CLUSTAL format seed alignment for MF_01150

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

TORD_ALIF1      ------------MNELTAFNEQRAEIYWWLSSLLSAELTTEQLEQYGSFEVRTFLSNLAE
TORD_ALIFM      ------------MNELTAFNEQRAEIYWWLSSLLSAELTTEQLEQYGSFEVRTFLSNLAE
TORD_ALISL      ------------MNELNAFNEQRAEIYWWLSSLFAHELTKEQLEQYNSFEIRTFLTNLSE
TORD_PHOPR      ------------MQEFIAFNEQRAEIYWWMSSLLARELTNEDVTEYHGDEMFTFLSGLGM
TORD_VIBCB      ------------MQEVKAFNEKRAEIYWWFSSLFAKELTENELETYHSVEIRSFLAGLGE
TORD_VIBPA      ------------MQEVKAFNEKRAEIYWWFSSLFAKELSEKELETYHSVEIRSFLAGLGE
TORD_VIBTL      ------------MKDTKAFNEQRAEIYWWLSSLFAKELTQEELDHYHSVEIRSFLTGLGE
TORD_VIBVU      -----------MMQEIKAFNEKRAEIYWWLSSLFAKELTQEELDKYQSMEIRAFLTGLAE
TORD_VIBVY      -----------MMQEIKAFNEKRAEIYWWLSSLFAKELTQEELDKYQSMEIRAFLTGLAE
TORD_VIBC3      -----------MMQELKILNEKRAEIYWWLSSLFFKELSEQDIARYHSAEVRTFLSGLAD
TORD_VIBCM      -----------MMQELKILNEKRAEIYWWLSSLFFKELSEQDIARYHSAEVRTFLSGLAD
TORD_VIBCH      -----------MMQELKILNEKRAEIYWWLSSLFFKELSEQDIARYHSAEVRTFLSGLAD
TORD_ECO55      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECOSE      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECO24      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECOHS      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECOLC      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_SHIB3      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_SHIBS      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECO8A      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECOBW      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKN
TORD_ECODH      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKN
TORD_ECOLI      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECO57      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECO5E      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_SHIDS      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECOSM      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECO7I      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLMKS
TORD_ECOLU      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECO45      --------------MTTLTVQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECOL5      --------------MTTLTVQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECO27      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECOL6      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_ECO81      --------------MTTLTAQQIACVYAWLAQLFSRELDDEQLTQIASAQMAEWFSLLKS
TORD_SALCH      -----------MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALPC      -----------MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALHS      -----------MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALNS      -----------MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALPA      -----------MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALPK      -----------MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALTY      -----------MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALDC      -----------MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALEP      -----------MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALG2      -----------MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALTI      -----------MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALPB      -----------MIKQPALVQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALA4      -----------MIKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALSV      -----------MNKQPALAQEQYACVYAWLALLFFREVDDEGLIQLQSAEIADWLALLKR
TORD_SALAR      -----------MIKQPALAQEQYACVYAWLALLFFREVDDEGLMQLQSAEIADWLALLKR
TORD_HAES1      --------------MITLNTEEKIFIYSWLKNILSHELTEQQLQQYQQGVFTPLFDFLS-
TORD_HISS2      --------------MITLNTEEKIFIYSWLKNILSHELTEQQLQQYQQGVFTPLFDFLS-
TORD_PASMU      --------------MMPFSREERQFVYTWLSNMLGHELSASQLAQYQQGLFDDFFAFLT-
TORD_ACTPJ      -----------MAHSQLLSSEERLFCYRWFHSLLAKELSEPQLQALQAGQFASFFAFLA-
TORD_ACTP7      -----------MAHSQLLSSEERLFCYRWFHSLLAKELSEPQLQALQAGQFASFFALLA-
TORD_ACTSZ      --------------MIALEKDEKLLILNWLRNLLARELSDEQLQTLQAVEFSQFFAFLA-
TORD_AGGAN      MLHHNQMVLMGLLNMLKISIQERQFVYSWICSLLSKELTQDQLAHYQRGDFDSLFAFLK-
TORD_SHEB5      -------------MSQVDINHARALVYQLLSSLFAREVDEQRLKELTSEAAQQFWEQLSL
TORD_SHEB2      -------------MSQVDINHARALVYQLLSSLFAREVDEQRLKELTSEAAQQFWEQLSL
TORD_SHEB9      -------------MSQVDINHARALVYQLLSSLFAREVDEQRLKELTSEAAQQFWEQLSL
TORD_SHEB8      -------------MSQVDINHARALVYQLLSSLFAREVDEQRLKELTSEAAQQFWEQLSL
TORD_SHEMA      -------------MSQVDINHARALVYQLLSSLFAREVDEQRLKELTSEAAQQFWEQLSL
TORD_SHESA      -------------MSNVDINHARALVYQLLSSLFAREIDEQRLKQLTSEQAQQFWTQLGY
TORD_SHESR      -------------MSNVDINHARALVYQLLSSLFAREIDEQRLKQLTSEQAQLFWTQLGY
TORD_SHESM      -------------MSNVDINHARALVYQLLSSLFAREIDEQRLKQLTSEQAQQFWTQLGY
TORD_SHEON      -------------MSNVDINHARALVYQLLSSLFAREVNAQRLQELTSDAAQQFWTQLGH
TORD_SHEPA      ---MIKDAVNTETVEVNPVDQVRSTIYQLLSSLFAKEIDHKILHDLTSEQAQQFWAQLGS
TORD_SHEPW      ----------MSAETANPVNQARSTIYQLLSSLFAKEVDHKTLHELTSTQAQAFWSQLAE
TORD_SHELP      --------MNKPSIDQTPANQARARVYRLLSDLFAKEIDHQRLQSLQSAEAQAFFDLLAG
TORD_COLP3      ----MSHVSQETAQEISEEREARAIVYNFLSSLFAKEVTSDLVAQLTSAQGQSFLKSLAL
TORD_SHEAM      ----MNKMSHSEEFAAGEMNAIRASVWQLLSSLYAKELSRERICELAGAELWQAFAAQVE
TORD_FERBD      -------MDEQEIREEVALAERRATLYWWFASMLCRELDSDQLNTLCSESGRVLLDALAE
TORD_SALBC      -------------MQHSSVTSPRAAIYQWFSQLLFQELTEAQLVTLGGRESRAWIASLST
TORD_SERP5      ------------MPLLNEVARQRAIIYRWFSQLLFQELSDEGLLRLRDKENLALLNALKL
TORD_AERHH      ------------MQEFLATSERRAELYWWFATLFTAQLSDEQIAEYDSYDVRSFLKSLST
TORD_AERS4      ------------MQEFLATSERRAELYWWFATLFSAELSDKQIAEYDSYDVRSFLKSLST
TORD_PSYWF      ---------MNNSQQWQAANTARAALYRWFAELFARELTKTNLTQLQAQ--YPSLHAAFS
                                             :  :   ::    :                 

TORD_ALIF1      TPELSDSVNALIEKLNAVQGRE---DAQLELSADFCDAFLGSDKSSALPYASMYLDKSGL
TORD_ALIFM      TPELSDSVNALIEKLNAVQGRE---DAQLELSADFCDAFLGSDKSSALPYASMYLDKSGL
TORD_ALISL      TPELTDSISSIVTKLNELQTRE---DAQLELSADFCEAFLGSDKNSALPYASMYLDKSRL
TORD_PHOPR      TPELKEPVEAFRNAINTLKTRE---DAQLELAADFCGLFLSTPKSGALPYASIYVGESGL
TORD_VIBCB      NESLKPAVDTLVDALNRLQDRE---DAQLELAADFCELFLKTEKHGALPYASMYIGKSGL
TORD_VIBPA      NESLKPAVDSLVDALNRLQDRN---DAQLELAADFCELFLKTDKYGALPYASMYIGESGL
TORD_VIBTL      NETLKPAIDSLVDALNRLQTRE---DAQLELSADFCDLFLKTDKHGALPYASMYIGQTGL
TORD_VIBVU      NDALRPSVNAFVDALNRLVDRQ---DAQLELAADFCDLFLKTAKHGALPYASIYLTKDGL
TORD_VIBVY      NDALRPSVNAFVDALNRLVDRQ---DAQLELAADFCDLFLKTAKHGALPYASIYLTKDGL
TORD_VIBC3      EQSLSREVKHLVEALNRLQDRQ---DAQLELAADFCDLFLKSDRDSALPYASVYTDQ-GL
TORD_VIBCM      EQSLNREVKHLVEALNRLQDRQ---DAQLELAADFCDLFLKSDRDSALPYASVYADQ-GL
TORD_VIBCH      EQSLNREVKHLVEALNRLQNRQ---DAQLELAADFCDLFLKSDRDSALPYASVYTDK-GL
TORD_ECO55      EPPLAAAVNELENCIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECOSE      EPPLAAAVNELENCIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECO24      EPPLAAAVNELENCIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECOHS      EPPLAAAVNELENCIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECOLC      EPPLVAAVNELENCIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_SHIB3      EPPLAAAVNELENCIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_SHIBS      EPPLAAAVNELENCIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECO8A      EPPLAAAVNELENCIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECOBW      EPPLTAAVNELENRIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECODH      EPPLTAAVNELENRIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECOLI      EPPLTAAVNELENRIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECO57      EPPLTAAVDELENRVATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECO5E      EPPLTAAVDELENRVATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_SHIDS      EPPLTAAVNELENCVATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECOSM      EPPLTAAVNELENRIAALTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECO7I      EPPLTAAVNELENRIAALTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECOLU      EPPLTAAVNELENRIAALTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECO45      EPPLTAAVNGLENSIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECOL5      EPPLTAAVNGLENSIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECO27      EPPLTAAVNGLENSIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASANKQDEQ-
TORD_ECOL6      EPPLTAAVNGLENSIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_ECO81      EPPLTAAVNGLENSIATLTVRD---DARLELAADFCGLFLMTDKQAALPYASAYKQDEQ-
TORD_SALCH      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALPC      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALHS      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALNS      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALPA      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALPK      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALTY      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALDC      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALEP      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALG2      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALTI      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALPB      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALA4      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALSV      QPALAASVALLEQKIAALSLRQ---DAQLELAADFCGLFLMTDKKSALPYASQYPQQEPG
TORD_SALAR      QPALTASVAQLEQKIAALRQRQ---DAQLELAADFCGLFLMTDKKSALPYASQYLQKEPG
TORD_HAES1      EQDLAEQINTVRNSLMQLSNLP---LAHLELAADFAQLFLLNGENSALPYASAYLSEKE-
TORD_HISS2      EQDLAKQINTVRNSLMQLSNLP---LAHLELAADFAQLFLLNGENSALPYASAYLSEKE-
TORD_PASMU      EQGFQAQVEGIQQQLQQLKTVE---LAHLELAADYTQLFLLDGSSSALPYASVYLPEAQ-
TORD_ACTPJ      ELGFQPQVTDLQNELAKLTAYD---SPRLELAADFAQCFLLEGKLSALPYASYYLDERD-
TORD_ACTP7      ELGFQPQVTDLQNELAKLTAYD---SPRLELAADFAQCFLLEGKLSALPYASYYLDERD-
TORD_ACTSZ      EIGFEKQSSALQQEIQKIALFQ---HPRLELAADFTQCFLLEGKVSALPYASAYLDGQS-
TORD_AGGAN      ELGFTEQT---EQLIATLRPME---FQQLELAADFAHTFLLEGNISAIPYMSAYLQGEE-
TORD_SHEB5      EANFTQSVDKIRSTLNGIKD----DEALLELAADYCGLFLVGTKHSASPYASLYLSGE--
TORD_SHEB2      EANFTQSVDKIRSTLNGIKD----DEALLELAADYCGLFLVGTKHSASPYASLYLSGE--
TORD_SHEB9      EANFTQSVDKIRSTLNGIKD----DEALLELAADYCGLFLVGTKHSASPYASLYLSGE--
TORD_SHEB8      EAKLTQSVDKIRSTLNGIKD----DETLLELAADYCGLFLVGTKHSASPYASLYLSGE--
TORD_SHEMA      EANFTQSVDKIRSTLNGIKD----DEALLELAADYCGLFLVGTKHSASPYASLYLSGE--
TORD_SHESA      APEFSASVASIQKVLNGLTS----DEALLELAADYCGLFLVGTKHSASPYASLYLNRE--
TORD_SHESR      ASEFSAPVANIQKVLNGLTS----DEALLELAADYCGLFLVGTKHSASPYASLYLSPE--
TORD_SHESM      APEFSAPVASIQKVLNDLTS----DEALLELAADYCGLFLVGTKYSASPYASLYLSPE--
TORD_SHEON      EPEFSAPVATMQKVLNDLQR----NDALLELAADYCGLFLVGTRHSASPYASLYLNSE--
TORD_SHEPA      EAEFKADVDVLVAELAKLNT----DKALLELAADYCGLFLVGTKYSASPYASLYLDDKP-
TORD_SHEPW      EPNFKADVDVLVAELAKLNS----DKALLELAADYCGLFLVGTNNSASPYASLYLTDTP-
TORD_SHELP      EPRLAPEVNIIQEVLAELGD----EASLLNLAADYCGLFLVGGKQSANPYAGLYLTPE--
TORD_COLP3      DPSLSASVNEINTKLVKLNS----KESLLELAADFCGLFLVDGRTSVSPYAGQYLSVEQG
TORD_SHEAM      LQASASQIQAALAHAAKYDASQGGDDARLELAADFCSAFLQNAEHCAAPYASLYLGDAGK
TORD_FERBD      EPSLAPGCQKLRRALAGVQVLA---TPQLELAADYATAFLGDHLGSAPPYASVYVEPGG-
TORD_SALBC      IPGLASDVKRFERSLTRVLHRE---AREQELAADFASLFLLAPPVGVSPYAGHYPHTTPA
TORD_SERP5      IPELSLLVTHFQRRLRAMLKRE---ECRLELAADFASLFLLPAPSGVSPYAGHYPHTNSP
TORD_AERHH      LDPMRPAVAELNDAIARLLVRP---ERANALAGDFHELFLAND--AVSPHESAHQDAAAL
TORD_AERS4      LDPMRPAVTELNEAIARLLVRD---ERATALAADFKGLFLADT--AVQPYESAHLDASSL
TORD_PSYWF      DLNLEPQSAALQTALENLQVIPA-PDRALELAADFAHLFLLSGHQSAPPYASYYLESDQ-
                                              *:.*:   **      . *: .        

TORD_ALIF1      LNA-------------------------KPAQDMREWLTKYNIAQKAEFNEPADHIAIEL
TORD_ALIFM      LNA-------------------------KPAQDMREWLTKYNIAQKAEFNEPADHIAIEL
TORD_ALISL      LNA-------------------------KPAQDMRDLLEKYNITQKAEFNEPADHIAIEL
TORD_PHOPR      LND-------------------------KPAQDMNVLMEEYGIAQRKEFNEPADHIAVEL
TORD_VIBCB      LND-------------------------KPAEEMEKLMADFGMQVDENLKEPADHLAVEL
TORD_VIBPA      LND-------------------------KPAEEMEKLMADFGVQVDENLKEPADHLAVEL
TORD_VIBTL      LND-------------------------KPAKDMEEIMAKHNLVVNQDLKEPADHIAIEL
TORD_VIBVU      LNG-------------------------EPAQKMDAWLKKHGVQVNQQLNEPADHLAIML
TORD_VIBVY      LNG-------------------------EPAQKMDAWLKKHGVQVNQQLNEPADHLAIML
TORD_VIBC3      LNG-------------------------KPAQQMRELLSAHGVKVEQNLNEPEDHLAIQL
TORD_VIBCM      LNG-------------------------KPAQQMRELLSAHGVKVEQNLNEPEDHLAIQL
TORD_VIBCH      LNG-------------------------KPAQQMRELLGAHGVKVEQNLNEPEDHLAIQL
TORD_ECO55      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECOSE      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECO24      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECOHS      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECOLC      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_SHIB3      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_SHIBS      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECO8A      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECOBW      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECODH      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECOLI      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECO57      --------------------------------EIKRLLVEAGMETSGNFNEPTDHLAIYL
TORD_ECO5E      --------------------------------EIKRLLVEAGMETSGNFNEPTDHLAIYL
TORD_SHIDS      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECOSM      --------------------------------EIKRLLVEAGMVTSGNFNEPADHLAIYL
TORD_ECO7I      --------------------------------EIKRLLVEAGMVTSGNFNEPADHLAIYL
TORD_ECOLU      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECO45      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECOL5      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECO27      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_ECOL6      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYP
TORD_ECO81      --------------------------------EIKRLLVEAGMETSGNFNEPADHLAIYL
TORD_SALCH      --------------------------------MIKHLLLEAGMEVNDDFKEPADHLAIYL
TORD_SALPC      --------------------------------MIKHLLLEAGMEVNDDFKEPADHLAIYL
TORD_SALHS      --------------------------------MIKHLLLEAGMEVNDDFKEPTDHLAIYL
TORD_SALNS      --------------------------------MIKHLLLEAGMEVNDDFKEPTDHLAIYL
TORD_SALPA      --------------------------------MIKHLLLEAGMEVNDDFKEPTDHLAIYL
TORD_SALPK      --------------------------------MIKHLLLEAGMEVNDDFKEPTDHLAIYL
TORD_SALTY      --------------------------------MIKHLLLEAGMEVNDDFKEPTDHLAIYL
TORD_SALDC      --------------------------------MIKHLLLEAGMEVNDDFKEPADHLAIYL
TORD_SALEP      --------------------------------MIKHLLLEAGMEVNDDFKEPADHLAIYL
TORD_SALG2      --------------------------------MIKHLLLEAGMEVNDDFKEPADHLAIYL
TORD_SALTI      --------------------------------MIKHLLLEAGMEVNDDFKEPADHLAIYL
TORD_SALPB      --------------------------------MIKHLLLEAGMEVNDDFKEPADHLAIYL
TORD_SALA4      --------------------------------MIKHLLLEAGMEVNDDFKEPADHLAIYL
TORD_SALSV      --------------------------------MIKHLLLEAGMEVNDDFKEPTDHLAIYL
TORD_SALAR      --------------------------------MIKHLLLEAGMDVNDGFKEPTDHLAIYL
TORD_HAES1      --------------------------LNQHIAFIDHLLLKYQLKFDHSLREPSDHLAVYL
TORD_HISS2      --------------------------LNQHIAFIDHLLFKYQLKFDHNLREPSDHLAVYL
TORD_PASMU      --------------------------LTCHFTFLEALLVRFQLQLNRDKPEPSDHLCVYL
TORD_ACTPJ      --------------------------LSENLAVMDQWLTKFQLKINRLHNEPSDHLCIYL
TORD_ACTP7      --------------------------LSENLAVMDQWLTKFQLKINRLHNEPSDHLCIYL
TORD_ACTSZ      --------------------------LKQNLAKMDRYLEHFQLQINRQTNEPSDHLVVYL
TORD_AGGAN      --------------------------LGVALNLVDQWMTHYQLGVNREQNEPSDHVSVLL
TORD_SHEB5      ---------------------DEPLLFGEQHQQMSEFLHQSKLQVQSHFPEPADHLAVML
TORD_SHEB2      ---------------------DEPLLFGEQHQQMSEFLHQSKLQVQSHFPEPADHLAVML
TORD_SHEB9      ---------------------DEPLLFGQQHQQMSEFLHQSKLQVQSHFPEPADHLAVML
TORD_SHEB8      ---------------------DEPLLFGQQHQQMSEFLHQSKLQVQSHFPEPADHLAVML
TORD_SHEMA      ---------------------DEPLLFGEQHQQMSEFLHQSKLQVQSHFPEPADHLAVML
TORD_SHESA      ---------------------EEPLLFGQQHQQMSEFLHQSKLQVQSHFPEPADHLAVIL
TORD_SHESR      ---------------------EEPLLFGQQHQQMSEFLHQSQLQVQSHFPEPADHLAVIL
TORD_SHESM      ---------------------EEPLLFGQQHQQMSEFLHQSKLQVQSHFPEPADHLAVIL
TORD_SHEON      ---------------------DEPLLFGQQHQQMSEFLHQSKLQVQSHFPEPADHLAVML
TORD_SHEPA      -----------------AKKGDEPLLFGEQHQQMTQFLKQSQLQVQSEFPEPADHLAVIL
TORD_SHEPW      -----------------VAKGDEPLLFGEQHQQMTQFLKQSQLQVQSEFPEPADHLAVIL
TORD_SHELP      ------------------GDEEQPQLFGPQHQEMLALLKQSKLGVQSDFPEPADHISVIL
TORD_COLP3      GEPSEKLSNAAINESGSKSKKNKAQLFGELHQQMTEFLTDNKLQIHSDFPEPGDHIAVIL
TORD_SHEAM      TERNETASYDTE-----SQDKAARSLYGEKHQLMSDYLRSAGLGLDADFREPSDHLAVIL
TORD_FERBD      ------------------------MMFQHPHQQMVQWLQQWQLAVSFDGNEPADHFAIML
TORD_SALBC      ----------------------------QERRQMNALLVEQALAPRE--NEASDHIAIQL
TORD_SERP5      ----------------------------EERQALRQKLVEHRLAPQN--NEAVDHIAIQL
TORD_AERHH      -------------------------------ERMKARLSRLNIDVSAKYQQPVDHLGVEL
TORD_AERS4      -------------------------------GRMQQRLVRLAIDVSAKYPQPVDHLGVEL
TORD_PSYWF      ------------------------MLYGKPAQQMSEFLASHKLDLHPEFREPKDHLSIYL
                                                 :   :    :       :. **. :  

TORD_ALIF1      DFLGNLIVMTNQQVSEDEFEAYMSAQLTFINEQLLSWTPRFNEICIERD---KFGFYAAV
TORD_ALIFM      DFLGNLIVMTNQQASEDEFEAYMNAQLTFINEQLLSWTPRFNEICIERD---KFGFYAAV
TORD_ALISL      DFLGNLIVMTNQQTTEPEFEQFMAAQLQFINEQLLSWAPRFNQLCSERD---TFGFYAAV
TORD_PHOPR      DFMGNLIIQANQELDEEKREALMQAQLAFVNDMLLNWIPAFAQSCKARD---DFGFYTAS
TORD_VIBCB      DFLGNMIIRSNELEQEKHMEEALEKQNEFIQQHLMTWLPQFAAKCKQFD---EFGFYVSV
TORD_VIBPA      DFLGNMIIRSNELEQEKHMEEAFVKQNDFIQNQLMSWLPKFAEKCKQFD---EFGFYLSV
TORD_VIBTL      DFLGNLIIRSNETELEEELEKSFAVQQQFIEQQLLTWVPKFNVKCHDID---TFGFYASV
TORD_VIBVU      DFLGNLIIRSNEFEQDRHMEEAFIEQNAFIQEMLLSWLPSFSQRAAEYD---EFGFYNSA
TORD_VIBVY      DFLGNLIIRSNELEQDRHMEEAFIEQNAFIQEMLLSWLPSFSQRAAEYD---EFGFYNSA
TORD_VIBC3      DFLAHLAISANQIEHSAQLSLALQAQSDFISQHLLTWLPAFAERCTQFD---AFGLYSAA
TORD_VIBCM      DFLAHLAISANQIEHSAQLSLALQAQSDFISQHLLTWLPAFAERCTQFD---AFGLYSAA
TORD_VIBCH      DFLAHLAISANQIEHSAQLSSALQAQSDFISQHLLTWLPAFAERCTQFD---AFGLYSAA
TORD_ECO55      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALWQWLPEFVVRCRQYD---SFGFYAAL
TORD_ECOSE      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALWQWLPEFVVRCRQYD---SFGFYAAL
TORD_ECO24      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALWQWLPEFVVRCRQYD---SFGFYAAL
TORD_ECOHS      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALWQWLPEFVARCRQYD---SFGFYAAL
TORD_ECOLC      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALWQWLPEFVARCRQYD---SFGFYAAL
TORD_SHIB3      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALWQWLPEFAARCHQYD---SFGFYAAL
TORD_SHIBS      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALWQWLPEFAARCHQYD---SFGFYAAL
TORD_ECO8A      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALWQWLPEFAARCHQYD---SFGFYAAL
TORD_ECOBW      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALWQWLPEFVARCRQYD---SFGFYAAL
TORD_ECODH      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALWQWLPEFVARCRQYD---SFGFYAAL
TORD_ECOLI      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALWQWLPEFVARCRQYD---SFGFYAAL
TORD_ECO57      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALRQWLPEFVARCHQYD---SFGFYAAL
TORD_ECO5E      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALRQWLPEFVARCHQYD---SFGFYAAL
TORD_SHIDS      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALWQWLPEFVARCHQYD---SFGFYAAL
TORD_ECOSM      ELLSHLHFSLGEGSVPARR---IDSLRQKTLTALWEWLPEFAARCRQYD---SFGFYAAL
TORD_ECO7I      ELLSHLHFSLGEGSVPARR---IDSLRQKTLTALWEWLPEFAARCRQYD---SFGFYAAL
TORD_ECOLU      ELLSHLHFSLGEGTVPARR---IDSLRQKTLTALWQWLPEFAARCHQYD---SFGFYAAL
TORD_ECO45      ELLSHLHFSLGEGTVPARR---IDGLRQKTLTALREWLPEFAARCRQYD---SFGFYAAL
TORD_ECOL5      ELLSHLHFSLGEGTVPARR---IDGLRQKTLTALREWLPEFAARCRQYD---SFGFYAAL
TORD_ECO27      DLLSHLHFSLGEGTVPARR---IDGLRQKTLTALREWLPEFAARCRQYD---SFGFYAAL
TORD_ECOL6      ELLSHLHFSLGEGTVPARR---IDGLRQKTLTALREWLPEFAARCRQYD---RFGFYAAL
TORD_ECO81      ELLSHLHFSLGEGTVPARR---IDGLRQKTLTALRQWLPEFVARCHQYD---RFGFYAAL
TORD_SALCH      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCLKHD---PYGFYAAL
TORD_SALPC      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCLKHD---PYGFYAAL
TORD_SALHS      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCLKHD---PYGFYAAL
TORD_SALNS      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCLKHD---PYGFYAAL
TORD_SALPA      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCLKHD---PYGFYAAL
TORD_SALPK      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCLKHD---PYGFYAAL
TORD_SALTY      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCLKHD---PYGFYAAL
TORD_SALDC      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCLKHD---PYGFYAAL
TORD_SALEP      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCLKHD---PYGFYAAL
TORD_SALG2      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCLKHD---PYGFYAAL
TORD_SALTI      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCLKHD---PYGFYAAL
TORD_SALPB      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCLKHD---PYGFYAAL
TORD_SALA4      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCLKHD---SYGFYAAL
TORD_SALSV      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCFKHD---SYGFYAAL
TORD_SALAR      ELLSHLHFSLGE-SFQQRR---MNKLRQKTLSSLLEWLPEFTNNCVKHD---PYGFYAAL
TORD_HAES1      ELLITLEK-SGQKEKSFN----------FIQHYLLAWLIPFNKKVQKIK--TETSFYQAI
TORD_HISS2      ELLITLEK-SGQKEKSFN----------FIQHYLLAWLIPFNKKVQKIK--TETSFYQAI
TORD_PASMU      ELLRQLAE-VDDMKTYRQ----------LIQDALLPWLLPFNDKVQRVK--TRTTFYQQV
TORD_ACTPJ      EVLIKLIETEQPVQVQQQ----------FIRQQLLGWLPQWAEKTAQIH--SSTAFYQII
TORD_ACTP7      EVLIKLIETEQPVQVQQQ----------FIRQQLLGWLPQWAEKTAQIH--SSTAFYQII
TORD_ACTSZ      EVLIKLLEQNKTTEAKE-----------FIQQQLLTWFPQFAAKTEKTN--IRTNFYPIL
TORD_AGGAN      AILIRLIG-EQPFHVQQD----------FAQKALLNWLPEFVRKANNTS--CETKFYAML
TORD_SHEB5      AYMAHLCCHSEDS-VQLS----------FLQTCVDSWLAKFINQLTQCH---KNGFYSAV
TORD_SHEB2      AYMAHLCCHSEDS-VQLS----------FLQTCVDSWLAKFINQLTQCD---KNGFYSAV
TORD_SHEB9      AYMAHLCCHSEDS-VQLS----------FLQTCIDSWLAKFINQLTQCD---KNGFYSAV
TORD_SHEB8      AYMAHLCCHSEDS-VQLS----------FLQTCVDSWLAKFINQLTQCD---KNGFYSAV
TORD_SHEMA      AYMAHLFCHSENS-VQLS----------FLQTCFNSWLAKFINHLTQCN---KNGFYSAV
TORD_SHESA      AYMGHLACHSEDA-AQLS----------FLNACIDSWLAKFVAKVVECDSKHSNGFYSAL
TORD_SHESR      AYMGHLTCHSEDA-AQLS----------FLNACIDSWLAKFVAKVVECDSKHSNGFYSAL
TORD_SHESM      AYMGHLACHSEDA-AQLS----------FLNTCIDSWLAKFVAKVIECDSQHSNGFYSAL
TORD_SHEON      AYMGHLACHSEDA-AQLN----------FLDACIDSWLAKFVVKVVECDSKHRNGFYSAL
TORD_SHEPA      AYVAHLCTHSDEA-EQHS----------FIKANLANWLGNFVAKVTEVD---TGNFYQAL
TORD_SHEPW      AYVAHIAMYTSNQ-QQLE----------FIRDNLTNWLATFVAKVAKVD---TGKFYIAL
TORD_SHELP      AYVAQQATSLDDK-AQQR----------FIAKYLDAWLAEFAKRVSDRD---PGRFYQAL
TORD_COLP3      AYIAHLCVTSGSE-QQLN----------FINSYLMTWLSDFTQQVNKHD---HGQFYCFV
TORD_SHEAM      GLMAHLCTSATEE-SQRA----------FLESAILSWLPEFNARLGKLK--LESPLYGAL
TORD_FERBD      DLMGNLVLKGVDSPEAQS----------AQSALLAEMLPPMRRWVTQCQ--RQPGFYAAL
TORD_SALBC      ALMAEQISREASVATQYY----------FLQHHILCWAPLFMASCQQRE---AEGFYVLA
TORD_SERP5      ALMTALIEEGVEREQQDL----------FLNRHLLSWLPLCTKRCYQRD---RFGFYAAA
TORD_AERHH      DLMGNLIIRAAEAASADLRERWLGEQEALLHGHLLAWFPHFERACRAAD---PFGFYGAS
TORD_AERS4      DLMGNLIIRAAEAPSADQREQWLGEQEAVLHGHLLAWFPHFEVACRAAD---PFGFYGAS
TORD_PSYWF      QVMSLWIKSSVDEQANLIE--MAVQQQHFLEDALLSWLPKFAARCQHIR--VKTQVYPAI
                  :                              .                     .*   

TORD_ALIF1      TGLLVTFLKLDVKFLAGE------------
TORD_ALIFM      TGLLVTFLKLDVKFLAGE------------
TORD_ALISL      THFLVTFLELDVKFLAGE------------
TORD_PHOPR      VNLLVAFCQLDAAFLLGEE-----------
TORD_VIBCB      AQLLIAFCKLDSTYLLGE------------
TORD_VIBPA      AQLLIAFCKLDSAYLLGE------------
TORD_VIBTL      SSLLLAFCKLDTQYLAGE------------
TORD_VIBVU      IKLLVAFCMLDSDYLVG-------------
TORD_VIBVY      IKLLVAFCMLDSDYLVG-------------
TORD_VIBC3      ARLALAFIQQDKHCLDELIQETH-------
TORD_VIBCM      ARLALAFIQQDKHCLDELIQETH-------
TORD_VIBCH      ARLALAFIQQDKHCLDELFQETH-------
TORD_ECO55      SQLLLVLVESDHQNR---------------
TORD_ECOSE      SQLLLVLVESDHQNR---------------
TORD_ECO24      SQLLLVLVESDHQNR---------------
TORD_ECOHS      SQLLLVLVECDHQNR---------------
TORD_ECOLC      SQLLLVLVECDHQNR---------------
TORD_SHIB3      SQLLLVLVECDHQNK---------------
TORD_SHIBS      SQLLLVLVECDHQNK---------------
TORD_ECO8A      SQLLLVLVECDHQNR---------------
TORD_ECOBW      SQLLLVLVECDHQNR---------------
TORD_ECODH      SQLLLVLVECDHQNR---------------
TORD_ECOLI      SQLLLVLVECDHQNR---------------
TORD_ECO57      SQLLLVLVEGDHQNR---------------
TORD_ECO5E      SQLLLVLVEGDHQNR---------------
TORD_SHIDS      SQLLLVLVEGDHQNR---------------
TORD_ECOSM      SQLLLVLVECDHQNR---------------
TORD_ECO7I      SQLLLVLVECDHQNR---------------
TORD_ECOLU      SQLLLVLVECDHQNR---------------
TORD_ECO45      SQLLLVLVECDYQKR---------------
TORD_ECOL5      SQLLLVLVECDYQKR---------------
TORD_ECO27      SQLLLVLVECDYQKR---------------
TORD_ECOL6      SQLLLVLVECDYQKR---------------
TORD_ECO81      SQLLQVLVECDNQKG---------------
TORD_SALCH      SQLLLAIVRFDDGKEDLSIVAAE-------
TORD_SALPC      SQLLLAIVRFDDGKEDLSIVAAE-------
TORD_SALHS      SQLLLAIVRFDDGKEDLSIVAAE-------
TORD_SALNS      SQLLLAIVRFDDGKEDLSIVAAE-------
TORD_SALPA      SQLLLAIVRFDDGKEDLSIVAAE-------
TORD_SALPK      SQLLLAIVRFDDGKEDLSIVAAE-------
TORD_SALTY      SQLLLAIVRFDDGKEDLSIVAAE-------
TORD_SALDC      SQLLLAIVRFDDGKEDLSIVAVE-------
TORD_SALEP      SQLLLAIVRFDDGKEDLSIVAVE-------
TORD_SALG2      SQLLLAIVRFDDGKEDLSIVAVE-------
TORD_SALTI      SQLLLAIVRFDDGKEDLSIVAVE-------
TORD_SALPB      SQLLLAIVRFDDGKEDLSIVAAE-------
TORD_SALA4      SQLLLAIVLFDDGKEDLSIVAAE-------
TORD_SALSV      SQLLLAIVRFDDGKEDLSIVAAE-------
TORD_SALAR      SQLLLAIVRFDDGEEDFPIVAAG-------
TORD_HAES1      TEILITLLNKT-------------------
TORD_HISS2      TEILITLLNKNVKLS---------------
TORD_PASMU      VVLLILLLQADCQN----------------
TORD_ACTPJ      SNLLLGFLQQDIT-----------------
TORD_ACTP7      SNLLLGFLQQDIA-----------------
TORD_ACTSZ      VKLLFAVLQNF-------------------
TORD_AGGAN      CNLFLAFMTEDFAV----------------
TORD_SHEB5      ATLTLAWVKQDIAQLEPAVAVIS-------
TORD_SHEB2      ATLTLAWVKQDIAQLEPA------------
TORD_SHEB9      ATLTLAWVKQDIAQLEPAEAVIS-------
TORD_SHEB8      AILTLAWVKQDIAQLEPAEAVIS-------
TORD_SHEMA      ATLTLAWVKQDIAQLEPAVAIIS-------
TORD_SHESA      ATLTLAWVQQDKQQLEQAMH----------
TORD_SHESR      ATLTLAWVQQDKQQLEQAIN----------
TORD_SHESM      ATLTLAWVQQDKQQLEQAIH----------
TORD_SHEON      ASLTLAWVKQDKQLLEQTINSSVEQTLS--
TORD_SHEPA      ARLTYSWVKSDAEWLESELN----------
TORD_SHEPW      AQLTLAWVNSDLEWLTSESTS---------
TORD_SHELP      ARLTQIWVSLDCEALGA-------------
TORD_COLP3      ADLTFEWLKVDTEFLLSD------------
TORD_SHEAM      GDFTLAWARLDTELLGG-------------
TORD_FERBD      AELLLAFVSLDQTLIEGEFSLAQ-------
TORD_SALBC      VAMIVHFMHEDAQYLESLLMDNVYCRNH--
TORD_SERP5      MGLLTGFVQQDSEWLIACRLATHPARPGQS
TORD_AERHH      ARLLGVFLTMDANYLSLVKPAPAAD-----
TORD_AERS4      ARLLGVFLTMDANYLSLVKPASSAD-----
TORD_PSYWF      IDLLLHFVQEDRQALEDMAEAE--------
                  :