILLGIGGVYGVLFSMALYL---------------------KNPLVRALLLWLLSHVQP
LNT_HELHP       PLVVIACGIFMGFVFYIGLWC---------------------ECLIVRFAFLLLLSYLTP
LNT_CAUVC       PFAVTGMAAGLALFWGLAALL------------YRALRPASAWRVLTFAGAFAALEWMRG
LNT_GLOVI       LFVSASQAWVIGLWASLVVRT----------------RLSGLRRVLFAVGLWVGLHWLWG
LNT_CAMJE       PIIPIIIGFIYGLLFRLCYLL---------------------KFDFLRLCGIFCISFIHP
LNT_BORBU       GYIPYSLTLGYFLYYSLKSFK---------------------NKTMSITMLFTFYDYSRS
LNT_GEOSL       IVIFLMLAGYLALYPAATAYVVR------------RGEDRGISALLAFPVVWVGLEYIRS
LNT_RHOBA       GYLAIYPVLFIALLRRLRLVD---------NCDVSQARRDRVPLCLVAAVVWVGLEWIRN
LNT_THEMA       PSWLGIVVFVLMGIIEAVPFLG-------FGFLSYFAPQSIVLKTLYLASVYTIFEYLRG
LNT_AQUAE       YPALVLLVLFLSLYQFGLTYL---------------LWRVFKFSFFAFPFLYTLVEILRS
LNT_BDEBA       YLALLLFCAFMHLYIPVAVAAG--------TWLRLRFKLSGGQTLFTIALLHALLERTWP
LNT_CHLTE       SLFSVVPLVVFYYFKKRAGFR---------------------SALLALPFIWTGWEWAYM
LNT1_LEPIN      ILFFFLYGLISHLKFFLFYTL-------------FRFSKIDSASKTYILLIFPAAGTLSD
LNT2_LEPIN      ILILLFAGLLFGLKFPIFMMS-----------FSFLSGKIGRHSVWVAGFCGLLSELIGP
                                                                            

LNT_NOSS1       ---AGPLWWSSLAYTQSPHNLAILHLGQISGPNLVTAAIVSVNGIVAEAWLN--------
LNT_SYNY3       ---HSILWWSPVAYTQSPSQLHFLQWGAIGGPALLSAFIVAVNGFLALGLIDFLDGKTV-
LNT_THEEB       ---HSPLWWISLSLTQSPG--GLVQLGRLAGPTTITAVVMTVNGLVTLSLRQ--------
LNT_PROMM       ---GSPLFWIGVGGSLLPGDRALAGLARWFGAGGLATLQLLIGWWLWRTALAW-------
LNT_SYNPX       ---GSPLFWIGVGGSVLPLDRPLAGLGRWLGSGGLATLQLLWGWGLWQLWRRR-------
LNT_PROMA       ---KSPFFWFGLGDSLLPYDRWLAGLARWFGSGGLAALQLILGWWVWKIIFAF-------
LNT_PROMP       ---QTPLFWIGLGEGIVPGDLYLAGLARWIGASGLCVVQLTIGFWIYLIYEKW-------
LNT_BRUME       -FIFTGFPWNLIGYAAMP-VPLLMQSVAVIGLVGMSALAVFVFAAPALLTGGHFAR----
LNT_BRUSU       -FIFTGFPWNLIGYAAMP-VPLLMQSVAVIGLVGMSALAVFVFAAPALLTGGHFAR----
LNT_RHILO       -FLFTGFPWNAIGYAAMP-VPLLMQSVSVTGMIGMNVLAVFLFSLPALLVARRHLR----
LNT_AGRFC       -FLATGFPWNAIGYGIMP-IPIMMQSAHLLGLLSITTLAVFIFASPALIGTKKGMG----
LNT_BRADU       -HALTGFPWNAFGYALSE-PLPLAQTASLIGLWGMTFLTVAIFASPATLIDRTPDRRVA-
LNT_RHOPA       -HLLTGFPWNAFGYALTE-PLVLAQSISVIGIWGLTLLTVAIFASPAVLIDGGTNTRRR-
LNT_RICCN       -WIFTGLPWNLIGYAFSF-SDILIQPLSIIGIYGLSFIVIYISTSAYPLFSKQFTQLK--
LNT_RICPR       -WILTGLPWNLIGYAFSF-SEILIQPLSITGIYGLSFIVIYISTSAYPVFTKKFTQLK--
LNT_BORBR       -VVLTGFPWLNIGYAHVD--SPLAGWAPLLGVHGMALLAAFAAAALAGLWQSASGR----
LNT_BORPA       -VVLTGFPWLNIGYAHVD--SPLAGWAPLLGVHGMALLAAFAAAALAGLWQSASGR----
LNT_BORPE       -VVLTGFPWLNISYAHVD--SPLAGWAPLLGVHGMALLAAFAAAALAGLWQSASGR----
LNT_RALSO       -TEWTGFPWLNGGYAHTD--GPLAGYAPLVGVYGVVAIA----ATLAGLLCAAAER----
LNT_NEIMA       -RFLTGFGWGAIGYSQITPDSPLAGFAPFGGIHMVTLATAFLGVWLVLASDNTARS----
LNT_NEIMB       -RFLTGFGWGAIGYSQITPDSPLAGFAPLGGIHMVTLATAFLGVWLVLASNNTARS----
LNT_CHRVO       -WVMTGFPWGAAGYSQIT-ESPLAGYAPLGGIHLVNYLVALSAAALAMLARAGMR-----
LNT_NITEU       -TLFTGFPWLTVGYSQAP-ASPLAGFAPVIGVYGLSLLLMLSAAWLACWLENRQS-----
LNT_ECOLI       -WVLTGFPWLQFGYSQID--GPLKGLAPIMGVEAINFLLMMVSGLLALALVKRN------
LNT_ECO57       -WVLTGFPWLQFGYSQID--GPLKGLAPLMGVEAINFLLMMVSGLLALALVKRN------
LNT_SHIFL       -WVLTGFPWLQFGYSQID--GPLKGLAPLMGVEAINFLLMMVSGLLALALVKRN------
LNT_ECOL6       -WVLTGFPWLQFGYSQID--GPLKGLAPIMGVEAINFLLMMVSGLLALALVKRN------
LNT_SALTI       -WVLTGFPWLQFGYSQVD--GPLKGLAPVMGVEAINFLLMMVSGLLALALATRN------
LNT_SALTY       -WVLTGFPWLQFGYSQVD--GPLKGLAPVMGVEAINFLLMMVSGLLALALATRN------
LNT_YERPE       -WVLTGFPWLQFGYSQIN--GPLRGIAPLLGVDGITFILMAISGLLVYACYQRR------
LNT_PHOLL       -WILTGFPWLQFGYSQLD--GPMKAIAPILGVEAITFLLMALSGLFVLAVIHRK------
LNT_BLOFL       -NEFIGFPWLQFGYSQIS--GPIRGIGPLLGVEGITFCLVLISSLLALSIRTVQ------
LNT_WIGBR       -KILTGFPWLEIGYSQIN--GPLKGLAPIIGVSGISYILIIISGMCVLSFYKKS------
LNT_VIBVU       -WVMTGFPWLWLGYSQID--SPLASFAPIGGVELLTLLLLVGAGAIAYAVIHKR------
LNT_VIBVY       -WVMTGFPWLWLGYSQID--SPLASFAPIGGVELLTLLLLVGAGAIAYAVIHKR------
LNT_VIBPA       -WVMTGFPWLWLGYSQID--APLASFAPIGGVELLTLFVLISAGALAYAWIHKQ------
LNT_VIBCH       -WVMTGFPWLWLGYSQID--SPLANFAPIGGVELITLLLLFCAGSLAYAVLNRR------
LNT_SHEON       -WVLTGFPWIWAGYSQTE--GPLKALASIIGALGLSFIIAMIAGALALCFSKRY------
LNT_HAEIN       -WIFTGFPWLQFGYTQID--SPFYGIAPIFGVTGLTFFTVWASAVIFNLVSSLF-KTKN-
LNT_PASMU       -WLFTGFPWLQFGYSQID--SPFAHLAPMFGVTGVTFFVMWVSAVIFNLLSVLLIKPRK-
LNT_HAEDU       -VVFTGFPWLQFGYTQID--SPFAQLAPIFGVEGLTFLVILLSSYLVDIV-------KN-
LNT_PSEPK       -WFLTGFPWLYAGYSQLD--GPLAGLAPLGGVWLISFTLALTAALLCNLHRLRP------
LNT_PSESM       -WFLTGFPWLYSGYSQLD--APLAGLAPVGGVWLISFALGLTAALLCNLHRLRA------
LNT_PSEAE       -WFLTGFPWLYAGYSQLQ--GPLAGLVPVGGVWLSSFVIALSAALLVNLPRLFP------
LNT_COXBU       -ILFTGFPWLFLGYSQIN--SPLKGFGPLFGIYGISLIVAFISGCIYLLVTSK-------
LNT2_TREDE      TGFL-AYPWGTAPMICFN-LKPFIQFVDITGVWGLSFIVPLIAACLGEALQTYAYSAN--
LNT2_TREPA      TGIL-AYPWGTVPMTAHS-LSHLIQIADITGVWGLSFLIPLANACVAESLHFFIKKRD--
LNT1_TREDE      LGFL-GYSYGIMGYTQWN-FPILIRVSSIFGVWGISFLLVFFSACSASFLFEFYKEKD--
LNT1_TREPA      LGFL-GFPYGVMGYSQWR-VLPLIQVASVFGVWVVSALVVFPSAWLASVLGQWVEESERN
LNT_CHLCV       YFLCSGMSLDYLGWPITA-NAYGRQFGGFFGWAGESFILVATGISFYQV-----------
LNT_CHLPN       YGIFSGMSFDYLGWPMTA-SAYGRQFGGFLGWAGQSFAVIAVNMSFYCL-----------
LNT_CHLMU       YGLLSGVSFDFIGWPLAA-TAYGRQFGSFFGWAGQSFVVIATNLGCCSVL----------
LNT_CHLTR       YGLLSGVSFDFIGWPLTA-TAYGRQFGSFFGWAGQSFLVIAANICCFAVC----------
LNT_HELPJ       ----FGFDWLVPDSFFSY---------SVFRVDKLSLGLIFLACIFLSAQNLKK------
LNT_HELPY       ----FGFDWLVPDSFFSY---------SVFRVDKLSLGLVFLACIFLSTKPLKK------
LNT_WOLSU       ----FGFDWMVPEVMLVP---------SLLDSSKLSFGLILLSLSLFWLLPQRW------
LNT_HELHP       ----FGFDWIVPESVFAY---------SYIGVDKLSFALSILALWILFKYKTWW------
LNT_CAUVC       -HVLTGFPWNLPGETWKA-GSAPSQLAALVGAYGLTWITLAIAGAPAVWRQGRGGR----
LNT_GLOVI       -QGETAFPWGTLAQSLAG-DLWAVQTVALGGAQLLVGLAVAVNALVAESWSTRR------
LNT_CAMJE       ----LGFDWFNWGIFTVY---------GFFDPSYRGIICIFLIAYFIYEGYISR------
LNT_BORBU       -IGFLAYPWGLAAFTVNN-FNNLIQIADIFGVFFVSFAVYFLNSGIADFLIHKNKTNLL-
LNT_GEOSL       -FLLTGFPWASLGYSQYR-TLPLIQIADLTGVYGLSFLIALSNVVLYRIIRGFAARERA-
LNT_RHOBA       -YFFTGISVLMLGHALAD-MPMLIQIADLGGTYAVSFVIVCVNVAMFDALNRWVVQRTSS
LNT_THEMA       -VGELGFTGGRISEALYS-HTGLIQIVSITGTLGLVFLIVSLNVLFYEFLRRRK------
LNT_AQUAE       HLPYGGFPWLLLGVNLVD--IPVLRYTLNAGTVFLGSFVVLLISLFPLFNKKEK------
LNT_BDEBA       -----VIFEWHLGYTLIWSKIPMYHLADLVGFHGLSAVVLLFNAWMGYVWLKQSFV----
LNT_CHLTE       -QQDFSLGWLTFGNSQAN-LLWMVQYADVTGVWGVSFWLLTFNVLVLLLFMEKES-----
LNT1_LEPIN      MITFQIFPWYWGNLISGS--IVFEQFASICGVYGLSFLLLFISSTFLILVNYYKYKNSK-
LNT2_LEPIN      ----QLFPWYWGNLAAGN--IILAQNAEITGVYGISFLVFIVSYTLFQSNPWHWKEIIHS
                                                                            

LNT_NOSS1       ---RKQGLLGRYLAIATGLLITLHLIGFGLYTAPIAKSSDTALKVGIVQGNIPNKIK---
LNT_SYNY3       ---NKNKQNWHYFLIAILIWLFCQGGGWLLYQKPLADTPEEKINVGIIQGNIPNQIK---
LNT_THEEB       -------QKWARVGLAMTLVAAIALNG-VLSVRVMADRGE-PLRVGLIQGNIPTREK---
LNT_PROMM       ---RRGVGWRRSLLVGLLCLLLAHGFGWSLLRSSDATAPI---SVAAWQPAIPTRSK---
LNT_SYNPX       ---GRRCAWW------LISLLLAHAMGALSLSPPPALAAL---RLGAWQPAIPTREK---
LNT_PROMA       ---KKGSPWLGLFALGVCSLLLAHCIGWILLADNEFTSSK---RIALWQTNIPTRQK---
LNT_PROMP       ---KRKYHFKKTFLFGLLILVILHFLGGLTN-PIERNNDY---PVALWQTNMPTREK---
LNT_BRUME       ---------TGIGLAIFLALAHVGFGAWTLSRAPAIVDENGPLAVRIVQPSIAQAMK---
LNT_BRUSU       ---------TGIGLAIFLALAHVGFGAWTLSRAPAIVDENGPLAVRIVQPSIAQAMK---
LNT_RHILO       ---------LGAALFVLLASAHVGFGYIRLAAPEKPAERS--LDVRIVQPAVDLSEK---
LNT_AGRFC       ---------PGLALAGLLLAAHFGYGFYRLQTPAETPADA--LTVRIVQPAIDQSRK---
LNT_BRADU       --------WRAPAAAVALLIAMSIFGAIRLSLHPTTMVAG--AKLRLMQPNLQQDAK---
LNT_RHOPA       --------WAVPAMALGVLAAMTVFGGIRLKLSPTQLVDN--VRLRIMQPNLPQDAR---
LNT_RICCN       ---------ILLASSVLVLTIIVIYGAVRLSNNHTNFTDI---KVRLVQPSIPQTEK---
LNT_RICPR       ---------ILLASSMLILTVMVIYGAVRVSTNPTNFTDI---KVRLVQPSIPQTAK---
LNT_BORBR       --------IDSRQALAAGVALLLAGAGWLLGQFSWSRPEGKPLHLRLVQGNVEQSQK---
LNT_BORPA       --------IDSRQALAAGVALLLAGAGWLLGQFSWSRPEGKPLHLRLVQGNVEQSQK---
LNT_BORPE       --------IDSRQALAAGVALLLAGAGWLLGQFSWSRPEGKPLHLRLVQGNVEQSQK---
LNT_RALSO       --------RLHWLAGLAGVAVL--AAGWPLHTIAWTQPVGKPITVRLLQGNVPQDVK---
LNT_NEIMA       --------GKRLLPIILIAALL--AAGYTARQTDFTRPDGSRSTVALLQGNIDQTLK---
LNT_NEIMB       --------GKRLLPIILIAALL--AAGYTARQTDFTRPDGSRSTVALLQGNIDQTLK---
LNT_CHRVO       ---------QRIGILIAAALAW--GSGVWLRDIEWTTPAGKPITVALAQGNIAQELK---
LNT_NITEU       -----------HRFWLGLGSVW--LIGFGLQQIHWTQPEGEPVTVSLLQGNIPQNMK---
LNT_ECOLI       ------------WRPLVVAVVLFALPFPLRYIQWFTPQPEKTIQVSMVQGDIPQSLK---
LNT_ECO57       ------------WRPLVVAVVLFALPFPLRYIRWFTPQPEKTIQVSMVQGDIPQSLK---
LNT_SHIFL       ------------WRPLVVAVVLFALPFPLRYIQWFTPQPEKTIQVSMVQGDIPQSLK---
LNT_ECOL6       ------------WRPLVVAVVLFALPFPLRYIQWFTPQPEKTIQVSMVQGDIPQSLK---
LNT_SALTI       ------------WRPLAVAVILFALPFPLRYIQWFTLEPTKATQVSLVQGDIPQSLK---
LNT_SALTY       ------------WRPLAVAVILFALPFPLRYIQWFTLEPAKATQVSLVQGDIPQSLK---
LNT_YERPE       ------------IVAAIIALALLLLPWPLRQIQWFTPEPERAVNIAMVQGNIAQSMK---
LNT_PHOLL       ------------IVAGIIAVAILLLPWPIRHYQWYSLLSEKTVDVALIQGNIPQSLK---
LNT_BLOFL       ------------PSPYYISLIILACLYPLSWIQWYQVQPQRMTTIALVQGNINQHLY---
LNT_WIGBR       ------------YYPIIFIIFIITLTYPLNFFKWYSVK-EKSTKIALIQGNISQHTY---
LNT_VIBVU       ------------WSMLLIPTVLLSTGYGLSHWDWVTPQPDKTTKVALIQGNVDQNLK---
LNT_VIBVY       ------------WSMLLIPTVLLSTGYGLSHWDWVTPQPDKTTKVALIQGNVDQNLK---
LNT_VIBPA       ------------WLMIIIPVVLMSAGFGIRQYDWVTPRPEDTTKVALIQGNVDQNLK---
LNT_VIBCH       ------------WLMACIPLVVYATGYGLQAMQWVTPQTERTASLALIQGNIEQGLK---
LNT_SHEON       ------------KSLLILLPITAVAAWVAPKLSQIQPTGE-SVKVALVQGNIPQSMK---
LNT_HAEIN       -------LKLVLANALLLIIVGGLSAYSSRIHFVKSVEDKA-ISVTLAQGNIEQNLK---
LNT_PASMU       -------WNVVIANLLLLTLVGGLSAYSSKAEYVRKIEDRD-LLVTLAQGNIEQNLK---
LNT_HAEDU       -------PTRKIATFTKIAVIIGFSLASNLLQFVQIDQQKPPVKVALIQANIEQQLK---
LNT_PSEPK       --------RPSFLAVASVLLLAPWGLGLALKGHAWTIPAGDPLKVAAIQGNVEQDLK---
LNT_PSESM       --------RKSFLAMGVLLLLAPWVAGLALKDHAWTSPSGPPLKVAAMQGNIEQSMK---
LNT_PSEAE       --------HGASLLLGLVLLLGPWAAGLYLKGHAWTHSAGEPLRVVAIQGNIAQELK---
LNT_COXBU       --------KLNKKIMCLILIILPFIVGWVLTFIPWTRPGSESVRVGLVQGNIGQRLK---
LNT2_TREDE      SKAFFKGLTEIKSPLIFTAFLVLIINIYGITILSIEMKPATFLNTVIVQQNTDPWDN---
LNT2_TREPA      SVPVFR-------LWLLTGCLYCLCSLYGAYRIATLGAPRTTLALAIVQQNADPWDT---
LNT1_TREDE      ---IKNVYQRYKLPMMIWVGTF-FAFILYGAFTKIDLSEAQRARIALVQPNRDPWLGNL-
LNT1_TREPA      ARAFLSAAYSHWVSALVWVGLCGFCVCAAKAGWWPDCTAHTRAKVALVQPNGDPRRGGI-
LNT_CHLCV       ---LLRKCFSRYVWLGCLLFPYILGGVHYEYLKNTFSKEE-NLRVAVIQPASSMLLEGP-
LNT_CHLPN       ---LLKKPHAKMLWVLTLLLPYTFGAIHYEYLKHAFQQDKRALRVAVVQPAHPPI--RP-
LNT_CHLMU       ---VFRKSFSYGLWLVCCAFPYFLGGTYYEYVRRHFSNEE-VLRVAIVQPGYSPHMQGA-
LNT_CHLTR       ---LLKHSFSKGLWLTLCAFPYLLGGAHYEYLKKHFSDSE-VLRVAIVQPGYSPHMHAG-
LNT_HELPJ       ----------------YRMIGVLLLLGALDFHFFKISDLKEVGNIELVSTRTPQDLK---
LNT_HELPY       ----------------YRIIGVLLLLGALDFNGFKTSDLKKVGNIELVSTKTPQDLK---
LNT_WOLSU       ----------------LKPLPLLLLPFTLYSKPFSPS--LPPFEVEIIETHIPQEIR---
LNT_HELHP       ----------------KLGGVICLVFALDFGLKDSKIQNLPPLKIKLAQSAVSQDFD---
LNT_CAUVC       ------------AATGLAVASLIGLYGYGAIALSRPLSPSGPTTVRIVQADIKQDLK---
LNT_GLOVI       -----------VGYAGLAALLAASVYLYGWWQLAQPLPAGEPLRMGVIQGNIAQARK---
LNT_CAMJE       ----------------YYKIAIVLILFFSGFQYNEKQAQTLNLNYKLINTNISQDQK---
LNT_BORBU       ---------NIAFPTLLITASFTYGMIKKIELKNLLAKEIDSLNIAAIQLNTDPWLPG--
LNT_GEOSL       ---------PYPVKSAAILVLLLVATLAYGFNRLHRPEAGAPFSVALIQGNIDQSVK---
LNT_RHOBA       VS-------DSPMKSLVTAGGLLIATMVYGAMSMNAETEPTGKTIALLGDNELTVYE---
LNT_THEMA       -------------GLLIFPVIFFVYLLNSSVVHLLPVPERGSFKVVALQPNVPTSLKYS-
LNT_AQUAE       ---------------IFSLAIITPLLIYGFIKETSYRVTHYGLKIALIQPFVPQDVK---
LNT_BDEBA       --------KKALSHLSLLALTFAALVGWGFWHGKAWNKFDGETKATVVQANIGNLEKIY-
LNT_CHLTE       -----FQVKVGIVMVMLVMIATPLLYARQVFRNTALDNTSPKVRVALVQPDIDPHEK---
LNT1_LEPIN      -----EFKTSIASLICITFIYGFGLYRIGYINQSQNELKPKNLSVLMIQPDTSPGTKDLK
LNT2_LEPIN      KE--KRKQYLRFITLPALLLLTFIVSGIFLFKKWENVKPVKSLNVLIVQPDAPLSFRDGR
                                                                            

LNT_NOSS1       LLPQGLSRAITGYTDGYLTLVNQG---------------------VEAVLTPEGALPF--
LNT_SYNY3       FNSEGWQRAIAGYTEGYKKLTEQG---------------------AEIVLTPEGALPYL-
LNT_THEEB       LTPEGIRRAWQVYLQGYHQLVSWG---------------------VDAVLTPEGALPIL-
LNT_PROMM       FSEEQQRRLPEALQNALDRADDLD---------------------AAWLVAPEGLLPPD-
LNT_SYNPX       FSPERQRRFQSALSSALQQAQSLK---------------------VEALVAPEGTLPFR-
LNT_PROMA       FTLRELKRLPISLQDALEEADNLG---------------------ADWMVAPEGTLSAG-
LNT_PROMP       TNFKNQF-INDKLISAQKIALSND---------------------AKLLITPEGTLNNN-
LNT_BRUME       WDNAERRAIFDKLVGLTEEAPAE------------------GKPRPDVIVWPETAIPYI-
LNT_BRUSU       WDNAERRAIFDKLVGLTEEAPAE------------------GKPRPDVIVWPETAIPYI-
LNT_RHILO       WDASVRDRIFATLLGLSAKAPDP------------------GHGKPQLILWPETSVPFL-
LNT_AGRFC       MLNTDRAEIFAEHLRLSALPPGE------------------GKKRPDIIVWPETSVPFI-
LNT_BRADU       FNYAAKTEVMKKYLALSDRASGPQST---------------GVRDATILIWPESAFPFF-
LNT_RHOPA       FNYSAKADVMQKYLSLSDRSTGPKST---------------GVRDVSLLIWPESAFPFF-
LNT_RICCN       WNEEEFWHNLMLHINLSE-----------------------NLEPTDLIIWSEAALVVP-
LNT_RICPR       WDQEEFWHNLMLHINLSE-----------------------NLEPTDLIIWSEAALVVP-
LNT_BORBR       FDPALLETGLRRHLELASLPPRPG------------------EPKPDLIILPETVLPVFQ
LNT_BORPA       FDPALLETGLRRHLELASLPPRPG------------------EPKPDLIILPETVLPVFQ
LNT_BORPE       FDPALLETGLRRHLELASLPPRPG------------------EPKPDMIILPETVLPVFQ
LNT_RALSO       FQQTGIDHSLALYTKMVTEQP------------------------AQLVVTPETAFPILL
LNT_NEIMA       WREDQVIPTIQKYYEQVGKTT------------------------ADIVILPETAIPVMR
LNT_NEIMB       WREDQVIPTIQKYYEQVGKTT------------------------ADIVILPETAIPVMR
LNT_CHRVO       WSPENLENSLLTYYRQVAMTR------------------------ADLMILPETALPLFL
LNT_NITEU       WQPEHLAATMQIYAELVQESP------------------------SRLIVTPEISFPLFY
LNT_ECOLI       WDEGQLLNTLKIYYNATAPLMGK----------------------SSLIIWPESAITDL-
LNT_ECO57       WDEGQLLNTLKIYYNATAPLMGK----------------------SSLIIWPESAITDL-
LNT_SHIFL       WDEGQLLNTLKIYYNATAPLMGK----------------------SSLIIWPESAITDL-
LNT_ECOL6       WDGDQLLNTLKIYYNATAPLMGK----------------------SSLIIWPESAITDL-
LNT_SALTI       WDENQLLNTLNIYLNETRPELGK----------------------SQIIIWPESAIPDL-
LNT_SALTY       WDENQLLNTLKIYLNETRPELGK----------------------SQIIIWPESAIPDL-
LNT_YERPE       WDPKALITTLQIYLDETRPFMGK----------------------APIIIWPESAIPDI-
LNT_PHOLL       WDPKMLSETMDIYMGNSLPYIGK----------------------MPIIIWPESAIPSL-
LNT_BLOFL       WNTENIQKTLKIYLQHTLPLLGK----------------------VKIIIWPESAIPGN-
LNT_WIGBR       IDNNQIQKNLEQYLKITKKIINS----------------------SNIIIWPESAIPCD-
LNT_VIBVU       WLPSQRWPTIMKYTDLSRENWD-----------------------ADIIIWPEAAIPAF-
LNT_VIBVY       WLPSQRWPTIMKYTDLSRENWD-----------------------ADIIIWPEAAIPAF-
LNT_VIBPA       WLPSQRWPTIMKYADLTRENWD-----------------------ADIIVWPEAAIPAF-
LNT_VIBCH       WLPSQRWPTIMKYTDLTRENWD-----------------------ADVIIWPEAAIPAF-
LNT_SHEON       WEPEALWPTLLKYMDLSREHFD-----------------------ADIIVWPEAAIPAP-
LNT_HAEIN       WDPNYFYSTLAIYQKLITENLGK----------------------TDLIILPESALPTL-
LNT_PASMU       WEPEYLYQTLDIYHKLISQHLGK----------------------TDVIILPESALPVL-
LNT_HAEDU       WDPAHFENTLRTYQQLINSSLAE----------------------NEVIILPESAIPAL-
LNT_PSEPK       WDPAHIDAQLALYRDLSFSSRP-----------------------VDLLVWPETAVPVL-
LNT_PSESM       WDPQKLNDQLALYRDMTFRSQQ-----------------------ADLIVWPETAVPVL-
LNT_PSEAE       WDPNQVRAQLDLYRDLSLPQQD-----------------------VDLIVWPETAVPIL-
LNT_COXBU       WDPDTLYSTLHTYYSETQKNWD-----------------------HGIIVWPEAAIPIY-
LNT2_TREDE      SQFEENIKTSQALSRKAIFSANKKP---------------------DLIVWSESS-----
LNT2_TREPA      XSFEKNLTTAIHLTETALRTQTAPPLPTTPYRKEKTLTHASARAPVDMVVWSESS-----
LNT1_TREDE      EVYRNNYEELKNLSEKALKNFPDIE----------------------LVVWPETAFIP--
LNT1_TREPA      ESYRADFSTLTYLSDWALERYPDVD----------------------LVVWPETAFVP--
LNT_CHLCV       WSGSPA-MAWQRLVSLSSIVRKPVD----------------------LLIFPEVSVPFGR
LNT_CHLPN       KLKSPI-VVWEQLLQLVSPIQQPID----------------------LLIFPEVVVPFGK
LNT_CHLMU       RTAS---AIWSNLVSLCQGICPPVD----------------------VIVFPEVSVPFGL
LNT_CHLTR       RTAS---AIWRGLVSLCQTIQTPVD----------------------VIVFPEVSVPFGL
LNT_HELPJ       FDSNYLNNIENNILKEIKLAQSKQ---------------------KTLIVFPETAYPIA-
LNT_HELPY       FDSSYLNDIENNILKEIKLAQSKQ---------------------KTLIVFPETAYPIA-
LNT_WOLSU       WEREARARIIEENLKRIDAAILEG---------------------KALILFPETAFPLL-
LNT_HELHP       YRMREAKSIFSEHISDIQKAINEE---------------------YDVIILPESAFYVP-
LNT_CAUVC       WDAERFAQIVQAYVSLTATPYAAKP--------------------ADIVIWPEGALPAAV
LNT_GLOVI       WTPDGRRETVETYVRGYEELAAAG---------------------AQLVLTPETAFPFIW
LNT_CAMJE       FLQENLKSNSDILIQDILQAINEK---------------------KELVILPETAFAFD-
LNT_BORBU       NDKKGIRDSIEITEQALKENPK-----------------------IEFVIWSEGVLTYPF
LNT_GEOSL       WDPAFQEATVAVYERLSRKACSTGP--------------------ADLVVWPESAVPFYL
LNT_RHOBA       QDIVREQEIFATYGQMAIDAVAKSNT------------------RIDAVVWPESMFSGGL
LNT_THEMA       VSSGEMLELLESMTKDFHGS---------------------------IVITPEAFFLED-
LNT_AQUAE       LNRELFELKYGEIIELVKKAVEKK---------------------PDLVVLPESAFPFY-
LNT_BDEBA       AEQGRAYQEVITRKFLDLSFAAMQKY-----------------PQTDILIWPETAFPDYL
LNT_CHLTE       WDGLGPEETLSRLYSLTGQSVRGER--------------------LELIIWPETAIPFYI
LNT1_LEPIN      ADASYLSATMSKVFSLAIPTFENS---------------------PSLIVIPESAIPFHG
LNT2_LEPIN      EIKESIEALMARIEKLTDEGAVRLGK------------------KPDLIVLPEAGVPFFS
                                                                :: .*       

LNT_NOSS1       -------FQRNLPTTPLVSAVREKGVVAWIGAFGDRGRSYTNSLFTVN-SQGEITSR---
LNT_SYNY3       -------WETVVAKSGFYQAILQTQVPVWLGAYGTKGDGYTNSLLTVD-GQGKLLGR---
LNT_THEEB       -------WQPQ-QMNPITEAVREAGVPLWLGTFMETAGGSHQVLLSLD-GNGEIDSH---
LNT_PROMM       -------AVL----------LRPAPLPLLSGGFRWLRGQQRSALLVVDRGERQASAF---
LNT_SYNPX       -------WQAD---------EDPLPVPLISGGFRWVRGQQRSSVLLARPDRAGVEPL---
LNT_PROMA       -------QNL----------LAPSPLPLLSGGFRRVKNKQMSSLLVFNEGSTSYSSA---
LNT_PROMP       -------FNL----------NFKSKIRMLAGGFRNSKNGLRSSLLGYQIGDKTYSSF---
LNT_BRUME       -------LESTPQALAHIGDALQEGQVLLAGAVREEKG-ADGGEPRYYNSIYTIDDR---
LNT_BRUSU       -------LESTPQALAHIGDALQEGQVLLAGAVREEKG-ADGGEPRYYNSIYTIDDR---
LNT_RHILO       -------FTERPDALTALGDMLADGQMLIAGVVREEGGSAASTDSRYYNSVVAINDR---
LNT_AGRFC       -------LTQNPDALAEIASTLEDGQVLFTGAVRMEDQ-GAGRPPRYYNSVYAIDSQ---
LNT_BRADU       -------LTREADAMAEIAELLPKGTVLITGSVRAPDLPRGTPITRAYNSIYVIDHD---
LNT_RHOPA       -------LSREADAMAQIAELLPKGTVLLTGAVRPPELPPGRRITRAYNSIYAIDHD---
LNT_RICCN       -------DDIPQVKSKLLKMLNSTNAILITGGISDNKK--QGDEFELYSAMYALDKN---
LNT_RICPR       -------DDIPQVKLKLLNMLNSTNAILITGGISDNKK--HGDQFELYSAMYALDKN---
LNT_BORBR       -------DQLPASVWDAWIEVARRADTRIAMGVPLHTQPDGATGHRYTNSVIGFDASTPV
LNT_BORPA       -------DQLPASVWDAWIEVARRADTRIAMGVPLHTQPDGATGHRYTNSVIGFDASTPV
LNT_BORPE       -------DQLPASVWDAWIEVARRADTRIAMGVPLHTQPDGATGHRYTNSVIGFDASTPV
LNT_RALSO       -------QDMPQE-----IALAIRTYVDTTGSSVLFGAANADSAVDYTNSAFGVGPWF--
LNT_NEIMA       -------QNLPENILAKFAEQAQNNGSALAVGISQYT----SDGNGYENAVINLTGYQEN
LNT_NEIMB       -------QNLPENILAKFAEQAQNNGSALAVGISQYT----SDGNGYENAVINLTGYQEN
LNT_CHRVO       -------DDLPSGYLSMMRGEASRAGMALASGIPRRT----DDGRGYLNSVVALSDPK--
LNT_NITEU       -------EQAPQDYLALLAEHARSRQGDLLIGMAERS----SSDNGYYNTMFSFGTSPE-
LNT_ECOLI       -------EINQQPFLKALDGELRDKGSSLVTGIVDARLNKQNR-YDTYNTIITLGK----
LNT_ECO57       -------EINQQPFLKALDGELRDKGSSLVTGIVDARLNKQNR-YDTYNTIITLGK----
LNT_SHIFL       -------EINQQPFLKALDGELRDKGSSLVTGIVDARLNKQNR-YDTYNTIITLGK----
LNT_ECOL6       -------EINQQPFLKALDGELRDKGSSLVTGIVDARLNKQNR-YDTYNTIITLGK----
LNT_SALTI       -------EINQQPFLRSLDEMLREKNSTLITGIVDARLNKQNR-YDTYNTIITLGK----
LNT_SALTY       -------EINQQPFLRSLDEMLREKNSTLITGIVDARLNKQNR-YDTYNTIITLGK----
LNT_YERPE       -------ETDQNTFLTMIDGLMRANHSSLITGIVDAKRQPEGQGYQFFNSIIVLGD----
LNT_PHOLL       -------ESYQRHFLTKLDELLRNQHTSLITGIVDERAVGDRD--KIYNSVIVLGD----
LNT_BLOFL       -------ELAHNELLVSLDYQLRKHHTYLITGIIDSRLINNSY-YHHYNSIIVLGNT---
LNT_WIGBR       -------EISCRNFLLKIDKELKLKKSYLITGIISLKKS------NYYNSIITLGG----
LNT_VIBVU       -------EVELPSYLSNLDSAAKMNQSAIISGIVNQAEDG-----QFYNSILAVGLT---
LNT_VIBVY       -------EVELPSYLSNLDSAAKMNQSAIISGIVNQAEDG-----QFYNSILAVGLT---
LNT_VIBPA       -------EVEVPSFLSNIDSAAKMNNSAIITGIVNQSEDR-----QFYNSILSLGVT---
LNT_VIBCH       -------EYEISSFLHNLDAAARMNQSAVITGIINQSDDK-----QYFNSVLTVGDT---
LNT_SHEON       -------ESMVQDFLDNANKVANLNHTSIITGIISRQQE------DFYNSLIVLGNHNQK
LNT_HAEIN       -------ENAITPFFEGLERAAKETKTEIMVGTVFQDTKSG----KLLNSIMTAGNP---
LNT_PASMU       -------ENHIQPFFQGLQAHAQQAGTEIVMGTIYQDKTAN----KLLNSIITLGNT---
LNT_HAEDU       -------ESKINPLLNQLQKMAAAKNTEIIIGTLYENEQQ-----QLFNSALVLGNQ---
LNT_PSEPK       -------KDQAQGYIDVMGRFAAERHSALITGVPVREEVHH-Q-RRYYNGITVTGEG---
LNT_PSESM       -------KESAEGYLSMMGKFAADRGAALITGVPVREPTGRGE-YSYYNGITVTGQG---
LNT_PSEAE       -------QDMASGYLGAMGQVADEKNAALITGVPVRERLADGK-SRYFNGITVVGEG---
LNT_COXBU       -------PQQVSVFLQALDKEAKQHNTALMTGIPIYHEKTN----KVFNGLMVLGDG---
LNT2_TREDE      ---------LIVPYKDNEDFYGILPYDDPFTRFLADTDTPIIVGSPYIDGKK--------
LNT2_TREPA      ---------LRYPYEQYRHVYNALPAARPFSAFLRTLGAPLLVGTPLRLSGNSTKG----
LNT1_TREDE      --------MIRWHYKYTSTYNPNSLLVRELLHFLDNQKVPFLIGNDDGVLDEKFSDNNFD
LNT1_TREPA      --------RIDWHYRYRHEQQ-SFQLVCDLLDYVNAKNCPFIIGSDD-AYKKRTKEGNWE
LNT_CHLCV       -------DRKVYPYDDSQVILSPLTHFKHQDELLANVDWMQALSNHFNCPILMGLERWEE
LNT_CHLPN       -------HRQVYPYESCAHLLSSFAPLPEGKAFLSNSDCATALSQHFQCPVIIGLERWVK
LNT_CHLMU       -------HRQAYSFHENQQVLESLVPNKFWNEFFTNLDWIRALSERFQCAVIMGMERWED
LNT_CHLTR       -------HRQAYTLHENQPVLESLLPNKSWGEFFTNLDWIQAIAERYQCTVIMGMERWEN
LNT_HELPJ       ---------LEN--SPFKTQLEDLSDKIAILIGTLRAQ-----GYSLYNSSFLFSKK---
LNT_HELPY       ---------LEN--SPFKAKLEDLSDNIAILIGTLRTQ-----GYNLYNSSFLFSKE---
LNT_WOLSU       ---------LNKE-DWVLEHLAQKSQEIAIITGALRAE-----EGEIYNSTYFFHQG---
LNT_HELHP       ---------LDSQYFPYFDSLLEMSHKIVIIVGALREEIHTDGRASYFNSTYKFDKG---
LNT_CAUVC       -------NDYLAPGTWVRQAIVDSLAPGQLLLIGGYRYEGAGPHPTYYNSLVALRRT---
LNT_GLOVI       -------SRPTNPAAPLVPEIQSRRVPVLLSAFERRTDGQVATTLFALDGDARTIST---
LNT_CAMJE       ---------LKNTKYELMLKELSYKITIITGAFHVEKE-------HTYNSTYIFKKG---
LNT_BORBU       S-----KEDQHFKSSDLHNELKNFIKEHKIPFAIGAPSNLDKAIGIQQNSIYMVEPN---
LNT_GEOSL       Q-----NEEKYASRIRNLTRELRSCTVVGSPAFERDGETIRYLNSAFLLSPWGDVVG---
LNT_RHOBA       PWMTT-GADLVVPDFMQNPAAAPLQPEQLRFAVESKQNDFLDRANSIQRAMRASSTVPTE
LNT_THEMA       -----------------------VRYSQKLRELSEENTFVIGFPADNQNSVFVLEGG---
LNT_AQUAE       --------------LGELEEKGKEILELSKKVPIITGFIEIDEGFKPYNTVVLLKDG---
LNT_BDEBA       DQ----HLLDRKHAQILISGLQPLSRPLITGAYSKDPKADEKQDTSTYNALFLVDPL---
LNT_CHLTE       RLP------ENKPYMDSVRRMVMRWNTPLLTGFPDEVPVFPNSARGEAVAASGAEYAAYN
LNT1_LEPIN      TIDSE-ENRKEKIYSSTMEGIILYLSKHTGADVLFNELNLDENKLRNQVSLFKNLDG---
LNT2_LEPIN      AHKTEITTKVRRMYWDRFDSLMFLLANRYKANVFFNEIDAGFKGAPSPRNLRYYNNNVLY
                                                                            

LNT_NOSS1       ------------------------------------YDKSKLVPLGEYIPFEGIIGGLVQ
LNT_SYNY3       ------------------------------------YDKFKLVPLGEYIPLSNVFGQLIQ
LNT_THEEB       ------------------------------------YGKVNLVPLGEYIP--PWLGGVVQ
LNT_PROMM       ------------------------------------IDKHRLVPLGEWLP--ALPGGVFR
LNT_SYNPX       ------------------------------------VDKHRLVPLGEWLP--PLPAGLTR
LNT_PROMA       ------------------------------------IDKHRLVPLGEWLP--SLPGVNWN
LNT_PROMP       ------------------------------------IDKHRLVPLGEKIP--GFLNIFSR
LNT_BRUME       ------------------------------GRIVSTADKVHLVPFGEYLPFESFLRGLGL
LNT_BRUSU       ------------------------------GRIVSTADKVHLVPFGEYLPFESFLRGLGL
LNT_RHILO       ------------------------------GEITDAVDKVHLVPFGEYLPFGDLLNRFGI
LNT_AGRFC       ------------------------------GEIIGATDKVHLTPFGEYVPFEGILREFGI
LNT_BRADU       ------------------------------GSVLAVYDKLHLVPFGEFLPYQDLMEKLGF
LNT_RHOPA       ------------------------------GSILSVYDKLHLVPFGEFLPYQNLMEKIGF
LNT_RICCN       ------------------------------NHKLFEYHKSHLVPFGEYMPLKKILP---F
LNT_RICPR       ------------------------------NNKLFEYHKSHLVPFGEYMPLKNILP---F
LNT_BORBR       -------------------------EQLRTGTTAMRYDKQHLVPWGEYVPPG--FRWFVD
LNT_BORPA       -------------------------EQLRTGTTAMRYDKQHLVPWGEYVPPG--FRWFVD
LNT_BORPE       -------------------------EQLRTGTTAMRYDKQHLVPWGEYVPPG--FRWFVD
LNT_RALSO       -------------------------------KGVYRYDKHHLVPFGEFIPFG--FHWFVH
LNT_NEIMA       -------------------------NQ----DGIPYYAKNHLVPFGEYKPLPFLTTPLYK
LNT_NEIMB       -------------------------NQ----DGIPYYAKNHLVPFGEYKPLPFLTTPLYK
LNT_CHRVO       ---------------------------------MPYYAKDHLVPFGEFVPLPGLIGWIYQ
LNT_NITEU       ----------------------------------QSYRKYHLVPFGEYIPLKPVFGWIID
LNT_ECOLI       -------------------------GAPYSYESADRYNKNHLVPFGEFVPLESILRPLAP
LNT_ECO57       -------------------------GAPYSYESADRYNKNHLVPFGEFVPLESILRPLAP
LNT_SHIFL       -------------------------GAPYSYESADRYNKNHLVPFGEFVPLESILRPLAP
LNT_ECOL6       -------------------------GAPYSYESADRYNKNHLVPFGEFVPLESILRPLAP
LNT_SALTI       -------------------------DNPYSYDSPNRYNKNHLVPFGEFVPLESILRPLAP
LNT_SALTY       -------------------------DNPYSYDSPNRYNKNHLVPFGEFVPLESILRPLAP
LNT_YERPE       -------------------------KDTYQYPTRNRYSKHHLVPFGEYVPLESLLRPLAP
LNT_PHOLL       -------------------------KIPYQYPAAIRYDKYHLVPFGEFVPLESLLRPLAP
LNT_BLOFL       -------------------------HDPYKYPSSNRYDKHHLVLCSERFPLQCLFEPVFR
LNT_WIGBR       -------------------------NSPYLDNSKNKYYKYNLVPFGEKLPLKSILNPIFN
LNT_VIBVU       ------------------------PYGDYSFDLTERYHKHHLLPFGEFVPFEQILRPLAP
LNT_VIBVY       ------------------------PYGDYSFDLTERYHKHHLLPFGEFVPFESILRPLAP
LNT_VIBPA       ------------------------PYGDYSFDMSERYHKHHLLPFGEFVPFEDILRPLAP
LNT_VIBCH       ------------------------PHGEYRYDLTQRYHKYHLLPFGEFVPFEEILRPLAP
LNT_SHEON       Q----------------------QDNPDYESDGSNQFKKHHLLPIGEFVPFQALLRPIAP
LNT_HAEIN       -------------------------DFPYQPNTQNRYNKHHLVPFGEYVPLESILRPLNS
LNT_PASMU       -------------------------DFPYSLETTNRYSKHHLVPFGEYVPLETLLRPLGS
LNT_HAEDU       -------------------------TKPYQLHQSLRYNKHHLVPFGEYVPFGSLLDWMRE
LNT_PSEPK       ---------------------------------DGTYLKQKLVPFGEYVPLQDVLRGAIE
LNT_PSESM       ---------------------------------DGTYFKQKLVPFGEYVPLQDLLRGLIS
LNT_PSEAE       ---------------------------------AGTYLKQKLVPFGEYVPLQDLLRGLIA
LNT_COXBU       ---------------------------------HGLYLKRHLVPFGESFTSSKICNLLMK
LNT2_TREDE      -------QYNAAYLL--------SPEGKIL----DIYSKIQLVPFAEYIPFIDN-PLVVR
LNT2_TREPA      ------GYANAVALL--------RPDGHVA----QVYGKMQMVPFAEFIPWGHM-TSVQR
LNT1_TREDE      NLEDKRLDYNAALLF--------IPKKNVSPPEPQTYRKMHLVPFTEHFPYQKL-FPRFY
LNT1_TREPA      -----RVDYNAALLF--------IPGVNVLPPSPQRYHKIKLVPFTEYFPYKRV-FPWFY
LNT_CHLCV       L-DSKLHLYNSAECI--------SQHGELI-----GYDKRILVPGGEYIPGGKIGWSVCK
LNT_CHLPN       K-ENVLYWYNSAEVI--------SHKGISV-----GYDKRILVPGGEYIPGGKFGSLICR
LNT_CHLMU       K-NGVMHLYNAAECL--------SLQGEVT-----SYDKRILVPGGEYIPGGKFGFSLCK
LNT_CHLTR       K-GGILHLYNAAECV--------SREGEIT-----SYDKRILVPGGEYIPGGKIGFSLCQ
LNT_HELPJ       --------------------------------SVQIADKVILAPFGEIMPLPEFLQKPLE
LNT_HELPY       --------------------------------SVQIADKVILAPFGETMPLPEFLQKPLE
LNT_WOLSU       --------------------------------RIEVADKIVLVPFGEKIPLPDFLVKPLN
LNT_HELHP       --------------------------------KVSFYDKVHLVPFGET--LPSFLLPLVN
LNT_CAUVC       ---------------------------ETDLELVGIYDKHRLVPFGEYLPADRFLTVIGF
LNT_GLOVI       ------------------------------------FNKIHLVPFGEQIPLKALIGPLVR
LNT_CAMJE       --------------------------------NVYILNKHFLVPFGEEIP---FFKDLTK
LNT_BORBU       ------------------------------LNITNIYSKIFLVPFAEKIPFYEYKFVRNF
LNT_GEOSL       -----------------------------------RSDKIHLVPFGEYVPMAKFLPFVNK
LNT_RHOBA       APPAIIGGCGLVQYADRPSQYSGVVWVNATGNMSGTYSKNHLVLFGETIPLVHSLPWIRD
LNT_THEMA       -------------------------------RFRKVYSKVKLFPFVEKLPYPRVFGVFSF
LNT_AQUAE       -------------------------------RVIEKYRKIKLVPFGEYTPFPFKFFSKYV
LNT_BDEBA       -----------------------------GNNLDKPYRKTELLAFGEYLPLSEQFPFLLK
LNT_CHLTE       A----------------------SMLLHPAGGPVQIYRKMRLVPFGERVPYSEYFPWLER
LNT1_LEPIN      --------------------------------KTERYNKRRLLPFGEYLPMEKNFPFLRS
LNT2_LEPIN      D---------------------------PNGDRRDSYQKKFLLMFGEYMPFDFLYELSQQ
                                                      *  :    *             

LNT_NOSS1       RLSPLDEHQVHGSPNQ--IFDTP-------------------------------------
LNT_SYNY3       RLSPLKEQLLPGDRPQ--VLPTP-------------------------------------
LNT_THEEB       RLSTLRSPLIPGDPEQ--VFTTP-------------------------------------
LNT_PROMM       GLSAVGGLQPGAASRL--LQWP--------------------------------------
LNT_SYNPX       GLSAVGGLQPGDASRF--VNVW--------------------------------------
LNT_PROMA       GLSFVGGVDPGDASRF--FDWD--------------------------------------
LNT_PROMP       GLSAVGGIQPGSDSRF--FKWKF-------------------------------------
LNT_BRUME       QEVVEMPGGFTAGTTRHALAVKD-------------------------------------
LNT_BRUSU       QEVVEMPGGFTAGTTRHALAVKD-------------------------------------
LNT_RHILO       AQLVAGPVTFAAGNERHAISLPG-------------------------------------
LNT_AGRFC       DNVIALPGGFSAASSRTPLTLPS-------------------------------------
LNT_BRADU       EQLTRVRGGFIAGTVRHALPMPG-------------------------------------
LNT_RHOPA       VQLTKVQGGFLSGVARHNLELPN-------------------------------------
LNT_RICCN       KKLTHGLIDYKEGNGGLVYLEKY-------------------------------------
LNT_RICPR       KKLTHGLIDYKEGDGGLVYIKKY-------------------------------------
LNT_BORBR       MLDIPLGDFDRGAARQPSFDIA--------------------------------------
LNT_BORPA       MLDIPLGDFDRGAARQPSFDIA--------------------------------------
LNT_BORPE       MLDIPLGDFDRGAARQPSFDIA--------------------------------------
LNT_RALSO       MMNMPLGDFRRGLPVQPPMPVA--------------------------------------
LNT_NEIMA       MMNMPLSDFRKGGGKQSALLMK--------------------------------------
LNT_NEIMB       MMDMPLSDFRKGGGKQSALLMK--------------------------------------
LNT_CHRVO       HMDMPLSGFTRGGADQPPLTLA--------------------------------------
LNT_NITEU       VLHIPLSDFSRGGLDQQPLDLA--------------------------------------
LNT_ECOLI       FFDLPMSSFSRGPYIQPPLSAN--------------------------------------
LNT_ECO57       FFDLPMSSFSRGPYIQPPLSAN--------------------------------------
LNT_SHIFL       FFDLPMSSFSRGPYIQPPLSAN--------------------------------------
LNT_ECOL6       FFDLPMSSFSRGPYIQPPLSLN--------------------------------------
LNT_SALTI       FFDLPMSSFSRGPYIQPQLHAH--------------------------------------
LNT_SALTY       FFDLPMSSFSRGPYIQPQLHAH--------------------------------------
LNT_YERPE       LFNLPMSSFNRGDYVQPPLTIA--------------------------------------
LNT_PHOLL       FFNLPMSSFSRGNYIQPQLSVA--------------------------------------
LNT_BLOFL       FFNIPIAFMKSGPYIQSQLNVY--------------------------------------
LNT_WIGBR       KLGLSLIDLKKGDFFQNQLKIF--------------------------------------
LNT_VIBVU       FFNLPMSSFSRGDFVQPNIVAN--------------------------------------
LNT_VIBVY       FFNLPMSSFSRGDFVQPNIVAN--------------------------------------
LNT_VIBPA       FFNLPMSSFSRGAFVQPNIVAN--------------------------------------
LNT_VIBCH       FFNLPMSSFSQGAYVQPNLIAK--------------------------------------
LNT_SHEON       FFNLPMSSFARGDYLQPNLSAL--------------------------------------
LNT_HAEIN       VFNLPMSAFQSGEAVQPSLIAK--------------------------------------
LNT_PASMU       VFNLPMSAFQSGDEIQSPLVVK--------------------------------------
LNT_HAEDU       VFILPVNLAK-GPFIQPALFTN--------------------------------------
LNT_PSEPK       FFNLPMSDFARGPEDQPLLQAK--------------------------------------
LNT_PSESM       FFDLPMSDFARGPNDQALLQAK--------------------------------------
LNT_PSEAE       FFDLPMSDFARGPADQPLLKAK--------------------------------------
LNT_COXBU       YFDIPMSDLSPGPEDQEPTVVK--------------------------------------
LNT2_TREDE      FFDKLVGFSSGWNPGTEYKVFGIKN--------------------------------SEG
LNT2_TREPA      LAQMLAGFSESWTPGPGPRLFHVPC--------------------------------AAG
LNT1_TREDE      EFLKEND-THFWEKGKEANLLEF-------------------------------------
LNT1_TREPA      NFLEKQD-ARFWAQGSEFVVFEA-------------------------------------
LNT_CHLCV       KYFPEYALSCQRIPGARSGVIEVE------------------------------------
LNT_CHLPN       QLFPKYALGCKRLPGRRSGVVQVR------------------------------------
LNT_CHLMU       AFFPEFALPFQRLPGEKSGIVQIT------------------------------------
LNT_CHLTR       TFFPEFALPFQRLPGEFSGVVNIT------------------------------------
LNT_HELPJ       KLFFGESAYLYRNAPHFSDFTLD-------------------------------------
LNT_HELPY       KLFFGESTYLYRNAPHFSDFTLD-------------------------------------
LNT_WOLSU       RLFFGGAQDYRASASKPVDFELH-------------------------------------
LNT_HELHP       TFFQGIGG--FSAGKDFGYFDIA-------------------------------------
LNT_CAUVC       KSLARLSDNFTTGPTPAPLRISP-------------------------------------
LNT_GLOVI       KLSPVQQEVFAGSLGQRLQTPVG-------------------------------------
LNT_CAMJE       KYFLKNIEEFSKGPIQSKYKLD--------------------------------------
LNT_BORBU       FLKNFRILGQIEGNKIEILKLKK-------------------------------------
LNT_GEOSL       IVAGIGDFSPGARIASLETGKGA-------------------------------------
LNT_RHOBA       IVPPGLGLDRGTQPERFDLDGISLM--------------------------------PNL
LNT_THEMA       LKGLSYYEPGRNFSVFNVGESPP-------------------------------------
LNT_AQUAE       PYLSFEDYNRGNKVKCFQLNGFS-------------------------------------
LNT_BDEBA       LLPFVSNFGRGHGPEVMKWDTPQG------------------------------------
LNT_CHLTE       LSFSMSGISSWAKGREATVMHFTSR--------------------------------D-G
LNT1_LEPIN      IFQETSRYVPGEFPKLLIGNKIQNQRSFLPPEISKLNEPKTYRYEFSSIVEHTNKIRNLE
LNT2_LEPIN      TGRFEPGLTHNLIRYYTPRYYTLAEKEKSPKGRHLGWTDTETFNHEAVRSYYETTRTEVS
                                                                            

LNT_NOSS1       -FGRAIVGICYESAFPEVFRSQA------AAGGQFILSSSNDAHYSAAM-PFQHHAQDIM
LNT_SYNY3       -FGPAAVVICYESAFPDLLRSQL------LQGGEFILSSANNAHYSDTM-AAQHHALDVM
LNT_THEEB       -WGNAVVLICFESAFSHRSRWQL------VHGGQFILSVANDDPYHRQL-MTQHHGHDVL
LNT_PROMM       -GPTAAVAICYELSNGAALAQAV------ADGAQWLLAVANLDPYPLAL-QRQFIALAQL
LNT_SYNPX       -PSPFAVAICYEISDGRALAKAT------AQGAEWLLTIANLDPYPQLL-QRQFLALAQL
LNT_PROMA       -GGPLAVAICYELSDGNNLAKAI------FDGAEWILAIANLDPYPISL-QRQFLALAQL
LNT_PROMP       -TQPLAIAICYEITDGFKIRNAV------KSGAELIISAANLDPYPRKL-HYQFLSLARV
LNT_BRUME       -GRSFLPLICYEAIFPDELGYE-------GAGASAIINVTNDAWYGDTPGPYQHFRQAQV
LNT_BRUSU       -GRSFLPLICYEAIFPDELGYE-------GAGASAIINVTNDAWYGDTPGPYQHFRQAQV
LNT_RHILO       -GIRALPFICYEVIFPDLVAVD-------ATSAQLIVNVTNDAWFGDTPGPYQHFRQAQI
LNT_AGRFC       -GKTFYPLICYEIIFPGEMTPG-------LQGAAAILNVTNDGWFGDTPGPYQHFLQARV
LNT_BRADU       -APSALPLICYEAIFPGEVAGR-------NERPGWIVNLTNDGWFGISTGPYQHLEQARM
LNT_RHOPA       -APPLLPLICYEAIFPDEIAIG-------NNRPGWMLNLTNDGWFGISSGPYQHLQQARM
LNT_RICCN       -NLKIKPLICYESIFPDFVRTN-------NEIADVIINITNDAWYGKSSGPYQHFHISRS
LNT_RICPR       -HLKIKPLICYESIFPNFVRTN-------NEIVDVIINITNDAWYGKSSGPYQHFHISRS
LNT_BORBR       -GQRIAFNICYEDLFGPELLPALQDGPDGRPGATIMANVSNLGWFGNTWALRQHLQIGRL
LNT_BORPA       -GQRIAFNICYEDLFGPGLLPALQDGPDGRPGATIMANVSNLGWFGNTWALRQHLQIGRL
LNT_BORPE       -GQRIAFNICYEDLFGPELLPALQDGPDGRPGATIMANVSNLGWFGNTWALRQHLQIGRL
LNT_RALSO       -GQRVAPNICYEDLFGEEIAASLRQAE--RP-ATMLANVTNLAWFGDTIALDQHLQISRM
LNT_NEIMA       -NQKIAFNICYEDGFGDELIAAA-------KDATLLANASNMAWYGKSNAMYQHLQQSQA
LNT_NEIMB       -NQKIAFNICYEDGFGDELIAAA-------KDATLLANASNMAWYGKSNAMYQHLQQSQA
LNT_CHRVO       -GQKVAFNVCYEDSFGEELIGPA-------SRAGMLANVSNLAWFGKSEAMSQHLQLSQA
LNT_NITEU       -GQQVAVNICYEDVFGEEIIMQL-------PQASLLVNVSNDAWFGRSIGPRQHLQISQM
LNT_ECOLI       -GIELTAAICYEIILGEQVRDN------FRPDTDYLLTISNDAWFGKSIGPWQHFQMARM
LNT_ECO57       -GIELTAAICYEIILGEQVRDN------FRPDTDYLLTISNDAWFGKSIGPWQHFQMARM
LNT_SHIFL       -GIELTAAICYEIILAEQVRDN------FRPDTDYLLTISNDAWFGKSIGPWQHFQMARM
LNT_ECOL6       -GIQLTAAICYEIILGEQVRDN------FRPDTDYLLTISNDAWFGKSIGPWQHFQMARM
LNT_SALTI       -DYKLTAAICYEIILGEQVRDN------FRPDTDYLLTISNDAWFGKSIGPWQHFQMARM
LNT_SALTY       -DYKLTAAICYEIILGEQVRDN------FRPDTDYLLTISNDAWFGKSIGPWQHFQMARM
LNT_YERPE       -GFNLTAAICYEIVLGQQVRDN------FRPETDFLLTISNDAWFGHSIGPWQHFQMARM
LNT_PHOLL       -GYNLTTAICYEIILGEQVRAN------FKPDTEFLLTVSNDAWFGGSIGPWQHFQMARM
LNT_BLOFL       -PIKMTASICYEIILGNQIRDN------FKLDSDFLLTLANDVWFGCSIGPWQHLQIARM
LNT_WIGBR       -DFNIVPSICYEIIFGDRIRKN------VKINTDFLLTISNDSWFGDSIGPWQHFNMARM
LNT_VIBVU       -GHPMAPALCYEIIFNEQVRQN------VTDDTDFLLTLSNDAWFGRSIGPLQHMEIARM
LNT_VIBVY       -GHPMAPALCYEIIFNEQVRQN------VTDDTDFLLTLSNDAWFGRSIGPLQHMEIARM
LNT_VIBPA       -GMHMAPALCYEIIFNEQVRQN------VTDETDFILTLSNDAWFGHSIGPLQHMEIARM
LNT_VIBCH       -GFAFVTALCYEIIFNEQVRDN------VTPDTDFLLTLSNDAWFGRSIGPLQHMEIARM
LNT_SHEON       -GHKVAPAICYEIAFPEQLRDS------VNLGTDLLLTVSNDAWFGTSNGPLQHMEIAQM
LNT_HAEIN       -KRAFSPAICYEIIFGEQVRQN------LKQDTDYLLTLSNDAWFGDSIGPWQHLQMARM
LNT_PASMU       -NRQLSAAICYEIILGEQLRKN------VKQDTDFILTVSNDAWFGDSIGPWQHLQMARM
LNT_HAEDU       -KGKFNMAICYEVIFGHQLQQNQ-----LAQQADYLITITNDAWFGDSIGPWQHLQMARM
LNT_PSEPK       -GYQIAPYICYEVVYPEFAAGL-------AARSDLLLTISNDTWFGKSIGPLQHLQMAQM
LNT_PSESM       -GYHIAPFICYEVVYPEFAAGL-------SAQSDLLLTVSNDTWFGTSIGPLQHLQMAQM
LNT_PSEAE       -GYQIAPYICYEVVYPEFAAAL-------AAQSQVLLTVSNDTWFGTSIGPLQHLQMAQM
LNT_COXBU       -GIPFAPFICYEIAYPTEVLNH-------LSNKQFIVVVNDDSWFAGTIAPAQQLQIAQM
LNT2_TREDE      KTVNFTVPICFEDAFPAVCLNLH------NAGSEVLINITNDSWSKTKSAEYQHFVVAHF
LNT2_TREPA      GSVRFATPICYEDAFPSLCAALH------TQGSELLINLTNDSWSKTASAEWQHYVVSLF
LNT1_TREDE      NNFKIGTPICFEDTFGYISKAFS------KKGANIIINLTNDAWANSAVSQYQHLSMAVF
LNT1_TREPA      RGLKFSVPICFEDAFGYITREFC------ARGASLLVNISNDSWAKSLSCQYQHLSMAVF
LNT_CHLCV       NLPKMGVSICYEETFGMLLRNYK------REGAKLLVNLTNDGWYPSSRLPQVHFYHGIL
LNT_CHLPN       GLPRIGITICYEETFGYRLQSYK------RQGAELLVNLTNDGWYPESRLPKVHFLHGML
LNT_CHLMU       ERIKAGISICYEETFGYAILPYK------RQKADILVNLTNDGWYPHSRLPLVHFYHGVL
LNT_CHLTR       ERIKAGISICYEETFGYAIRPYK------RQQADILVNLTNDGWYPRSRLPLVHFYHGML
LNT_HELPJ       -DFTFRPLICYEGTSKPAYSSSPS---------KVFILMSNNAWFSPSIEPTLQRTLLKY
LNT_HELPY       -DFTFRPLICYEGTSKPAYSNSPS---------KIFIVMSNNAWFSPSIEPTLQRTLLKY
LNT_WOLSU       -GVKLRNAICYEATSAILYEGSP----------QFMVVGSNNAWFYPSIEPALQRLLLGY
LNT_HELHP       -EIKFKNAICYEGSNRGFYADYP----------QYVIVTSNNAWFVPSIEPILQKNLMKY
LNT_CAUVC       -ELLVQPLICYESLFPGLAKPDP--------NVRALINVSNDAWFGVTSGPPQHLNLASY
LNT_GLOVI       ---LVAAGICFDSAFADGFRAQV------AAGARLLVQSTNDAWYGPAMAPQHHA-LDAL
LNT_CAMJE       -NQIITNAICYEATKEQNYQNS-----------QIIIALSNNAWFNNSSEYKLQQLLMKF
LNT_BORBU       --FKFAPLICYDDAFPELSRFYK------TQGANILVNFSNDSWSKTNSAEWQHFVVAKF
LNT_GEOSL       ----IGVLVCFEGIFPELARGYV------RAGSRVLVNITNDAWYKRSSAPYQHLSMTVF
LNT_RHOBA       CIETAVERIPVNHMHQLNSRANP-------KLPDAIVTLTNDVWFHDSAVVDHHLRCAQL
LNT_THEMA       ----LSVQICFESYFPEVSRAFVK------NGSELLIVVTNDGWFHYKAALLNHFVQGVF
LNT_AQUAE       ----IGTPVCFEVAYPFFVKSF---------GCEFIAVLTNDAWFRDSEGTFQHMKLARV
LNT_BDEBA       -SVRWGGQICYEGLYPSFTRGLA------EKGADILVNVTNDSWFGKTFEPQQHLYMTLA
LNT_CHLTE       QPVRMANIICYESIFPGQVSTFV------RRGAQFLTLVTNDGWYGTSYGPWQHAAIDRL
LNT1_LEPIN      YSYSILPLLCYEAMFTELVLDYFQ----NEQKPEVLINITNDSWFDSELEAYQHSGAVRL
LNT2_LEPIN      ETGKFLPLICYEVILPEFVREFRT-----AGNPEFIVNLTNDKWYGATTESDQHMELGRL
                        :  :                       .    :                   

LNT_NOSS1       RAIETDRWSARATNTGYSAFVDPHGRTLWISG------YNTYETHAETIYRRQTQNLYVR
LNT_SYNY3       RAIEGDRWLARATNTGLSAIINPRGKTLWLSA------MNQYEIHAAPIYRRRGLILYSR
LNT_THEEB       RAVEGDRWLVRCTNTGLSAVIAPTGETLWLSK------ADEFVIYAATIFRRQTETLYTR
LNT_PROMM       RSIETARDLLSVANTGPSALVLATGKQQQLLA------PFTEGVGLADLHFHQGISGYTR
LNT_SYNPX       RAIETGRDVLSVANTGPTALVSADGTVQRLLE------PQTDAVAAAELQRRQQLTGYSR
LNT_PROMA       RSIESARNLISVANTGPTSMILSSGKIKSIIE------PFNEGVGVIDINVSQKISGYVR
LNT_PROMP       RSIENKKDNIIISNTGPSGLISEEGKIIKLFD------PNTEQNDVVNPNFSIEKTFYTT
LNT_BRUME       RAVEQGLPLIRAANNGLSAIVDTYGRITGSLA-----LDAVGVVDSYLPSP-RDPFWGRP
LNT_BRUSU       RAVEQGLPLIRAANNGLSAIVNTYGRITGSLA-----LDAVGVVDSYLPSP-RDPFWGRP
LNT_RHILO       RAVENGLPLLRAANNGISAVVDPRGRIVDALA-----IDARGAIDVKVPIS-GQAVVSSA
LNT_AGRFC       RAVETGVPVIRGANTGISAVIDPYGRIIAGLD-----YGRVGILDATLSGG-SNDAFTYD
LNT_BRADU       RAIELGLPLVRSANTGISAVIDPVGRTVASLG-----LGVEGILDASLPAA-IPPTIYAR
LNT_RHOPA       RAIEQGLPLVRAANTGVSAVIDPVGRIVAELG-----LGVEGVLDSGLPAP-VAPTIYAR
LNT_RICCN       RAVENGLPMIRVANNGISAIVDPFGRTIKKLN-----LNEINGTQGLIPKKLISPTIFSQ
LNT_RICPR       RAVENGLPMIRVANNGISAIVDPIGRIVKKLN-----LNEINYIQGLIPQKLTTPTIFSQ
LNT_BORBR       RTMETARPMVAATNTGITAAIDARGRVAAALP-----AGRAGVLPVAVQGM-TGLTPYAR
LNT_BORPA       RTMETARPMVAATNTGITAAIDARGRVAAALP-----AGRAGVLPVAVQGM-TGLTPYAR
LNT_BORPE       RTMETARPMVAATNTGITAAIDARGRVAAALP-----ADRAGVLPVAVQGM-TGLTPYAR
LNT_RALSO       RALESGRPMLRATNTGATAVVRPDGSVQARLP-----VFTLGTLQADVQGM-QGLTPFVR
LNT_NEIMA       RAMELGRYMVRATNTGATAIISPKGNIIAQAQ-----PDTETVLEGHIKGY-VGETPYMK
LNT_NEIMB       RAMELGRYMVRATNTGATAIISPKGNIIAQAQ-----PDTETVLEGHIKGY-VGETPYMK
LNT_CHRVO       RSLETGRYMLRATNNGMTAIIRPDGEISAVAA-----PFTAQVLTGFAQSR-QGLTPYMR
LNT_NITEU       RALETGRYMLRATNTGVTAIIDERGRVLEQLD-----MFTTAGLHSTAQGF-GGATPYVR
LNT_ECOLI       RALELARPLLRSTNNGITAVIGPQGEIQAMIP-----QFTREVLTTNVTPT-TGLTPYAR
LNT_ECO57       RALELARPLLRSTNNGITAVIGPQGEIQAMIP-----QFTREVLTTNVTPT-TGLTPYAR
LNT_SHIFL       RALELARPLLRSTNNGITAVIGPQGEIQAMIP-----QFAREVLTTNVTPT-TGLTPYAR
LNT_ECOL6       RALELARPLLRSTNNGITAVIGPQGEIQAMIP-----QFTREVLTTNVTPT-TGLTPYAR
LNT_SALTI       RSLELARPLLRSTNNGITAVIGPQGEIQAMIP-----QFTRQVLTTKVTPT-TGLTPYAR
LNT_SALTY       RSLELARPLLRSTNNGITAVIGPQGEIQAMIP-----QFTRQVLTTNVTPT-TGLTPYAR
LNT_YERPE       RALELGRPLLRSTNNGITAAIGPSGEILAQIP-----QFTQQVLEVKVTPT-TGITPYAR
LNT_PHOLL       RSLELGRPLLRGTNNGITAVIRPDGEVQAALP-----QFTRNVLVAKVTPA-TGITPYAR
LNT_BLOFL       RALELGRPILFCTNNGVTAIINADGSIQSQLS-----QFISTTLITNISPT-TGFTPYAQ
LNT_WIGBR       RALETGKNLLRASNNGITAIIGPNGELKSKLP-----QFVNDFLLEEVFST-MGVTPYVK
LNT_VIBVU       RALELGKPLIRSTNNGLTAVTDHRGKIIASIP-----QFETAVLRAELTPT-QGQTPYHQ
LNT_VIBVY       RALELGKPLIRSTNNGLTAVTDHRGKIIASIP-----QFETAVLRAELTPT-QGQTPYHQ
LNT_VIBPA       RALELGKPLIRSTNNGLTAVTDYKGKIVEQVP-----QFETAVLRAELTPT-DGTTPYRT
LNT_VIBCH       RALELGKPLIRATNNGVTAVTDERGRIMAQLP-----QFETGVLKATVTPT-RGSTPYFL
LNT_SHEON       RAIELGRPLVRATNNGVTAVVDENGNITAALP-----QFETGVLSATIPLV-TGQTWFAK
LNT_HAEIN       RALELGKPLIRATNTGISVFVDAQGKVLAQAP-----QFIETTLTYKIAPA-EGKTPYSV
LNT_PASMU       RALEFGKPVIRATNTGISVFIDEQGKIVAQAP-----QFIETTLTHKVAAT-EGQTPYAV
LNT_HAEDU       RALELGKPLLRAANTGITAVVGFDGKVIKKLP-----QFETNTLTAEIATT-KGHTLFGQ
LNT_PSEPK       RALEAGRWMIRATNNGVTALIDPFGRITTQIP-----QFQQAVLYGEVVPM-QQLTPYLQ
LNT_PSESM       RALEAGRWMIRATNNGVTALIDPFGRITVQIP-----QFERGVLYGEVVPM-HELTPYLH
LNT_PSEAE       RALESGRWMIRATNNGVTGLIDPYGRIVRQIP-----QFQQGILRGEVIPM-QGLTPYLQ
LNT_COXBU       RALETERYLLYSTNTGITAIISPEGKIVKSAP-----QNQRLLLTGQIKPV-TGKTPLMR
LNT2_TREDE      RAIELRTTLVRSTNSGYSVVVDPKGKIISDMP----LFEAESVYTEVPVYGHKKTF-YAS
LNT2_TREPA      RAIELRTTLVRSTNSGYTVVIGPEGKTRAAFP----LFQATSAVLHVPVYPVVRTY-YAR
LNT1_TREDE      RAVENRLPVLRATSSGQTAFIDQNGNIQEMLP----PFIKDILVADVTVLTEGHKTVYSY
LNT1_TREPA      RAIENRRALVRASTSGQTVAIAPDGRILDELQ----PFAPGVLVADVPIVTCACGG-YRY
LNT_CHLCV       RNQELGMPCVRSCHTGITVAADALGRVIKMLPYETRYRKASPGVLQVSLPMQNYPTLYAF
LNT_CHLPN       RNQEFGMPCVRACQTGVTAAVDSLGRILKILPYDTRETKAPSGVLETSLPLFNYKTLYGY
LNT_CHLMU       RNQELGMPCIRACHTGVSAAVDSLGRIVGVLPWESKTCPVCPDVLQVSVPVYSYPTIYAK
LNT_CHLTR       RNQELGIPCIRACRTGVSAAVDSLGRIVGILPWESRTCPVSTGVLQVSVPLYSYHTVYAR
LNT_HELPJ       YARRYDKIILHSANFSTSYILSPSLLGDILFRKRS-------------------------
LNT_HELPY       YARRYDKIILHSANFSTSYILSPSLLGDILFRKRS-------------------------
LNT_WOLSU       YAREHRTTILHAANRSPSGIIAP-------------------------------------
LNT_HELHP       YARLYGSVIFHATNLSPAAIITPFVSSR--------------------------------
LNT_CAUVC       RAIESAKPILRATPTGISAVVDARGRIVPGAS----LGLGESGVIDAQIPGMGQVTPYDN
LNT_GLOVI       RAVETGRYLVRASNNGTSAVVDPLGRTTRITG------WNVYAAFVEPVRLLEGMTLYAL
LNT_CAMJE       YASKYGVSVYHATNGKENIVILPKKLLSKDWK-----NLSKEIFNDKK------------
LNT_BORBU       RSIENGIKTIRATNSGITATINEYGETIKKLE-----TFKKGYLLSTVKLSPTFTTIYEK
LNT_GEOSL       RAVENRVPLVRAANTGITAIIDSKGHILRMTN------------------------LFEV
LNT_RHOBA       VAVGCRRPILSAANGGPTVWIDSAGRVVERLAK------GQSDVIYAQPRRDSRISLYVR
LNT_THEMA       RAVETRRQFLQVANTGITGLVDEYGRIVDALP------LRVRLAGEFHIKARKGETFYVR
LNT_AQUAE       RAIENEKFFLWVNNTGPSGIISPRGEVIKSID----------------------------
LNT_BDEBA       RAIEVRRPLVRSTNTGVSTAVLANGDVLQKSP----LHEEWSGQFVIKYLKNAPLTFFVQ
LNT_CHLTE       RCIENRRAMARCANTGVTLFYDICGRSYAETP------WWQQSVLTADVPLESRITFYTA
LNT1_LEPIN      RAIETGLPLIRSAVSGISEVWDARGIPMIVPIG----FHETGTRAFSIRLDAIESTIYTR
LNT2_LEPIN      RSIELRRWMVRSTNSGISANIDHLGRFVGNKK---TGLMTAEALSETIDVIDSPPTFYTQ
                                                                            

LNT_NOSS1       WGDWFTPLLVGLSFLGWSLNIFWRNDANANSKLR----------
LNT_SYNY3       WGDWVVFLLLVVSAIAWLYQIVFPLNQR----------------
LNT_THEEB       YGDWLLPLLLGMLSLSVLRQRGWH--------------------
LNT_PROMM       WREAPLIGLMLFAVVGLGLSRVRSWLISLMLC------------
LNT_SYNPX       L--------------------VWAWSSR----------------
LNT_PROMA       WGEIPLISSLLI---------VLCFIARLKGKA-----------
LNT_PROMP       YGERPLFLLCLF------LIGLNLYFGKFTN-------------
LNT_BRUME       PGWIQTVLILLTLLAASVGLILYSRRRFH---------------
LNT_BRUSU       PGWIQTVLILLTLLAASVGLILYSRRRFH---------------
LNT_RHILO       QRRINGMLIMLLFALVGALLNVRQRLRVN---------------
LNT_AGRFC       THRTYFWLIFSILMIVAVFPALSFARRQN---------------
LNT_BRADU       VGDVPAAVLVALAVLLAVRRRVAKRHP-----------------
LNT_RHOPA       VGELPAAVLVALVMMLVLLRKRPPGS------------------
LNT_RICCN       FGNFTILLLIVFILLINYLLALILDHQRV---------------
LNT_RICPR       FGNFAMLLSIVFIILIHYLLSLIFDE------------------
LNT_BORBR       FGDKPALALIGLLLIAAAARGRRPRQP-----------------
LNT_BORPA       FGDKPALALIGLLLIAAPALG-----------------------
LNT_BORPE       FGDKPALALIGLLLIAAAARGRRPRQP-----------------
LNT_RALSO       TGNAPALGAGVLVLLAALARRRRAGAA-----------------
LNT_NEIMA       TGSSWWLMGILTLAALILFIFRNK--EH----------------
LNT_NEIMB       TGSSWWLMGILALAALILFIFRNK--EH----------------
LNT_CHRVO       FGNLPVVLGCGALLLLALLLGWRRRGQH----------------
LNT_NITEU       FGNSLVFALIGLLLLAGSLAAFSGRRKTL---------------
LNT_ECOLI       TGNWPLWVLTALFGFAAVLMSLRQRRK-----------------
LNT_ECO57       TGNWPLWVLTALFGFAAVLMSLRQRRK-----------------
LNT_SHIFL       TGNWPLWVLTALFGFAAVLMSLRQRRK-----------------
LNT_ECOL6       TGNWPLWVLTALFGFAAVLMSLRARKH-----------------
LNT_SALTI       TGDWTVWLITVLFGFGALVMSLRQRRK-----------------
LNT_SALTY       TGNWPLWVLTALFAFGAVVMSLRQRRK-----------------
LNT_YERPE       FGSWPMWIITLVLGAFTLYCAIRGRSDKH---------------
LNT_PHOLL       WGNWPLWIITVSFSLFALTYNRR-KS------------------
LNT_BLOFL       FGSWWLLIISILICIFIIYIQKNQLFKIFTFFKKNK--------
LNT_WIGBR       FGNIPLLFFSIICFIISFFIKIKLIFLKN---------------
LNT_VIBVU       LGSWPLYIWVALSLALAWWRKRRTNA------------------
LNT_VIBVY       LGSWPLYIWVALSLALAWWRKRRTNA------------------
LNT_VIBPA       FGTWPLYFWVALSLMLAWWLPRKKD-------------------
LNT_VIBCH       WGTTPLYLWVGLAAGFAFWRQRRAR-------------------
LNT_SHEON       IGQTPLLILCGALLLVGFIRRQKQQ-------------------
LNT_HAEIN       LGNMPLYALSLLFLLLHSMMAFIRRKMNIL--------------
LNT_PASMU       FGNTAIYGLSLLLLLMRGFGALIRRRLFMPRL------------
LNT_HAEDU       FGHWLIYSLSFICVAFGLFRRQKHKKH-----------------
LNT_PSEPK       WRSWPLAIVCALLLGWALLAGRIAKTV-----------------
LNT_PSESM       WRSWPLAIVCLLLFGWALLAARISKTV-----------------
LNT_PSEAE       YRVWPLAGLAGVLLLWALLGRQLRPQERRLFG------------
LNT_COXBU       WNYYPVVGIIIIFLLLTFL-------------------------
LNT2_TREDE      YKDWLPIMMFLILI---FNIFLEKRRAKTARF------------
LNT2_TREPA      MRDWVIVLCALIFFAEGVRMAVHTRRHSTTQAESSLQQIRGEHV
LNT1_TREDE      LGDFFGVLCTIVLILNLCFIIINKFIKRSEVK------------
LNT1_TREPA      WGDALGVFFCVASLFILIAGGVRHMLRCRRGGWR----------
LNT_CHLCV       WGDFPMIFLSLLSIGCIGC-YFGYRLLAKKEKA-----------
LNT_CHLPN       CGDYPMILIAFCAVSYLGGGFLGYRLLAKKEIR-----------
LNT_CHLMU       FGDAPLLFVAVSSVLGVVGYFLKRRGKTLTGSDI----------
LNT_CHLTR       LGDAPLLLIAVCSVIGAIAYFYRKKKETPPQTFF----------
LNT_HELPJ       --------------------------------------------
LNT_HELPY       --------------------------------------------
LNT_WOLSU       --------------------------------------------
LNT_HELHP       --------------------------------------------
LNT_CAUVC       FGDVAFLALILISGVVSARVRIGKISSSIAPKRKLS--------
LNT_GLOVI       WGDWFVPLSAALALLGLIAGRSPAGRRGRRNF------------
LNT_CAMJE       --------------------------------------------
LNT_BORBU       IGDSFIHILVMMFLITTLRFQFMEDKNQLLSSSVVKIKV-----
LNT_GEOSL       WRPRFSWTRK----------------------------------
LNT_RHOBA       IGSWPAGLMGAATLCGLAWMTFEWLMRRRKRSVIA---------
LNT_THEMA       YGDWFFYLSVILAVVSVFISRMRGERNEGIGIRL----------
LNT_AQUAE       YGSRGILLFSF---------------------------------
LNT_BDEBA       WGHWDWIVILLVLGAVIGRGALNARSRRS---------------
LNT_CHLTE       HPDLVPHVCLGIAGVLALVAAVRKR-------------------
LNT1_LEPIN      FGNSFLWIFCILILISRLIFVSRIERKS----------------
LNT2_LEPIN      YGNLIPWLMLFLTGIYYLNLLIGIRRGKSA--------------