CLUSTAL format seed alignment for MF_01151

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

GRPE_ONYPE       ---------------------------------MFLEKDQDNLDNLETQAKELHKDCKEC
GRPE_AYWBP       ---------------------------------MFLEKEQDNLDNLKTQTKELHKDYTEC
GRPE_ACHLA       ----------------------------------MADKEKD-------------------
GRPE_PEWBP       ----------------------------MQEFMNFEECSKQNTNNCKQHEKNIDENNCSC
GRPE_WOLTR       ----------------------------------MSDSSKERK-----------------
GRPE_WOLPM       ----------------------------------MSDSSKEKK-----------------
GRPE_EHRCJ       ----------------------------------MSDSDNNTKS----------------
GRPE_FUSNN       ------------------------------------------------------------
GRPE_FUSNP       ------------------------------------------------------------
GRPE_BORBP       ------------------------------------------------------------
GRPE_METS3       ------------------------------------------------------------
GRPE_METTH       ------------------------------------------------------------
GRPE_METST       ------------------------------------------------------------
GRPE_CALS4       ------------------------------------------------------------
GRPE_CLOD6       ------------------------------------------------------------
GRPE_ALKOO       ------------------------------------------------------------
GRPE_CLOAB       ------------------------------------------------------------
GRPE_CLOTE       ------------------------------------------------------------
GRPE_CLOB8       ----------------------------------------------------------ME
GRPE_CLOPS       ----------------------------------------------------------MV
GRPE_LACP7       ----------------------------------------------------------MA
GRPE_METMA       ------------------------------------------------------------
GRPE_METAC       ------------------------------------------------------------
GRPE_METBF       ------------------------------------------------------------
GRPE_AQUAE       ------------------------------------------------------------
GRPE_THEMA       ------------------------------------------------------------
GRPE_PSELT       ------------------------------------------------------------
GRPE_VIBHA       ----------------------------------MSN-----------------------
GRPE_VIBVU       ----------------------------------MSN-----------------------
GRPE_VIBPR       ----------------------------------MSN-----------------------
GRPE_VIBC3       ----------------------------------MSN-----------------------
GRPE_PHOPR       ----------------------------------MNN-----------------------
GRPE_ALIF1       ----------------------------------MSN-----------------------
GRPE_SHELP       ----------------------------------MSK-----------------------
GRPE_SHESH       ----------------------------------MSN-----------------------
GRPE_SHEFN       ----------------------------------MSN-----------------------
GRPE_SHEON       ----------------------------------MSN-----------------------
GRPE_PSET1       ----------------------------------MSE-----------------------
GRPE_PSYIN       ----------------------------------MTE-----------------------
GRPE_COLP3       ----------------------------------MTT-----------------------
GRPE_PSEP1       ----------------------------------MA------------------------
GRPE_PSEPG       ----------------------------------MA------------------------
GRPE_PSEE4       ----------------------------------MA------------------------
GRPE_PSEMY       ----------------------------------MA------------------------
GRPE_PSEU5       ----------------------------------MA------------------------
GRPE_PSEAE       ----------------------------------MA------------------------
GRPE_PSEPF       ----------------------------------MA------------------------
GRPE_PSE14       ----------------------------------MA------------------------
GRPE_CHRSD       ----------------------------------MAK-----------------------
GRPE_ALCBS       ----------------------------------MS------------------------
GRPE_YERE8       ----------------------------------MSS-----------------------
GRPE_SERP5       ----------------------------------MSS-----------------------
GRPE_PECAS       ----------------------------------MSS-----------------------
GRPE_SODGM       ----------------------------------MSS-----------------------
GRPE_PHOLL       ----------------------------------MSS-----------------------
GRPE_ECOLI       ----------------------------------MSS-----------------------
GRPE_ENT38       ----------------------------------MSS-----------------------
GRPE_KLEP7       ----------------------------------MSS-----------------------
GRPE_CROS8       ----------------------------------MSS-----------------------
GRPE_BAUCH       ----------------------------------MIS-----------------------
GRPE_BLOFL       ----------------------------------MID-----------------------
GRPE_PASMU       ----------------------------------MSN-----------------------
GRPE_ACTSZ       ----------------------------------MSE-----------------------
GRPE_HAEIN       ----------------------------------MSE-----------------------
GRPE_HAES1       ----------------------------------MSE-----------------------
GRPE_HAEDU       ----------------------------------MTT-----------------------
GRPE_ACTP2       ----------------------------------MTA-----------------------
GRPE_PSYS1       ----------------------------------MSEQNTNHES----------------
GRPE_ACIAD       ----------------------------------MAN-----------------------
GRPE_XANOM       ----------------------------------MNQDHPEFDS----------------
GRPE_XYLFT       ----------------------------------MNQDHPECDS----------------
GRPE_ALKEH       ----------------------------------MSDKQREAER----------------
GRPE_HALHL       ----------------------------------MTDNQRQSTT----------------
GRPE_HYDCU       ----------------------------------MSDNKTELNE----------------
GRPE_BURTA       ----------------------------------MENTQE--------------------
GRPE_BURL3       ----------------------------------MENTQE--------------------
GRPE_PARXL       ----------------------------------MENTQE--------------------
GRPE_RALSO       ----------------------------------MKHTSEPTS-----------------
GRPE_POLAQ       ----------------------------------MTQENQ--------------------
GRPE_POLNA       ----------------------------------MSENKQPE------------------
GRPE_ACIAC       ----------------------------------MSDQQHSAP-----------------
GRPE_BORPE       ----------------------------------MTAPQEPV------------------
GRPE_NITEC       ----------------------------------MQEPHNQEPI----------------
GRPE_NITEU       ----------------------------------MQEPHDQEPI----------------
GRPE_NITMU       ----------------------------------MTEENRPQP-----------------
GRPE_METFK       ----------------------------------MQHEDKTPE-----------------
GRPE_METSS       ----------------------------------MQEENQHPE-----------------
GRPE_DECAR       ----------------------------------MS--NPENA-----------------
GRPE_NEIMB       ----------------------------------MSEQTQQQN-----------------
GRPE_CHRVO       --------------------------------MQFRGNVMQEN-----------------
GRPE_FRATO       -------------------------------------------M----------------
GRPE_FRAP2       -------------------------------------------M----------------
GRPE_DICNV       ------------------------------------------------------------
GRPE_LEGPA       ----------------------------------MSKQNKKDWK----------------
GRPE_COXBN       ----------------------------------MSSKNNPE-S----------------
GRPE_BRUME       ----------------------------------MADEKNKPENPDLDQR----------
GRPE_OCHA4       ----------------------------------MADEKNKSQNPDLEQR----------
GRPE_BARQU       ----------------------------------MSDEKNKFTDASFENC----------
GRPE_BARHE       ----------------------------------MSDEKNKFTDASFENC----------
GRPE_RHIRD       ----------------------------------MTDDTKK-------------------
GRPE_RHIME       ----------------------------------MTDETNK-------------------
GRPE_RHIL3       ----------------------------------MTDDTTK-------------------
GRPE_RHILO       ----------------------------------MSDQAKD-------------------
GRPE_RHOPS       ----------------------------------MTDSNGQK------------------
GRPE_RHOPA       ----------------------------------MTETDGQK------------------
GRPE_BRASO       ----------------------------------MTDPDLHQ------------------
GRPE_RHOP5       ----------------------------------MTDPNGPK------------------
GRPE_BRADU       ----------------------------------MTDRDRQ-------------------
GRPE_RHOS4       ------------------------------------------------------------
GRPE_RICTY       ----------------------------------MKDDNIE-------------------
GRPE_RICCN       ----------------------------------MIDDNIE-------------------
GRPE_RICB8       ----------------------------------MTDNNIE-------------------
GRPE_CAUVC       ----------------------------------MTDEQTP-------------------
GRPE_WOLSU       ----------------------------------MNDNP---------------------
GRPE_HELHP       ----------------------------------MEEQEEKQY-----------------
GRPE_HELAH       ----------------------------------MKDEHNQEH-----------------
GRPE_NITSB       ----------------------------------MAEKK---------------------
GRPE_ARCB4       ----------------------------------MSEEKK--------------------
GRPE_CAMC5       ----------------------------------MSEEIK--------------------
GRPE_CAMFF       ----------------------------------MSEDTN--------------------
GRPE_CAMJR       ----------------------------------MSEQKQ--------------------
GRPE_SULNB       ----------------------------------MSQET---------------------
GRPE_PARTM       ----------------------------------MEKERDVAQEQATYEQ----------
GRPE_GEOSE       ----------------------------------MEQEQKATQEQATYEEWT--------
GRPE_GEOKA       ----------------------------------MEQGEKQVMEQATYDE----------
GRPE_GEOTN       ----------------------------------MEQGDK----QATYNE----------
GRPE_BACVZ       ----------------------------------MS------------------------
GRPE_BACSU       ----------------------------------MS------------------------
GRPE_BACP2       ----------------------------------MS------------------------
GRPE_BACLD       ----------------------------------MA------------------------
GRPE_BACCN       ----------------------------------ME------------------------
GRPE_BACHD       ----------------------------------MVEN----------------------
GRPE_BACSK       ----------------------------------MAE-----------------------
GRPE_LISIN       ----------------------------------MS------------------------
GRPE_LYSSH       ----------------------------------MI------------------------
GRPE_OCEIH       ----------------------------------MN------------------------
GRPE_STAAB       ----------------------------------MTNKDESVEKNTE-STVE--------
GRPE_STAHJ       ----------------------------------MTEKDESVKSNSE-YTEE--------
GRPE_STAEQ       ----------------------------------MSEKDQSVNNTEEDFNVE--------
GRPE_STAS1       ----------------------------------MTEQNESAFNENE-------------
GRPE_LACJO       ----------------------------------MSKEEFP-------------------
GRPE_LACAC       ----------------------------------MSKEEFP-------------------
GRPE_LACDB       ----------------------------------MSKEEFP-------------------
GRPE_LACPL       ----------------------------------MAKKSTR-------------------
GRPE_LACSN       ----------------------------------MSKK----------------------
GRPE_LACSK       ----------------------------------MTKQE---------------------
GRPE_PEDPA       ----------------------------------MAKEK---------------------
GRPE_STRGC       ----------------------------------MAKHKH--------------------
GRPE_STRPN       ----------------------------------MAQDIK--------------------
GRPE_STRTD       ----------------------------------MTEDIK--------------------
GRPE_STRA1       ----------------------------------MSEEIKK-------------------
GRPE_STRMU       ----------------------------------MSKKDKK-------------------
GRPE_STRS2       ----------------------------------MSEEIKN-------------------
GRPE_LACLA       ----------------------------------MSEETKE-------------------
GRPE_TETHA       ----------------------------------MSDKKKN-------------------
GRPE_ENTFA       ----------------------------------MSKKEEK-------------------
GRPE_LEUMM       ----------------------------------MTEKNEE-------------------
GRPE_OENOB       ----------------------------------MVEKKKS-------------------
GRPE_GEOUR       ----------------------------------MEKKKHGTNSISEALKVK--------
GRPE_GEOSL       ----------------------------------MDKKKHGTVQSADETIAA--------
GRPE_PELPD       ------------------------------------MKKH----VTEEQKTS--------
GRPE_MYXXD       ----------------------------------MTVIEVEASGPSTPVEAE--------
GRPE_DESVH       ----------------------------------------MSRDTTTPDDAA--------
GRPE_STRCO       ----------------------------------MTEETPGFEEKPDVP-----------
GRPE1_STRAW      ----------------------------------MTEETPGFDEKPDVP-----------
GRPE_CUTAK       ----------------------------------MTDKNVNPDD--DQA-----------
GRPE_MYCTU       ----------------------------------MTDGNQKPDGNSGEQ-----------
GRPE_MYCPA       ----------------------------------MTQGNQKTEGNPPEQ-----------
GRPE_MYCLE       ----------------------------------MTEGN------PHEQ-----------
GRPE_CORGL       ----------------------------------MTTPNGMPDNPGDPE-----------
GRPE_COREF       ----------------------------------MTDSYKLPDNPGDPD-----------
GRPE_CORDI       ----------------------------------MSTTDNTNGDDRRPG-----------
GRPE_BIFAA       ----------------------------------MSDFNKDEYLNDLPD-----------
GRPE_BIFLO       ----------------------------------MSEFNKDDYLNDLPD-----------
GRPE_TROWT       ----------------------------------MTKSNETERME---------------
GRPE_LEIXX       ----------------------------------MSDQNLGQGSDE-PE-----------
GRPE_THET2       ------------------------------------------------------------
GRPE_MEIRU       ------------------------------------------------------------
GRPE_DEIRA       ----------------------MFTNPFGRKKDMSDDQKKNNQPDTEAD-----------
GRPE_HALMT       MSDDFAESVTEANAESDTETAADAESSAAEDASAADDAAPEESTGDEQA-----------
GRPE_HALSA       MSDH-----------------------AEHAADAADTDAPE---GDDAG-----------
GRPE_NATPD       MSDD--------------------------QGDAVEASSEA----DEEA-----------
GRPE_RUBXD       --------------MSNEERKERGHEPEGPQREEKVEEPQGSPVDPASV-----------
GRPE_METTP       --------------MADELS------------EKSVEGTEED------------------
GRPE_THEAC       -----------------------------------MQPTPSEYARTPVR-----------
GRPE_THEVO       ----------------------------------MYSPSSSNYIKDPIS-----------
GRPE_PICTO       -----------------------------------MMTYNKKYI-DSVE-----------
GRPE_TREDE       -----------------MKKNHEKHADKKEAAKEELEKDLQPKDESAVK-----------
GRPE_TREPA       -----------------MCGGDVQGQGVASGCDEALERADSLRASDPVP-----------
GRPE_SYNPX       ----------------------------------MSGEASTPAQDPS-------------
GRPE_SYNS9       ----------------------------------MSGDASTSAQDQN-------------
GRPE_PROMM       ----------------------------------MSGDAPTPAHDPA-------------
GRPE_PROM1       ----------------------------------MNSDVSSSEHELSQDGSSQNNPSENF
GRPE_PROMA       ----------------------------------MKEEVSTSNQEDLV------------
GRPE_PROMS       ----------------------------------MIENQSDNIDNKEN------------
GRPE_PROM9       ----------------------------------MIENQSDNIDIKEN------------
GRPE_PROM5       ----------------------------------MIEEQSDNVENKDE------------
GRPE_PROMP       ----------------------------------MIEKQSDNVENLED------------
GRPE_NOSS1       ----------------------------------MIDENKQVNHTSQQLGESTEVKQAIM
GRPE_SYNE7       -----------------------------------------------------MSEHQTP
GRPE_TRIEI       ----------------------------------MAGENSSTETKNQEINEKTPEVQTF-
GRPE_THEEB       ----------------------------------MHNPQSRGHNLSQAMSDQTVTNPAAE
GRPE_SYNY3       ----------------------------------MNEDQVSLENQTNPVSPEASDVPAVT
GRPE_GLOVI       ----------------------------------MAENERTTENFQP-------------
GRPE_SYNJB       ----------------------------------MAPEDTYPELQEEE------------
GRPE_SYNJA       ----------------------------------MPTEDAYPELQEEE------------
GRPE_BACFR       ----------------------------------MDPKEKKTKQEEELK-----------
GRPE_BACTN       ----------------------------------MDPKEK-EKMAEELN-----------
GRPE_PORGI       ----------------------------------MN-KQKNNRERTPQP-----------
GRPE_CHLPM       ----------------------------------MMKHRDKPMPENEEP-----------
GRPE_PELLD       ----------------------------------MMKKAEDPLQDREGT-----------
GRPE_CHLTE       ----------------------------------MSRKHHK---EQEE------------
GRPE_CHLAB       ----------------------------------MTDSS---------------------
GRPE_CHLPN       ----------------------------------MTDTP---------------------
GRPE_CHLMU       ----------------------------------MTETP---------------------
GRPE_PARUW       ----------------------------------MVDKDEEQI-----------------
GRPE_LEPIC       ----------------------------------MAETSN--------------------
GRPE_LEPBJ       ----------------------------------MAETSNS-------------------
GRPE_BDEBA       ----------------------------------MSEENNS-------------------
GRPE1_BUCAP      ----------------------------------MKNKKEEKIN----------------
GRPE1_BUCAI      ----------------------------------MIHNEEE-------------------
GRPE_WIGBR       ----------------------------------MKEKNSNKIN----------------
GRPE2_BUCAI      ----------------------------------MDN-----------------------
GRPE2_BUCAP      ----------------------------------MDN-----------------------
GRPE2_BUCBP      ----------------------------------MND-----------------------
GRPE_MYCMS       ----------------------------------MTEELKNK------------------
GRPE_MYCCT       ----------------------------------MTEELKNK------------------
GRPE_MESFL       ----------------------------------MNNEKELK------------------
GRPE_MYCGE       -----------------------------MCEKSQTIKELLN------------------
GRPE_MYCPN       -----------------------------MSENSLTITEILS------------------
GRPE_MYCGA       -----------------------------MANENIQIKSSLD------------------
GRPE1_BUCBP      ----------------------------------MNIDNDLLS-----------------
GRPE_RHOBA       ----------------------------------MNEQPNEELQS---------------
GRPE2_STRAW      ----------------------------------MPTRPQEPDR----------------
GRPE_MYCPE       ----------------------------------MENKNQKHNNEFHEK-----------
GRPE_UREP2       ----------------------------------MSKNNENIKHQNNDK-----------
GRPE_MYCMO       ----------------------------------MIINYKFSDFYFDKKLSG--------
                                                                             

GRPE_ONYPE       K------------NCQKEETKTTNKDNQKEDETVKNQSNQSNQSN---------------
GRPE_AYWBP       Q------------NCQKEETQTTNKDNQKEDETFKNQPNK--------------------
GRPE_ACHLA       -------------AVIVDETEHVDVDS-KES-----------------------------
GRPE_PEWBP       KEKKVQSKKVSSDHSSSEDNASSDINSNKAETLTLNCGDQSDNKNS-------------I
GRPE_WOLTR       ------------------KKFTGMVNKQKSEDQQ-NNSKQ--------------------
GRPE_WOLPM       ------------------KKFADMVSRQKGDDQQSDNHKQ--------------------
GRPE_EHRCJ       -----------------QQNNPTQTDEKSGEEIQSNQKPQRKFTAV-------------L
GRPE_FUSNN       ---------MKDKEIKEEVLKEEINKEVNEKKKCECEEG--------------------K
GRPE_FUSNP       ---------MKDKDIKEEVLKEEINKEVNEELKNEEVKE--------------------E
GRPE_BORBP       ---------MEKKETKNDAEKN--NKQDNKSTKSQKKEN--------------------L
GRPE_METS3       -----------------------MANDKNEDQKEEETKT--------------------L
GRPE_METTH       -----------------------MCEDKKTDSRS--------------------------
GRPE_METST       -----------------------MTEEEKTKSEAE-------------------------
GRPE_CALS4       ---------MEELEKDKIERNEEMSEEVKGEGPPSELEQ--------------------S
GRPE_CLOD6       --------------MDKKNEQQEVREENDTSINQESETQ--------------------V
GRPE_ALKOO       -------------MKETKQEEMEVREDCES-----------------------------V
GRPE_CLOAB       ----MQEKDSKDVTME-DEETIASQEEIEV-EGNSEESS--------------------K
GRPE_CLOTE       --MKWRHDYMAEKKVE-DLEMDLNEEELE--ESEVNEDK--------------------E
GRPE_CLOB8       ENRDVKNEELEKEEIA-DEVAEKDNETQESNDAAETNEA--------------------S
GRPE_CLOPS       DNKDFNEELKESIQEELDNETKSENPNIDEEVEEVSEDI--------------------K
GRPE_LACP7       DNMDFKDLMADEAEDIIEKDIARVNQASEDIDQENQSEV--------------------V
GRPE_METMA       ---------------------MKKSRKKENMDSKERNQK--------------------E
GRPE_METAC       ---------------------MKKSTKKESTHSKEESQT--------------------Q
GRPE_METBF       ---------------------MKIFNKDGNKNSKEDTKA--------------------G
GRPE_AQUAE       ---------------------MEKNQKEIEKELEELRKR--------------------E
GRPE_THEMA       ---------------------MSEKEKKELTQECE-------------------------
GRPE_PSELT       ---------------------MNENEKPQITEQKENQSA--------------------L
GRPE_VIBHA       -------------------EENKVTEEELDQI----------------------------
GRPE_VIBVU       -------------------EENKINEEALKQQ----------------------------
GRPE_VIBPR       -------------------QEKKMHEEELQQQETV-------------------------
GRPE_VIBC3       -------------------EEIKNKDEQLQQD----------------------------
GRPE_PHOPR       -------------------EDKKLQDEQLQKE----------------------------
GRPE_ALIF1       -------------------EENKVNEEAVVEE----------------------------
GRPE_SHELP       -------------------ESNKAQEPQIEET----------------------------
GRPE_SHESH       -------------------DSSKAKQNQVDEA----------------------------
GRPE_SHEFN       -------------------ESNNTSQDQVEEA----------------------------
GRPE_SHEON       -------------------ESIKAEQDLIHEG----------------------------
GRPE_PSET1       --------------------QRQNPEQEVELNEDL-------------------------
GRPE_PSYIN       -------------------DKKTIPEEQVEAEQVV-------------------------
GRPE_COLP3       -------------------ESTSNKEE--LSAEQL-------------------------
GRPE_PSEP1       -------------------DEQ--LNEKDLNVEE--------------------------
GRPE_PSEPG       -------------------DDQ--LNEKDLNAEE--------------------------
GRPE_PSEE4       -------------------DEQ--LDEKNLNSEE--------------------------
GRPE_PSEMY       -------------------DEQ-NLDTQNPEAQAA-------------------------
GRPE_PSEU5       -------------------DEQ-NLDNQNPETPEQ-------------------------
GRPE_PSEAE       -------------------DEQQTLDQQTPEQP---------------------------
GRPE_PSEPF       -------------------DEQ-TVDTQNPEANQA-------------------------
GRPE_PSE14       -------------------DEQ-NLDAQ-AQDQAA-------------------------
GRPE_CHRSD       -------------------DPQTPTDEELARAERD-------------------------
GRPE_ALCBS       -------------------EQEKDQNNAEPQVETV-------------------------
GRPE_YERE8       -------------------KEQKTPNEQVSEEMEN-------------------------
GRPE_SERP5       -------------------KEQKTPNEQVSEEME--------------------------
GRPE_PECAS       -------------------KEQKTPDEQVLDQKEA-------------------------
GRPE_SODGM       -------------------KEQNTPDEQVSQESEM-------------------------
GRPE_PHOLL       -------------------KEQKMPDEQVSEDMEV-------------------------
GRPE_ECOLI       -------------------KEQKTPEGQAPEEIIM-------------------------
GRPE_ENT38       -------------------KEQKTPEGQAPEEIIT-------------------------
GRPE_KLEP7       -------------------KEQKTPEGQAPEEIIT-------------------------
GRPE_CROS8       -------------------KEQKTPDGQAPEEIVT-------------------------
GRPE_BAUCH       -------------------QDKNYSDDQISQDSEI-------------------------
GRPE_BLOFL       -------------------NNK---HNQDINASSA-------------------------
GRPE_PASMU       -------------------KEQHIEK-EEQLQEEK-------------------------
GRPE_ACTSZ       -------------------QEQKQEQPIENAAENS-------------------------
GRPE_HAEIN       -------------------QEQKVEIPEVEKQEE--------------------------
GRPE_HAES1       -------------------QE-KVEQEEISAELET-------------------------
GRPE_HAEDU       -------------------EKE--TATPADVEVAS-------------------------
GRPE_ACTP2       -------------------QNENAQAQAEQVEVAN-------------------------
GRPE_PSYS1       -------------------PEQNVAHDNIEHSDSI-------------------------
GRPE_ACIAD       --------------------EQNEQSQDLSS-----------------------------
GRPE_XANOM       -------------------E----------------------------------------
GRPE_XYLFT       -------------------E----------------------------------------
GRPE_ALKEH       -------------------Q---QSEDKAHSEAES-------------------------
GRPE_HALHL       -------------------DGQPETRDPAQATAEA-------------------------
GRPE_HYDCU       -------------------E-------QHNATAEG-------------------------
GRPE_BURTA       ------------------------NPTDQTTEETG-------------------------
GRPE_BURL3       ------------------------NPATQSAEDIG-------------------------
GRPE_PARXL       ------------------------NPTSQNPKPAE-------------------------
GRPE_RALSO       ------------------------QPDTQAAESAQ-------------------------
GRPE_POLAQ       ------------------------NPPPEQEDVAA-------------------------
GRPE_POLNA       ------------------------QNQDLTGEPSP-------------------------
GRPE_ACIAC       ------------------------QNAAATASPS--------------------------
GRPE_BORPE       ---------------------------DSTPESG--------------------------
GRPE_NITEC       -------------------EEQKLSEMEDTLEKQH-------------------------
GRPE_NITEU       -------------------EKQKLPGMDDVLETEH-------------------------
GRPE_NITMU       -------------------DQPELTVTSESSVQET-------------------------
GRPE_METFK       --------------------------QQENKTPET-------------------------
GRPE_METSS       --------------------------QDD-------------------------------
GRPE_DECAR       --------------------------QDAMLGNEP-------------------------
GRPE_NEIMB       --------------------------SEEAVENVE-------------------------
GRPE_CHRVO       --------------------------QNQAAEAVE-------------------------
GRPE_FRATO       -------------------SKQEKSNVEDKSLDIE-------------------------
GRPE_FRAP2       -------------------GKEEKNNIEDKALDNE-------------------------
GRPE_DICNV       -------------------MHDPKESLETNIQETE-------------------------
GRPE_LEGPA       -------------------KFKDEHKEEHKVENEI-------------------------
GRPE_COXBN       -------------------ETKAKNKWEKVMEAEE-------------------------
GRPE_BRUME       -------------------DINNPRDREALKQAAD-------------------------
GRPE_OCHA4       -------------------DINNPRDREALNRAAD-------------------------
GRPE_BARQU       -------------------DLKNPVDRDTLKKATD-------------------------
GRPE_BARHE       -------------------DLKNPSDRDALKQAAD-------------------------
GRPE_RHIRD       ---------------------PGPD-----ADVAE-------------------------
GRPE_RHIME       ---------------------NGPE-----AAAPE-------------------------
GRPE_RHIL3       ---------------------NGPD-----ATAAD-------------------------
GRPE_RHILO       ---------------------ERAP-----SEAEA-------------------------
GRPE_RHOPS       ---------------------DNNQDQ---AQPA--------------------------
GRPE_RHOPA       ---------------------DNNQDT---AQAAA-------------------------
GRPE_BRASO       ---------------------NDPENP---AQAS--------------------------
GRPE_RHOP5       ---------------------DIPEQS---AEAA--------------------------
GRPE_BRADU       -----------------------PEDT---TAPTG-------------------------
GRPE_RHOS4       ---------------------------MAEDQAPR-------------------------
GRPE_RICTY       ------------------------------NNNIE-------------------------
GRPE_RICCN       ------------------------------NNEQT-------------------------
GRPE_RICB8       ------------------------------NKE---------------------------
GRPE_CAUVC       ------------------------------AEE---------------------------
GRPE_WOLSU       ---------------------ANAEPQEE--EVSL-------------------------
GRPE_HELHP       --------------------NQNIQDNEEGTQMRE-------------------------
GRPE_HELAH       --------------------DLSQKELESCENSCT-------------------------
GRPE_NITSB       ----------------------RAQEQEK-----V-------------------------
GRPE_ARCB4       --------------------DEILEQETVETKEEI-------------------------
GRPE_CAMC5       ----------------------EQNVQDAQNENLA-------------------------
GRPE_CAMFF       ----------------------KNENVDNIPDNFD-------------------------
GRPE_CAMJR       ----------------------EIENENAQNSENL-------------------------
GRPE_SULNB       ----------------------EKDLEQTQNEELV-------------------------
GRPE_PARTM       --------------------ESPNAERQEELKENE--------------------HQEKN
GRPE_GEOSE       -------------------APEPQEEKAEERGGNE--------------------PQEEN
GRPE_GEOKA       --------------------PEREQPIEEEAAP-Q--------------------PEEES
GRPE_GEOTN       --------------------LETEQPVSKEGADSQ--------------------PEDEA
GRPE_BACVZ       ---------------------EEKQTA---EQVEA--------------------AEQEE
GRPE_BACSU       ---------------------EEKQTV---EQNET--------------------EEQE-
GRPE_BACP2       ---------------------EEKQTP---EQEAE--------------------VEAQ-
GRPE_BACLD       ---------------------EEKQNEELNEQEEL--------------------NETEA
GRPE_BACCN       ---------------------ERNEQVVEETKEAQ--------------------TEEAT
GRPE_BACHD       ----------------------EKTSVEETEEKAE--------------------TEDEM
GRPE_BACSK       ----------------------EKNEELQTEETEQ--------------------TKEDG
GRPE_LISIN       ---------------------EKKNKKEKLAEEIE--------------------QEELN
GRPE_LYSSH       ---------------------MRRIQVTETTENKD--------------------LVQGD
GRPE_OCEIH       ----------------------EKDNQTTSEPENE--------------------QEIID
GRPE_STAAB       ---------------------VTNVKQNIDDSVEQ--------------------TE-ES
GRPE_STAHJ       -------------------QEVKNEDTSTVENVED--------------------TTSDS
GRPE_STAEQ       -------------------TEDNQNDTNIENSVSN--------------------TDNSE
GRPE_STAS1       ---------------------EVNEETSQTDSVEN--------------------ND-ET
GRPE_LACJO       --------------------HEKDLKDE--VTPDK--------------------APKKD
GRPE_LACAC       --------------------SEKNLDKE--ENTSK--------------------PKKAV
GRPE_LACDB       --------------------SEKDLPQEDQEKQAK--------------------AAEAD
GRPE_LACPL       --------------------TTPEDSQA--STTDS--------------------AATST
GRPE_LACSN       ---------------------KAEDKQP--IIKDE--------------------AVEEP
GRPE_LACSK       ---------------------KAENQEK--PTEET--------------------VEETP
GRPE_PEDPA       ---------------------KEEVKEE--EVSEA--------------------TSTEG
GRPE_STRGC       --------------------EEHPEDVEV-------------------------KETVET
GRPE_STRPN       --------------------NEEVEEVQE-------------------------EEVVKT
GRPE_STRTD       --------------------EEEVKEEEATETTEEVVEETKEATETTEEVVEGTKEATET
GRPE_STRA1       --------------------DDLQEEVEATE-------------------------TEET
GRPE_STRMU       --------------------EEIKEEVEATEP-----------------------TTEES
GRPE_STRS2       --------------------EEIVEEVEATE-----------------------------
GRPE_LACLA       --------------------EIKNEKVDEEV-------------------------TEEL
GRPE_TETHA       --------------------AEEFEETFSDK-------------------------TSED
GRPE_ENTFA       --------------------QEELQEEMEAV-------------------------DAAG
GRPE_LEUMM       --------------------VVEDKNISDQTDENL---------------------TEEI
GRPE_OENOB       --------------------QAE-KNNQSATEEEI---------------------EKAV
GRPE_GEOUR       -------------------AAVEQETATPEPTPQS------------------------E
GRPE_GEOSL       -------------------AGFAGEAAQGKGEDVQ------------------------S
GRPE_PELPD       -------------------AAPEAEQASPESSAAE------------------------A
GRPE_MYXXD       -------------------ASASPADTTSPPSDAE------------------------A
GRPE_DESVH       -------------------AFEAAATTSGTATSAG------------------------E
GRPE_STRCO       ---------------SGATPDDAEPQAASEEGAAPAGDAS--------------------
GRPE1_STRAW      ---------------SGATPEDAEPKAAPSEGAAPAGDAAA-----------AA---QTA
GRPE_CUTAK       ---------------DENRDDNVDERFADIVGDVDIDADQS-----------A-----TD
GRPE_MYCTU       ---------------VTVTDKRRIDPETGEVRHVPPGD-------------------MPG
GRPE_MYCPA       ---------------VTVTDKRRIDPETGEVRHVPPGD-------------------TPG
GRPE_MYCLE       ---------------VTVTDKRRIDPDTGEVRSIPLGD-------------------TPG
GRPE_CORGL       ---------------NTDPEATSADRAEQAAEEAAARQ---------------------A
GRPE_COREF       ---------------ATDDEGIHPDEVENLIEEAERTQGGS-----------EDDDLLTT
GRPE_CORDI       ---------------QPE-----WDDEENNFEHLDATE-------------------VPA
GRPE_BIFAA       ---------------MDDLSGQAAPAAASADSAAAAAGATQ-----------EGAAQPAA
GRPE_BIFLO       ---------------PSD--AEAAAQASSGADASAESGSAQ-----------DSAAQAPS
GRPE_TROWT       ---------------------ESEETHSSDIRSASES---------------DHASGSDH
GRPE_LEIXX       ---------------REEPIVRDKRRIDPETGKVREPQDLS-----------HEELVDVG
GRPE_THET2       --------------------------------------MEE-----------RNHENTLE
GRPE_MEIRU       --------------------------------------MEN------------NEPVVET
GRPE_DEIRA       ---------------NAENIKFAADDTELRAGDETDADFEM-----------PEGFPEMD
GRPE_HALMT       ---------------GETTAESSDAESVTVSERVAEYDDEL-----------AAEVEALE
GRPE_HALSA       ---------------GDDGEQAGDDGTSALSERVRALD--------------ADNADALA
GRPE_NATPD       ---------------STSPDEGDDRDPVAAVAERAEND-----------------PASVA
GRPE_RUBXD       ---------------EENAPPE--ASAETAPEEA--------------------GKEVRE
GRPE_METTP       ---------------GESAPAE--GTTEGVPVD---------------------------
GRPE_THEAC       ---------------IEMQRSK--ERNSMVYKE---------------------------
GRPE_THEVO       ---------------TEIIKSK--TRNLKKRAE---------------------------
GRPE_PICTO       ---------------YDLIETR--KRMWMMERK---------------------------
GRPE_TREDE       ---------------DEQGAGCGCETSKENPQEDKAEQNSS-----------TGGKCEKN
GRPE_TREPA       ---------------VESGEGS---VPGEHSQE---------------------------
GRPE_SYNPX       -------------VEPLDAAPV-----AAEPEVMSTETP----------------AEGSL
GRPE_SYNS9       -------------VESNDVPAIPDVDAGTPIDPVVEETP----------------TLDTE
GRPE_PROMM       -------------AEGLEASVPLESVASINSDE-GQSSA----------------QSAPL
GRPE_PROM1       V----SSSNSNESVNQVELSDNPEVEHQVKNDSVDTAKE----------------QSSTS
GRPE_PROMA       ---------ADQEVIASEESDLSPKEEKVSESTIDDDDS----------------LNDAE
GRPE_PROMS       ---------DLSDQDNALENVSSAQELTTENNELSSQKT----------------EEINT
GRPE_PROM9       ---------DVLNQDNAPEDNSSAAEKTIENDELSPQKT----------------EEINT
GRPE_PROM5       ---------NVSMDNNISENLPIAEEQTNEDKKLPDDNN----------------EKIDA
GRPE_PROMP       ---------NVSQEVNKNEDSSVIENQTSEDKQTLEVDD----------------ENIYA
GRPE_NOSS1       S-ESPAQINN--NESANEVTEPVAIPTNVVGDTTATEDN-------------GFTATQIQ
GRPE_SYNE7       P-EEDLTVAN--GDSAEAVSEP---------DVTVASG-------------------QEA
GRPE_TRIEI       --ETNVEFES--SQKVESDTELSADNASIDTDIQSTEST-------------S--KEKDQ
GRPE_THEEB       AQEGEITPDT--PDTVDKVENTPVENVENPAEATPGEEDQA-----------SEATSANA
GRPE_SYNY3       PEESPQPTDAVLGEPSGEQSEDPRIGAATETEGGPLEQE--------------KSSEEII
GRPE_GLOVI       ------QDPS-------------------YAEAATTEAS-----------------AAEA
GRPE_SYNJB       ------------IDVEAELEKLILEDSEAEAGTSSGETA-----------------AEPS
GRPE_SYNJA       ------------IDVEAELEKLILEDREAEASTSSGEAS-----------------AEAS
GRPE_BACFR       -----------------------VDDIQDTVEGQSQNEE-----------------ATEA
GRPE_BACTN       -----------------------VEETKDTAEEQPQDDQ-----------------AEEA
GRPE_PORGI       -----------------------EQDTERDEQLTNSHEN-----------------DIDS
GRPE_CHLPM       -----------------------LQE----QEGTLHAEP-----------------AEPQ
GRPE_PELLD       -----------------------IQEHTEGQAGTAAADQ-----------------SAAV
GRPE_CHLTE       -----------------------IQEQETISAGAAETPA-----------------EETA
GRPE_CHLAB       -----------------------NAH-EAENPTVP-------------------------
GRPE_CHLPN       -----------------------PEN-EEQHESNV-------------------------
GRPE_CHLMU       -----------------------NTSSEEIQTSEP-------------------------
GRPE_PARUW       -----------------------KQNVEEDLSSTV-------------------------
GRPE_LEPIC       ----------------------NKTSEEAKANEKKSQSETLEESKLENMNSEE---STET
GRPE_LEPBJ       ---------------------ENKTSEEAKASEKNSRSITLEETKLENMNSEESTQTTES
GRPE_BDEBA       ---------------------QNSNPPNPENGE---------------------------
GRPE1_BUCAP      -----------------NLKKEEK--INNLKKEEKINNL--------------------K
GRPE1_BUCAI      -------------------QLEKK--IEK-NQDPKINHK--------------------K
GRPE_WIGBR       -----------------EDKLNKKSEVKNKKEEEIINNK--------------------K
GRPE2_BUCAI      --------------------KENKLDEKKIFKNNKIEEK--------------------K
GRPE2_BUCAP      --------------------QEKKTNYQNTDKENDLEKN--------------------K
GRPE2_BUCBP      --------------------IDKHKKETQTESKNDLNNT--------------------T
GRPE_MYCMS       -------------------KINKKYYSQNRNKTKA-----------------------EF
GRPE_MYCCT       -------------------KNNKNYYSQNKNKTKA-----------------------EF
GRPE_MESFL       -------------------KEETSVENKEKKVATE-----------------------EI
GRPE_MYCGE       -------------------AIRTLVVKNNKAKVSM-----------------------IE
GRPE_MYCPN       -------------------SIRTLLVKHNKAKVTQ-----------------------IE
GRPE_MYCGA       -------------------DLKNFVQ-NPKSQNQK-----------------------IK
GRPE1_BUCBP      ----------------------KNKEAKVVSENS-------------------------T
GRPE_RHOBA       -------------------EDEQFDPQETVSFEGE------------------------T
GRPE2_STRAW      ------------------AASDPVEPVPEGAGRPPRGD-----------------LPQPG
GRPE_MYCPE       -------------------NQQSQKDNNNVKKENLHEDQSDLNDANFDDGGKKNKLKNDI
GRPE_UREP2       -------------------VNNQVDKKETKNHNKQ---------------------EFKY
GRPE_MYCMO       ---------------KEVEFSIQIQKREASSDKNLQSKN----------------LIIDA
                                                                             

GRPE_ONYPE       QTKQTNTKQQKHQPK-----------------------------ENSHLQITKLQTQIKE
GRPE_AYWBP       -TKQTNTKQQKHLSK-----------------------------ESSHQQITKLQTQIKE
GRPE_ACHLA       -KKEKKTKQQ--------------------------------------QKIEFLEAEVKE
GRPE_PEWBP       SDIESNKFIPNENDF-----------------------------QMLKKQLNDLKAENVN
GRPE_WOLTR       ---ADDLDE-----------------------------------------LKTLKERAVQ
GRPE_WOLPM       ---TDDLNED----------------------------------------LNTLKERAVQ
GRPE_EHRCJ       NKKKEKLNEDL-------------------------------------SELDKLKQQLAH
GRPE_FUSNN       EEAHEHKNDEHACCGKHNHK----------------------------EEIEKLKAEIEE
GRPE_FUSNP       THEHEHKHGGHTCCGKHGHKH-------------------------NDEEIGKLKAEIEE
GRPE_BORBP       NLVNSDK------------------------------------------KITELENEISN
GRPE_METS3       QEKYDELLEELDSKNKE--------------------------LAKINEDLEKQKEETQE
GRPE_METTH       QQECQKELEELRERLKD--------------------------LEN---EIKKKEEEVRE
GRPE_METST       EIEQNNKEEEQEKSVEE--------------------------LLE------EKEQEIQQ
GRPE_CALS4       EEVVEEKIETEVEQKKEPSLEEI--------------------VEELRKKLEEKEKEAKE
GRPE_CLOD6       ELEEEVVNEECETSSEKTDEKEVD--------------DENVTDINSKLAEKKLQDELDE
GRPE_ALKOO       DSNLEATVEEMESTKGTSE------------------------DLEQKLAEKTAQYE--D
GRPE_CLOAB       EEESNNSEISDENLSEENL--------------------------KLKDENEKLKNELDA
GRPE_CLOTE       FEELDKSEEENE-VEELIS--------------------------TLKDENEKLNNEMEA
GRPE_CLOB8       KEASENIEAAEEDQEDLVK--------------------------NQEEENKKLREELDA
GRPE_CLOPS       ADEKVIDFEELKALKEENT--------------------------MFKSKTKKLENELEA
GRPE_LACP7       DDTTENEDASEEVYEEDTASEDGS--------------KEKKSFFKKKEKKDKKDEKIDE
GRPE_METMA       AERSEARNSESPAEKAGETKVSPE--------------NEPSSPEAEKNPEEACREENEI
GRPE_METAC       AGNSEARKSGPSTKKAGEKTAEPE--------------KATAGSGTEKSPEAACREENEL
GRPE_METBF       AENSEAQNSGSSAEEVNKARENPE--------------EASASSEAEKSPEVKCQEEKQV
GRPE_AQUAE       KELEEKIQKLETIAKNSNLRVA--------------------------------------
GRPE_THEMA       -ELKEKYKELEEYAK---------------------------------------------
GRPE_PSELT       DQLIKEKHELLEHLR---------------------------------------------
GRPE_VIBHA       --IEEAEKVEAA------------------------AQEAEAELEEIG---DEKDAKIAQ
GRPE_VIBVU       --DAAEVEVEAV------------------------GTDADIEWNEEA---DESAAKIAE
GRPE_VIBPR       -EADTEAEAEAV------------------------GTDADIEWNEESA-LDETEAKIAQ
GRPE_VIBC3       ---AVETEAEVV------------------------GTDADIDWNQAADEIDEKEAKIAQ
GRPE_PHOPR       ---TVEAAETVS------------------------AEEEFVEITAEE----MQIARIAE
GRPE_ALIF1       -------QVEAV------------------------GTEADVEWNESAE--DSQEAKIAE
GRPE_SHELP       ----EAVAVET-----------------------EVVEDAASLMDELT----QANFRVEE
GRPE_SHESH       ----VEGEIITDNEN-------------------ETVTGEASLMDELT----QANFRVEE
GRPE_SHEFN       ----VTPEIVV---------------------------DEASLMDELT----QANFRIEE
GRPE_SHEON       ----VESEVST---------------------------EEASLIDELT----QANFRIEE
GRPE_PSET1       -AK-MEADVEAA-------------------------VQAAEEHAEQEQ-SPE--AEIAM
GRPE_PSYIN       -VEEVEAELVEN-------------------------DESAQPQEEAEA-SNEDLNMIEV
GRPE_COLP3       -ADDIVQQAEEQ-------------------------VEDQHDHAHEVI-SAEQ-EKINE
GRPE_PSEP1       -----------------------------------------------TGAGNAADTRVLE
GRPE_PSEPG       -----------------------------------------------AAAVDNG-ARVQE
GRPE_PSEE4       -----------------------------------------------AGAVNGD-ARVQE
GRPE_PSEMY       -EN--------------------------------------------AAPSDDLAARVQA
GRPE_PSEU5       -SQ--------------------------------------------ADVAEDLAARVQS
GRPE_PSEAE       -----------------------------------------------TGAAEDLTARVQE
GRPE_PSEPF       -P---------------------------------------------EASGDDLATRVQV
GRPE_PSE14       -E---------------------------------------------AGAGEELTTRVQV
GRPE_CHRSD       -AEPQPGDATDDEVELEGVVE-------------DVEASEADAEALENPEADALAARVEE
GRPE_ALCBS       -EEQQ-------------------------------------AAAAAEAVEPTAEEKLAE
GRPE_YERE8       -AAEQQVEAT----------------------------------QETGEGVDPR---VAE
GRPE_SERP5       -----QQEVL----------------------------------PEAAEGVDLRDERIAE
GRPE_PECAS       -AKGQQADAA----------------------------------PETADVADPRDERIAE
GRPE_SODGM       -EQGQQAEAA----------------------------------PETVDVVDPRDERIAE
GRPE_PHOLL       -VSEQQNSADK---------------------------------AEASETESVVDPRVAE
GRPE_ECOLI       -DQHEEIEAVEP--------------------------------EASAEQVDPRDEKVAN
GRPE_ENT38       -EQHEEVEAVEP--------------------------------DASAEQVDPRDEKIAN
GRPE_KLEP7       -EQHDDVEAVEP--------------------------------EVSAEQVDPRDEKIAN
GRPE_CROS8       -EQHEEVESVES--------------------------------AESAEQVDPRDEEIAR
GRPE_BAUCH       -DTIEAVSETEAV-------------------------------SETNEIIDMRDDRIQK
GRPE_BLOFL       -NTIKKDELSESA-------------------------------CKIDSIIDPKDDQIIQ
GRPE_PASMU       -HEEQQKTEETEV----------------------------EAVNGV-DPLEEAILRVQE
GRPE_ACTSZ       -AQKPEEVTETDV----------------------------QTEQNVTDPLEEAIARVQE
GRPE_HAEIN       -----VVVEETQQ----------------------------AEHSQEFDPLEEAIARVQE
GRPE_HAES1       -Q---NEQEKPME----------------------------ETEIQDGDALENAIARVQE
GRPE_HAEDU       -QEEQIDQTTEAQ----------------------------VEEPSIEAELAGCYAKIHE
GRPE_ACTP2       --EAQLEQTAEIQ----------------------------QEQP-VEAELAAAYARINE
GRPE_PSYS1       -LEETMKEFDPQHN-------------------------------SGEEMTIENEIDLDT
GRPE_ACIAD       --EQTTQDHEQTQT-------------------------------EGVEQ--GAEISVED
GRPE_XANOM       -DLAQNPPETDP--------------------------------------LKAEIESLRS
GRPE_XYLFT       -ELTQNSPETDP--------------------------------------LKVEVETLRG
GRPE_ALKEH       -AEAGQAPEAQAAEDG--------AESASGDS------------GDELTELQQALEEARA
GRPE_HALHL       -AEQTQATQASAAVEGELQDGS--ADSATGASLSADDGADPEALRQRVEELEKALADAEQ
GRPE_HYDCU       -EVSEETHQAEDAVEH---------------------------------DLEAMLEEARK
GRPE_BURTA       --REAQAAENAAP-----------------AAEAA---------------LAEAQAKIAE
GRPE_BURL3       --SEKQAAQGAAP-----------------AAEAAD------------AALAEAQAKVAE
GRPE_PARXL       -ETARQAAEAAAP-----------------QQEAAANAATDSPASAEQAALAEAQAKIAE
GRPE_RALSO       -SSAAAAGQAASAYSSQAQRASADAQAIAGDEAAVAEATIEPDTAELRRQLEAADEKARQ
GRPE_POLAQ       -DPQVNEAAASEP-----------------AAVKTPE-----------QEIADLNQQIGE
GRPE_POLNA       -EELEAAQAADEF----------------DAMNAASE---------AQAQLAVLQAKNTE
GRPE_ACIAC       -DSPEAVEATMAA----------------HAADELGR---------LQNELAELKAKSAD
GRPE_BORPE       ---ENAATPGLED----------------DLSAELAA---------LRAELEAAQATVKA
GRPE_NITEC       -SGASTENTERAE--------------EGVVIPDLEQ------------QLKEAEIRAAE
GRPE_NITEU       -SGTVAGNTERAG--------------EDAA-PSLEQ------------QLKEAEIRAAE
GRPE_NITMU       -GENKARTPEQ----------------EGEAMPSLEQ------------LLKKAELDAAE
GRPE_METFK       -ELQQENAPATPQ--------------EAGAAGSIDD------------RIAELEAKLAE
GRPE_METSS       --------ISEAQ--------------DAGAAGSLDA------------RIAELEAQLAE
GRPE_DECAR       -AVEPVVEPTAEQ--------------HTDTLPSIEE------------QFRALELKAAE
GRPE_NEIMB       -AVETVETVGNAD----------------GVQEQAAA----------EPAYEDLQARIAE
GRPE_CHRVO       -N-EMTETASAAH----------------TELEQTP-----------EQRIAGLEAEIAE
GRPE_FRATO       -TAAQVETAQESA-------------------------SGALEELSVEEQLERAKDTIKE
GRPE_FRAP2       -Q----EMDQEST-------------------------SKAVEELSIEEQLERARDTIKE
GRPE_DICNV       -S-----QEKLPE-------------------------TPIIEE---EPILTLPDDQINQ
GRPE_LEGPA       -LEEEID-EKSQH-------------------------QEP---ALGHPSYTALEEQLTL
GRPE_COXBN       -EQEEGGGDGSQE-------------------------MEPHREGLEFPSREKLEGQLTR
GRPE_BRUME       -DFLKARRAEA------------------------AADEAEGEVDETANRIAVLEADNTE
GRPE_OCHA4       -DFLKARKAEARAEV--------------------AEDEAEAAVDETANRIAMLEADNGE
GRPE_BARQU       -EFLKTHEAEI-------------------------HSEVKEENNEVSDPLAALQDENKE
GRPE_BARHE       -KFLKAHAAEA-------------------------DADVKGGGEALVDPLAALQDENKE
GRPE_RHIRD       -EFVDPAQAGEE------------------------Q-----AETAEPDPVELLKAENAD
GRPE_RHIME       -EFETAAEPQAA------------------------EKPEADASTTAPDPLELARAESAE
GRPE_RHIL3       -AAADATAYVEN------------------------ETAQ--QEPAQPDPIELLKAENGE
GRPE_RHILO       -AEANAERTEG-------------------------------SIDGDYEALVRLLKENEE
GRPE_RHOPS       -DPVVSKPYIMP-------------------------------DDPEEGTNEALVREAAE
GRPE_RHOPA       -DPVVSKPYIMP-------------------------------DDPEEGSNEALVREAAD
GRPE_BRASO       -EPVVSKPYIMP-------------------------------DDPETGSAEAYAKEAAE
GRPE_RHOP5       -EPVVSKPYIMP-------------------------------DDPEPDAVELLAKEAAE
GRPE_BRADU       -EPVVSKPYIMP-------------------------------DDPEPGSVELLQKEAAE
GRPE_RHOS4       -EETVEAPELTE--------------------------------APEIDELETLRAERDE
GRPE_RICTY       -EENLNIETQVV----------------------------------ANEEIALLKAEIKE
GRPE_RICCN       -INDIAEEIVET----------------------------------ANPEVTALKAEIEE
GRPE_RICB8       -EEIINDIAEEV----------------------------------ENTEIADLKAQIEE
GRPE_CAUVC       -----MPFEADD----------------------------------AAQEIEALKLEVAQ
GRPE_WOLSU       -ESQPSTPESGS----------------------------------DGSKEAELEAKIKE
GRPE_HELHP       -ELQESTSAQQT----------------------------------LQEQEIDYQAKYLE
GRPE_HELAH       -CEGKKQEASEK----------------------------------ECEIKEDFELKYQE
GRPE_NITSB       -QEDQKMQNEQN----------------------------------ECE---EVEKKLQE
GRPE_ARCB4       -KTEEAEQKTES----------------------------------LEEKVARLESELKE
GRPE_CAMC5       -PDSVNFDGLSD----------------------------------AAKVAE-LENKLNE
GRPE_CAMFF       --DNVSFTKLNE----------------------------------DVK------DELAL
GRPE_CAMJR       -QDDLQDNEKNE----------------------------------TNE----LQKELEE
GRPE_SULNB       -EEAQSDEKKDQ----------------------------------EVDPVEAAQAEAAE
GRPE_PARTM       APEEQEKVREENGRQDAQKDE---------------IGDPEKAKEEQNEELAAANAKIAE
GRPE_GEOSE       A----ENLQQEN--TQAQQEA---------------LEEQPKAEQEQNDELAAANAKNCR
GRPE_GEOKA       GGVPLEEAGGEE------------------------AAEPAEKAPT-AEELAAAKAQIAE
GRPE_GEOTN       IGAASEHADAQAGENPEAAST---------------TADPAEQTSVEAEELAKAKAQVAE
GRPE_BACVZ       VTEQAEQAASQE--------------------------QHE----ETAGQEEALQHQIDE
GRPE_BACSU       --IIEEQAAADE--------------------------QQE----ETN-ESELLQNQINE
GRPE_BACP2       -----EEAVQAD--------------------------TEE----VTQDEQSAFQEKIDE
GRPE_BACLD       ETAEAEQTAAEA--------------------------DAP----AEETQTEMLEKQLKE
GRPE_BACCN       IEKNSEESVTEE--------------------------ATEETVVEEKSEAALLQEKVDE
GRPE_BACHD       LTEDPSNEDSDE------------------------------ANEEGNELSE-EEKRIAE
GRPE_BACSK       HGDSAEQEETE--------------------------------NNSGTEVEEQEEPEVHP
GRPE_LISIN       SLDESVETVEEE---------------------------------ATEETLTEEQAKILE
GRPE_LYSSH       VQAETATEEVER---------------------------SEVQEEIELSVEEQYEANVAE
GRPE_OCEIH       VNDSGEQPEENE--------------------------------TEQPQEEAVENDEIAK
GRPE_STAAB       KGHLQDEAIEET------------------------------SDENVIEEIDPKDQKINE
GRPE_STAHJ       DNSSNDSSNEES------------------------------SEE---TAVDPKDEEIQQ
GRPE_STAEQ       ANASDSENNSEE------------------------------SIKD--EESESQDTKIKE
GRPE_STAS1       TETSQDNLQEDD------------------------------SQE-IAEDVDPKDEEIQQ
GRPE_LACJO       PKAAPK-EEVKEN------------------------------------PVENYEKEIAE
GRPE_LACAC       KKEAAKGEETKKNN-----------------------------------ENQKLAKEIAD
GRPE_LACDB       KAGVKDDKKVKDDKEEA--------------------------AKPADVELDQLKAEVAA
GRPE_LACPL       AS----EATQAATSATD--------------------------DQAEQTTAVDPTQQITD
GRPE_LACSN       KS----DSKVNALSA-----------------------------------------KIAE
GRPE_LACSK       KKETPFEPVMEADEVEE--------------------------TTEAQAPVEEADDKLAE
GRPE_PEDPA       STDV--ESTNNDDLTTE--------------------------TQATTAL-----DDIKK
GRPE_STRGC       AEQAESASPEK--------------------------------------------SELEL
GRPE_STRPN       AEE---TTPEK--------------------------------------------SELDL
GRPE_STRTD       TEEVVEETKET--------------------------------------------SELEE
GRPE_STRA1       VEEVIEEIPEK--------------------------------------------SELEL
GRPE_STRMU       VEEVAEETSEN--------------------------------------------KELQE
GRPE_STRS2       ---EVVETPEK--------------------------------------------SELDL
GRPE_LACLA       TEEALEDIVEEE------------------------------------------INELDE
GRPE_TETHA       ESTVENETVEENENED-----------------------------------VQAISEVDD
GRPE_ENTFA       VSEVEVEATE-----------------------------------------------IEN
GRPE_LEUMM       ESEADDLQVEPDPKQ----------------------------------------AEIDK
GRPE_OENOB       KGSKRDSNAADEKNS----------------------------------------ASAAA
GRPE_GEOUR       TESADKIKQLEE-------------------------------------ALAAKEAEAAA
GRPE_GEOSL       VAAEERIRQLET-------------------------------------ELAAKEAEAAA
GRPE_PELPD       ATPEERISRLEE-------------------------------------QLAAKEAECRE
GRPE_MYXXD       TPSEDVAALRQEVESLKAQLEF-----------------SQAKGRETMERLREAHERAKE
GRPE_DESVH       NIPGDLLPLCRE-------------------------------------HICPVCPEKAQ
GRPE_STRCO       -ENAGLVAQLDQ-----------------------------------------VRTALNE
GRPE1_STRAW      AQTAGLTAQLDQ-----------------------------------------VRTALGE
GRPE_CUTAK       SPAPEELSRESQ-----------------------------------------LEALLAE
GRPE_MYCTU       GTAAADAAH--------------------------------------------TEDKVAE
GRPE_MYCPA       GTAPQAATAESG------------------------------------GA---ATDKVAE
GRPE_MYCLE       GSEPAGMTDRSA------------------------------------NSTDTMVDKVAE
GRPE_CORGL       EESPFGQASEEE----ISPELE---AEINDLLSDVDPDLD------GDGEVSAVETQLAE
GRPE_COREF       EPDPVVDAREDDRDPTLEEDLE---GDLQAVLDDIDAELGVADTPEATGDLPTTEAQLAE
GRPE_CORDI       EEEALVESAGLD------ADTL---ADLEDAFDGVDASTE--DPGATVGETSTLESELAE
GRPE_BIFAA       AQSQENGDSAAADGA-------------------DKAGAADGKADDTLTPLGQAKKEAAE
GRPE_BIFLO       NEG-ADAAPAAAEG--------------------EKTGEGQSDSADTLTPLGKAKKEAAD
GRPE_TROWT       TESADEIPTADAEQ-----------------------GE--------LEQLEKLKDD---
GRPE_LEIXX       PAGESQGEEILSDDD-------------------LDLLSGQTTADQLAADQLAADQLAAE
GRPE_THET2       KDLEAVGQEAQALE----------------------------------ERLKAAEEELKG
GRPE_MEIRU       PEAQNDLPEVERLK----------------------------------GEVEFLKAELEA
GRPE_DEIRA       ENMFGQVQEMMAKL----------------------------------ERVDELEKENAD
GRPE_HALMT       ARVADLEASVADLE----------------------------------TERDEAEETASD
GRPE_HALSA       DDVAALEARVETLT----------------------------------DELADAEDEVAD
GRPE_NATPD       AELVALREEAAELE----------------------------------TERD-------D
GRPE_RUBXD       EELAKLREELEA-----------------------------------------VRRERDE
GRPE_METTP       -EVAKLRQELED-----------------------------------------VKRIADE
GRPE_THEAC       -MYNDAQRKYSE-----------------------------------------ALDRISK
GRPE_THEVO       -EAILYRSIAEQ-----------------------------------------SSRKLAE
GRPE_PICTO       -KNEELLKKYQQ-----------------------------------------AMSDLED
GRPE_TREDE       DDVLSPEKRIEE-----------------------------------------LEAKCRD
GRPE_TREPA       ---LETGASEET-----------------------------------------LRERVNV
GRPE_SYNPX       TDPAERLQQLEHEL-------------------------------------QTLKQEHET
GRPE_SYNS9       IDPANRLQQLEQEL-------------------------------------NSLKQEHEA
GRPE_PROMM       ADNEARLQQLEQEH-------------------------------------SSLREEHET
GRPE_PROM1       CESNIKGSDTEARL-------------------------------------QQLEKEHET
GRPE_PROMA       LQSNKQTLDNEARL-------------------------------------EQLEKEHET
GRPE_PROMS       EELKNSISNNDARL-------------------------------------EQLEKEHET
GRPE_PROM9       EELKNTISNNDARL-------------------------------------EQLEKEHET
GRPE_PROM5       EDLKNTITNNDARL-------------------------------------EQLEKEHET
GRPE_PROMP       EDLKNTITNNDARL-------------------------------------EQLEKEHET
GRPE_NOSS1       EANTAALAELTQQI-------------------------------------SSLKTQLDE
GRPE_SYNE7       AELAAQLALVAADR-------------------------------------DRLKTELDE
GRPE_TRIEI       VLLKEAYELLQTQL-------------------------------------ETTKYQLEE
GRPE_THEEB       ADLLEQIAALEAAK-------------------------------------ASLSQVVEE
GRPE_SYNY3       AILQKDLASHRQEL-------------------------------------AEQSEQLDS
GRPE_GLOVI       TGFIARIDQLAAEN-------------------------------------SDLQKKLAD
GRPE_SYNJB       PDPGEALKQLQHEL-------------------------------------EVVRQQLKE
GRPE_SYNJA       QDLSETLKQLQQEL-------------------------------------EITRQQLKE
GRPE_BACFR       TEPLTAEEKLEKEL-------------------------------------KEAQAQIED
GRPE_BACTN       A-PLTHEEQLEKEL-------------------------------------EDAQAVIEE
GRPE_PORGI       APAAEENDKVADPV-------------------------------------EQLTAQLAA
GRPE_CHLPM       PQKEDRVAELEAAL-------------------------------------TAEKEQSGK
GRPE_PELLD       ETPESRIAGLEREV-------------------------------------QAEKEQNGK
GRPE_CHLTE       AIPAATEADMDAEI-------------------------------------SARDAEIQK
GRPE_CHLAB       -TPDNE--------------------------------------------IQDLQQEIAT
GRPE_CHLPN       -QNENE--------------------------------------------VEHLQQEIVT
GRPE_CHLMU       -SSDNE--------------------------------------------LQTLQQENAN
GRPE_PARUW       -EQTGEENIEFPSA------------------------------PNHPKQVLVTDEELKA
GRPE_LEPIC       TQTESMETAETETS--------------------------------LQTELESAKKEIES
GRPE_LEPBJ       TQAQAAEAADSELS--------------------------------LQSELDAAKKEVES
GRPE_BDEBA       ----------------------------------------------IASEIQKLQEQAEK
GRPE1_BUCAP      KEEKEKNDDVQN------------------------------------KIIDLLEIKLKK
GRPE1_BUCAI      YDS---DNLIKK------------------------------------NLIQFLEIQLKE
GRPE_WIGBR       QTTEKKINLNKNNISDEIIPEKIN-------------------FNDQKNIIENLKKNLSK
GRPE2_BUCAI      ENLIDAI-TVQNQ------------------------------------KIENLKLKLLQ
GRPE2_BUCAP      EKKNDES-IFQNK------------------------------------KMNEIREKIFK
GRPE2_BUCBP      ITQNNVSDDCQNQD-----------------------------------KINSLKQKILE
GRPE_MYCMS       QKADIKKNQYLNLKT---------------------------KLNNVLLEVQNLKELNET
GRPE_MYCCT       QKPHVKKNQYLKLKT---------------------------KLDTALLEVQNLKDLNET
GRPE_MESFL       KK---EKKDYKKI-------------------------------------IQDLEKQIES
GRPE_MYCGE       KELLAFVSELDKKFK---------------------------QQLNNFNELQQKIPLLQK
GRPE_MYCPN       KELLQAVAELEKKFK---------------------------QQVQNFNELQQKIPNLQK
GRPE_MYCGA       AVNQLMYNEFVKIET---------------------------AINNINNYIENLTHRLEL
GRPE1_BUCBP      VEINDVTNSDSKN----------------------------TDNDFQTEELNNFEKIFLN
GRPE_RHOBA       AANDEAFAEAGEETR--------------------------------DEEMTRLRGEVEE
GRPE2_STRAW      PPARPEATNGEPGPD----------------------------AAGPAPAEDEYTTAIQE
GRPE_MYCPE       KKLNHLVDSLKNENN------------------------------NKQAKIESLERQINL
GRPE_UREP2       KELYEHELKKNKE--------------------------LQNINTLLKDKNQQLEEQISQ
GRPE_MYCMO       INVQRDFSEKNKSSD---------------------------NLEILNKQIEDKNDLIIN
                                                                             

GRPE_ONYPE       LQQQLTQQ-----------KKSFDEELLKNQAELINFKKRA----QTQKANELKYASSNF
GRPE_AYWBP       LQQKLSQQ-----------KKTFDEGLLKNQAEFINFKKRA----QTQKENELKYASSNF
GRPE_ACHLA       LNDKY----------------------LRTLAEAENFKKRI----QAEKIMDRKYAASSF
GRPE_PEWBP       LKRDLQEA-----------HQQRTNDNLKYLADFDNFKKRI----TVQTNREIKYALTDF
GRPE_WOLTR       LEDHL----------------------RRAVADNENVKRIM----QKQISDANDYAVTKF
GRPE_WOLPM       LEDHL----------------------RRAVADNENVKRIM----QKQISDASDYAVTKL
GRPE_EHRCJ       FQNQF----------------------RLAVADKENVKRIM----QKNIDDTSIYAISNF
GRPE_FUSNN       WKNSFL----------------------RKQADFQNFTKRK----EKEVDELKKFASEKI
GRPE_FUSNP       WKNEYL----------------------RKQADFQNFTKRK----EKEVDELKKFASEKI
GRPE_BORBP       LKDLYL----------------------RKQAEFENFRKRL----EKEKDNFVKFANETI
GRPE_METS3       YISLSQ----------------------RLQADFENFKKIN----EKKSKDIIKFANEPL
GRPE_METTH       YTSHLQ----------------------RLQADFDNYKKQM----EKQELEIIKNANERL
GRPE_METST       YKDKLQ----------------------RIHADFENFKKRS----IKEKQEFVKFANEGL
GRPE_CALS4       YLDIAQ----------------------RIKAEFDNYRKRT----EKEKAEMISYGQEQV
GRPE_CLOD6       LNDKYQ----------------------RLQAEYANYRRRT----QQEKETIGVFANEKI
GRPE_ALKOO       IFSQFQ----------------------RLQADFTNYKKRV----EKEKGDIYLYANEKI
GRPE_CLOAB       AKDRLL----------------------RLSAEYENYRNRT----AKEKEGIYTDACSDV
GRPE_CLOTE       LKDRLL----------------------RTTGEYDNYRKRT----DREKEGLYASACEDV
GRPE_CLOB8       TKDRLL----------------------RLTAEYDNYRKRT----AKEKEGIYSDAYVDV
GRPE_CLOPS       LKDRLL----------------------RISSEYENYRKRT----DKEKERIYTDACEDV
GRPE_LACP7       LTDRLM----------------------RNMAEFENFRKRT----EKEKTQMFEVGAKDI
GRPE_METMA       LKDQLF----------------------RLAADFDNFRKRT----ARQMEENRKSVLEQV
GRPE_METAC       LKDQLF----------------------RLAADFDNFKKRT----ARQMEENRKAVLEQV
GRPE_METBF       LMEKYY----------------------RLAADFDNFKKRT----ARQMEENRKAVLEQV
GRPE_AQUAE       ----------------------------ELQREIDYLKERY----RRDLEEQRKFCYEKF
GRPE_THEMA       ----------------------------RLKAEYENYREEV----AREKRELIKNANEYL
GRPE_PSELT       ----------------------------QLKAQFENYKRDS----LREKEQVLKNANEYF
GRPE_VIBHA       LEAAL----LSSET----KVKDQQDAVLRSKAEVENMRRRT----EQEIDKARKYALNKF
GRPE_VIBVU       LEAAL----LASEA----RVKEQQDSVLRAKAEVENMRRRT----EQEIDKARKYALNRF
GRPE_VIBPR       LEAAL----LSSEA----KVKEQQDAVLRAKAEVENMRRRT----EQEIDKARKFALNKF
GRPE_VIBC3       LEAAL----LVSEE----RVKEQQDSVLRARAEVENMRRRS----EQEVDKARKFALSRF
GRPE_PHOPR       LEAAL----LSSDA----KVKEAQDNVLRARAEGENVRRRS----EVEIDKARKFALNKF
GRPE_ALIF1       LEAAL----LASQA----QVKEQQDTVLRAKAEEQNVRRRA----EEDVDKARKYALKKF
GRPE_SHELP       LEQAL----AAAEA----KVEEQKDSVIRAAAEVENVRRRA----AIDVEKAHKFALEKF
GRPE_SHESH       LEQAL----EAATA----KVDEQKDSVIRAAAEVDNIRRRA----AIDVEKARKFALEKF
GRPE_SHEFN       LEQLL----AESET----ALAERKDVEMRAAAETQNIRTRA----AKDVEQARKFALEKF
GRPE_SHEON       LEQLL----ADALA----KVDEQKDSVIRAAAEVDNIRRRA----AMDVEKANKFALEKF
GRPE_PSET1       LYAEL----EVAKQ----TIADQKDGVVRAAADVENMRRRA----AQDVEKAHKFALEKF
GRPE_PSYIN       LNKKL----ALAEQ----QIVDQQADVARAQADVVNARRIA----AQDVQKAHKFALVKF
GRPE_COLP3       LELAL----ATAQS----TVADQKDSVIRAKAEVDNIRRRA----AQDVEKARKFALEKF
GRPE_PSEP1       LEEQL----AAAK-----------DQALRAVADLQNVRRRA----EQDVEKAHKFALEKF
GRPE_PSEPG       LEEQL----AAAK-----------DQSLRVAAEAQNSIRRA----EQEVDKARKFALEKF
GRPE_PSEE4       LEEQL----AAAK-----------DQSLRAAADLQNIRRRA----EQDVEKAHKFALEKF
GRPE_PSEMY       LEEQL----AAAQ-----------DQSLRMAAELQNVRRRA----EQDVEKAHKFALEKF
GRPE_PSEU5       LEEQL----AAAQ-----------DQSLRVAAELQNIRRRA----EQDVEKAHKFALEKF
GRPE_PSEAE       LEEQL----AAAQ-----------DQALRMVADLQNVRRRA----EQDVEKAHKFALEKF
GRPE_PSEPF       LEEQL----AAAQ-----------DQSLRVAADLQNVRRRA----EQDVEKAHKFALEKF
GRPE_PSE14       LEEQL----AAAQ-----------DQSLRVAADLQNVRRRA----EQDVEKAHKFALEKF
GRPE_CHRSD       LEQAL----ADAK-----------DQTARAAAEAQNVRRRA----EQDVEKARKFALEKF
GRPE_ALCBS       VEVEL----AKVKK----ALA---EADVRAQAEVQNVRKRA----ERDVQHARKFALEKF
GRPE_YERE8       LEAQL----AAAVQ----R---ERESLLRAKAEVENIRRRT----EQDVEKAHKFALEKF
GRPE_SERP5       LEAQL----AEAQQ----H---ERDSLLRAKAEMENVRRRT----ELDIEKAHKFALEKF
GRPE_PECAS       LEAQL----SELQQ----R---ERDNMLRVRAEADNVRRRA----EMDIEKAHKFAVEKF
GRPE_SODGM       LEAAL----SQAQQ----R---EHDSVLRAKAEMENVRRRS----EQDVEKAHKFALERF
GRPE_PHOLL       LEEQL----KQAQQ----R---ERDAILRAKAEVENIRRRT----EQDVEKAHKFALERF
GRPE_ECOLI       LEAQL----AEAQT----R---ERDGILRVKAEMENLRRRT----ELDIEKAHKFALEKF
GRPE_ENT38       LEAQL----TEAQN----R---EREGVLRVKAEMENLRRRT----ELDVEKAHKFALEKF
GRPE_KLEP7       LEAQL----AEAQK----R---EREVMLRAKADEDNLRRRT----EQDIEKAHKFALEKF
GRPE_CROS8       LQSEL----TQAQN----R---ERDTVLRMKAEMENLRRRT----EQDIEKAHKFALEKF
GRPE_BAUCH       LEVEL----VQAQQ----R---ERDLLLRSKAEIENMRRRN----EIEVEKVYKFSLERF
GRPE_BLOFL       LQIQL----AQIKE----H---ERNTILRLKAEIENIQRRN----IQEIEKAHKFALDRF
GRPE_PASMU       LEAQL----TEMVK----K---EQDFLLRSRAEMDNIRRRA----EQDVEKAHKFGLEKF
GRPE_ACTSZ       LEEQL----ADAAK----K---EQDALLRARAEVDNMRRRA----EQDVEKAHKFALEKF
GRPE_HAEIN       LEEQLKTQIEEAAN----K---EQDILLRSRAEIENLRRRT----EQDVEKAHKFALEKF
GRPE_HAES1       LEEQL----IQAVK----K---EQDILLRTRAEIDNIRRRA----EQDVEKAHKFALEKF
GRPE_HAEDU       LETYI----AEADK----R---EQDIQLRAQAEIQNIRRRT----EQDIEKAHKFALEKF
GRPE_ACTP2       LETYV----AEADN----R---EKDIQLRAQAEIQNIRRRA----EQDVEKAHKFALEKF
GRPE_PSYS1       FKARI----AELEG----EVKEAKEGTARANAEAYDAQKRM----EQEADKSKKFALQKF
GRPE_ACIAD       LKAQI----GKLEE----SLKLEKARTANAVYEAEKVKERA----EREADTAKKFALEKF
GRPE_XANOM       EIALVK------------------ADALRERADLENQRKRI----ARDVENARKFANEKL
GRPE_XYLFT       EIASIK------------------ADVLRERAELENQRKRL----IRDVEQARKFANEKL
GRPE_ALKEH       RAEENW------------------NECLRARAEMQNIQRRA----QADVEKARKYAVEKI
GRPE_HALHL       KAEEHW------------------DQVLRMRAELENARRRA----EKDVDQAKRQGLEKV
GRPE_HYDCU       EAESQK------------------ELALRTLADMENLKRRT----RMDVESAHKFALEKF
GRPE_BURTA       LQESF----------------------LRAKAETENVRRRA----QDDVAKAHKFAIESF
GRPE_BURL3       LQESY----------------------LRAKAETENVRRRA----QDDVSKAHKFAIEGF
GRPE_PARXL       LQESF----------------------LRAKAETENVRRRA----QEDVAKAHKFAIESF
GRPE_RALSO       NYENW----------------------ARAVAEGENIRRRA----QDDVARAHKFAIEGF
GRPE_POLAQ       LQDNF----------------------LRAKAEGENIRRRA----VEDIAKAHKFAIESF
GRPE_POLNA       LSDNY----------------------LRAKAEAENARRRA----EDEISKARKFALESF
GRPE_ACIAC       LADQF----------------------LRAKAEAENARRRA----DEEVSKARKFGIESF
GRPE_BORPE       QQEQV----------------------LRAAAEAENVRRRA----QEDVAKARKFGIESF
GRPE_NITEC       HHDAW----------------------LRAKAETENIRKRA----QTDIANAHKYAIDNF
GRPE_NITEU       HHDAW----------------------LRAKAETENIRKRA----QTDIASAHKYAIDNF
GRPE_NITMU       HYDAW----------------------LRAKAEGENIRKRA----QMDVTNAHKYAIENF
GRPE_METFK       QQAAV----------------------LYAKAEGENIRRRA----AEDIEKARKFALEKF
GRPE_METSS       QQANV----------------------LYVKAEGENIRRRA----AEDIDKARKFALEKF
GRPE_DECAR       HYDAW----------------------LRAKAEGENIRRRA----QDDISKAHKFAVEKF
GRPE_NEIMB       LEAQLK------------------DEQLRALANEQNLRRRH----QQEIADTHKFAGQKF
GRPE_CHRVO       LNDTL----------------------LRARAELENQRRRA----QDEVAAAHKYAIGKF
GRPE_FRATO       LEDSCD---------------QFKDEALRAKAEMENIRKRA----ERDVSNARKFGIEKF
GRPE_FRAP2       LEETCD---------------SFKDEALRARAEMENVRKRA----ERDVSNARKFGIEKF
GRPE_DICNV       LQQEVA---------------ELKDQLIWQKAENENLRKRQ----ARELENAYKFASERL
GRPE_LEGPA       AEQKAH---------------ENWEKSVRALAELDNVRRRM----EREVANAHKYGVEKL
GRPE_COXBN       MEHKVD---------------EYKTQYLRAQAEMDNLRKRI----EREKADIIKFGSKQL
GRPE_BRUME       LKDQM----------------------LRVAAEMENLRKRT----QRDVQDARAYAITNF
GRPE_OCHA4       LKDQL----------------------LRAAAEMENLRKRT----QRDVQDARTYAVTNF
GRPE_BARQU       LKDQL----------------------LRLVADMENLRRRT----ARDVADAKAYSIANF
GRPE_BARHE       LKDQL----------------------LRLAADMENLRRRT----ARDVADAKAYSIANF
GRPE_RHIRD       LRDKF----------------------LRLAAEMDNLRRRT----ERDVKDAKAYSLAGF
GRPE_RHIME       LRDKY----------------------LRLAAEMDNLRRRT----ERDVKDAKSYSVAGF
GRPE_RHIL3       LRDRY----------------------LRLAAEMDNLRRRT----EREVKDAKSYSVAGF
GRPE_RHILO       LKDRA----------------------LRVAAEMENLRRRT----ARDVHDARTYAVANF
GRPE_RHOPS       ARDKM----------------------LRTLAEMENLRRRT----AKEVADARTYGVSAF
GRPE_RHOPA       ARDKM----------------------LRTLAEMENLRKRT----QKEVADARTYGVTSF
GRPE_BRASO       ARDKM----------------------LRTLAEMENLRKRT----AREVADARMYGITGF
GRPE_RHOP5       ARDKM----------------------LRTLAEMENLRKRT----TREVADARIYGVTAF
GRPE_BRADU       ARDRM----------------------LRTLAEMENLRKRT----TKEVADARLYGITGF
GRPE_RHOS4       LRDRF----------------------MRALADAENSRKRA----DRDRREAEQYGGTRL
GRPE_RICTY       LQDKL----------------------IRTTAEIDNTRKRL----EKARDEAKDYAIATF
GRPE_RICCN       LKDKL----------------------IRTTAEIDNTRKRL----EKARDEAKDYAIATF
GRPE_RICB8       LKDKL----------------------IRASAEIDNTRKRL----EKARDEARDYAITTF
GRPE_CAUVC       LKEQA----------------------LRYAAEAENTKRRA----EREMNDARAYAIQKF
GRPE_WOLSU       LEDSY----------------------LRVHADFENTKKRL----EREKFQALEYAYEKI
GRPE_HELHP       LKDQY----------------------VRAFADFENTKKRL----ERDKNQSLEYAYERI
GRPE_HELAH       MHEKY----------------------LRVHADFENVKKRL----ERDKSMALEYAYEKI
GRPE_NITSB       CEEKY----------------------LRVHADFENTKKRL----EREKIQAIEYSLEKF
GRPE_ARCB4       SEEKF----------------------LRAYADFENMKKRL----EKEKYQAIDYASEKF
GRPE_CAMC5       LTDKY----------------------YRANAEFENIKKRF----EKEKTDIASYANEKF
GRPE_CAMFF       AKESL----------------------MRATADFENIKKRL----EREKGEAVKFANESF
GRPE_CAMJR       LKDKY----------------------MRANAEFENIKKRM----EKEKLSAMAYANESF
GRPE_SULNB       YKDKY----------------------IRAHADFENAKKRL----EKDKMNAVAYANESF
GRPE_PARTM       LEAKIKE---------------MENRYLRLYADFENFRRRT----RREMEAAEKYRAQSL
GRPE_GEOSE       TRSEDKR---------------NGNRYLRLYADFENFRRRT----RQEMEAAEKYRAQSL
GRPE_GEOKA       LEAKLSE---------------MEHRYLRLYADFENFRRRT----RQEMEAAEKYRAQSL
GRPE_GEOTN       LEEKLAE---------------MEKRYLRLYADFENFRRRA----RQEMEAAEKYRAQSL
GRPE_BACVZ       LQGLLDE---------------KENKLLRVQADFENYKRRS----RLEMEAAQKYRSQNV
GRPE_BACSU       LQGLLEE---------------KENKLLRVQADFENYKRRS----RLEMEASQKYRSQNI
GRPE_BACP2       LQQLLDE---------------KENKILRVQADFENYKRRA----RTEVETVQKYRSQHV
GRPE_BACLD       LQERLEE---------------KENKLLRVQADFENYKRRA----RLDLEAAEKYRSQRI
GRPE_BACCN       LQAKLTE---------------TEGRMLRLQADFENYKRRV----QLDKQAAEKYRAQSL
GRPE_BACHD       LEGQVDE---------------LNQRLLRIQADYDNFRRRQ----REEKEAAAKYRAQSL
GRPE_BACSK       LEIELNE---------------LKDRLARVRADYENFRRRT----KEEKEAQAKYRAQGF
GRPE_LISIN       LENKLDE---------------VENRYLRMQADFENVKKRH----IADRDASQKYRSQSL
GRPE_LYSSH       LQAKLDDD--------------EENRHLRLRADFDNMRRRQ----QLDGEAAEKYRAQSL
GRPE_OCEIH       LQQEKDE---------------TYNRLVRLQAEFDNYKRRT----LKEREADRKYKSQDL
GRPE_STAAB       LQQLADE---------------NEEKYLRLYAEFENYKRRI----QKENEINKTYQAQRV
GRPE_STAHJ       LQLKANE---------------NEEKYLRLYAEFENYKRRI----QKENETNKTYQSQRV
GRPE_STAEQ       LEKLAND---------------NEEKYLRLYAEFENYKRRI----QKENQINATYKAQGV
GRPE_STAS1       LKKDVQE---------------NEEKYLRLYAEFENYKRRI----QKENQTMKAYKAQDV
GRPE_LACJO       LTAKNKD---------------LEDKYLRSEAEIQNMQARY----AKERAQLIKYESQSL
GRPE_LACAC       LKEKNKD---------------LEDKYLRSEAEIQNMQNRY----TKERAQLIKYESQSL
GRPE_LACDB       LTQKNKD---------------LEDKYLRSQAEIQNAQRRY----SKERADLVKYESQRL
GRPE_LACPL       LKAQLDA---------------KDDQLLRAQAEIVNMQNRN----KKEQAALLKYDGQAL
GRPE_LACSN       LQQQLDD---------------SQNDYLRAQAEIQNMQKRS----QKEQSALAKYGAQRL
GRPE_LACSK       LQKKYDA---------------MEDSFLRSQAEIKNIQMRN----QKEQANLLKYDGQSL
GRPE_PEDPA       VEAERDE---------------LSDKYIRAQAEIVNMRRRN----EKEQASLIKYDGQKL
GRPE_STRGC       ANERADD---------------FENKYLRAHAEMQNIQRRA----NEERQLLQRYRSQDL
GRPE_STRPN       ANERADE---------------FENKYLRAHAEMQNIQRRA----NEERQNLQRYRSQDL
GRPE_STRTD       AQARAEE---------------FENKYLRVHAEMQNIQRRA----KEERQQLQKYRSQDL
GRPE_STRA1       ANERADE---------------FENKYLRAHAEMQNIQRRS----SEERQQLQRYRSQDL
GRPE_STRMU       ALERAED---------------FENKYLRAHAEMQNIQRRA----NEERQSLQRYRSQDL
GRPE_STRS2       ANERAEE---------------FENKYLRAHAEMQNIQRRA----NEERQTIQRYRSQDL
GRPE_LACLA       AQKLATE---------------WENKFLRVSAEMQNVQRRG----NEERLQLIKYRSQDL
GRPE_TETHA       LKAQLDE---------------MEDKYLRASAELSNMNNRF----RNERQTLQRYRSQDL
GRPE_ENTFA       LKAELSE---------------MEDKFLRARAEIANMSNRN----KNERELLVRYRSQDL
GRPE_LEUMM       LTEQVNN---------------LEEKLLRSQAEIQNIQQRN----ARELQNVRKYDGQKL
GRPE_OENOB       SSSAVSDA-----E----PAVDYEDKFYRAEAEMQNMQQRF----NKERASILKYEGQDL
GRPE_GEOUR       NWDKV----------------------LRERADLENYRKRV----QKEKEELLKYGNESL
GRPE_GEOSL       NWDKF----------------------VRERADLENYRRRT----QKEKEELLKYGNESL
GRPE_PELPD       NWDRF----------------------VRERADLENFRKRS----NREKEELLNYGTKSL
GRPE_MYXXD       AQERT----------------------VRHAADLENYRKRA----QKEKEEVQRFGSEKL
GRPE_DESVH       ADEQR----------------------LRALADLENTKKRL----QREKDEQVRYAAETV
GRPE_STRCO       RTADLQ----------------------RLQAEYQNYRRRV----ERDRVAVKEVAVANL
GRPE1_STRAW      RTADLQ----------------------RLQAEYQNYRRRV----ERDRIAVKEIAIANL
GRPE_CUTAK       RTEDLQ----------------------RLQAEYVNYKRRV----DRDRALSRQSGVDKV
GRPE_MYCTU       LTADLQ----------------------RVQADFANYRKRA----LRDQQAAADRAKASV
GRPE_MYCPA       LTADLQ----------------------RVQADFANYRKRA----LRDQQAAADRAKAAV
GRPE_MYCLE       LTSDLQ----------------------RVQADFANYRKRA----LRDQQTASDRAKATV
GRPE_CORGL       RTEDLQ----------------------RVTAEYANYRRRT----ERERQGIIDTARAGV
GRPE_COREF       RTEDLQ----------------------RVTAEYANYRRRT----ERERAGIIDTAKSGV
GRPE_CORDI       RTEDLQ----------------------RLSAEYANYRRRT----DRERKVGVEAAKAKV
GRPE_BIFAA       YLEALQ----------------------RERAEFINFRNRA----QKEQERFRQHGIIDV
GRPE_BIFLO       YLEALQ----------------------RERAEFINYRNRT----QKEQERFRQHGIIDV
GRPE_TROWT       ----LA----------------------RERAAFHNFRMAR----AKQAEIERDRTRSEV
GRPE_LEIXX       RLADLQ----------------------RVTAEYANYRKRT----ESNREIERERAIGDA
GRPE_THET2       LKDKYL----------------------RLLADFDNYRKRM----EEELKAREREGVLKA
GRPE_MEIRU       SKNKFL----------------------RLYADFENYKKRM----VQELEAAQRNGKFDA
GRPE_DEIRA       LKNRLG----------------------RLASDFEGYRNRT----TIESAEAHDKGVSKA
GRPE_HALMT       LESRLK----------------------RTQADFQNYKKRA----KKRQQQIKERATEDF
GRPE_HALSA       LTERVQ----------------------TKQADFKNYKERA----KRKQEEIRERATEDL
GRPE_NATPD       LESRLK----------------------RKQAEFQNYKKRQ----EKQREKERARATEAL
GRPE_RUBXD       YLDALR----------------------RLKAEFENSRKRM----EREAQRIREAAAERL
GRPE_METTP       RLEQLL----------------------RCRAELDNVIKRN----SREREELARFASEAI
GRPE_THEAC       LTDAYL----------------------REKAEVENFIKIK----DREVEMSKKNANEKL
GRPE_THEVO       ISEAYK----------------------HKLADMENYLKIK----DRETEIIRKNANESL
GRPE_PICTO       YKNLYM----------------------RQRSEMENYQRYI----EKTINNIKANANADL
GRPE_TREDE       WQDQYL----------------------RKAADFENYRKRM----IREKQEAIDYANSNL
GRPE_TREPA       LQEQYL----------------------RKAADLENYRKRA----LRERQEAVEHAYAAL
GRPE_SYNPX       LQSQYM----------------------RIAADFDNFRKRQ----SRDQEDIRQQLVCST
GRPE_SYNS9       VQSQYM----------------------RIAADFDNFRKRQ----ARDQDDLRQQLVCST
GRPE_PROMM       LRSQYM----------------------RIAADFDNFRKRQ----SRDQDDLRFQLICTT
GRPE_PROM1       LNSQYM----------------------RIAADFDNFRKRQ----TRDQDDLKIQLTCTT
GRPE_PROMA       LRSQYV----------------------RIAADFDNFRKRQ----SRDQDDLKLQLTCNT
GRPE_PROMS       LKNQYV----------------------RISADFDNFRKRQ----SRDQDDLKIQLVSKT
GRPE_PROM9       LKNQYV----------------------RISADFDNFRKRQ----SRDQDDLKVQLVSKT
GRPE_PROM5       LKSQYV----------------------RIAADFDNFRKRQ----SRDQDDLKIQLVSKA
GRPE_PROMP       LKSQYV----------------------RIAADFDNFRKRQ----SRDQDDLKVQLVSKA
GRPE_NOSS1       RSTQYM----------------------RIAADFENYRKRT----QKEKEELDLQVKRNT
GRPE_SYNE7       QNSAYL----------------------RLAADFENFRRRT----LKEREELELQSKRTT
GRPE_TRIEI       KESQYK----------------------RLGADFDNFRKRT----QKEKEDLDTQVKCST
GRPE_THEEB       RNSQYI----------------------RLAADFENFRKRT----QREKEELELQIKCSV
GRPE_SYNY3       IKKRYV----------------------ALAAEFDNFRKRT----QREKEEQAKLIKGRT
GRPE_GLOVI       YEQKYT----------------------RLMADFDNFRKRT----QREKDELAYFVSAKL
GRPE_SYNJB       KEDAYL----------------------RLYADFENYRRRT----QREKEEFSQKERQKF
GRPE_SYNJA       KEESYI----------------------RLYADFENYRRRT----QREKEEFSQKERQKF
GRPE_BACFR       QKDKYL----------------------RLSAEFDNYRKRT----VKEKAELILNGGEKS
GRPE_BACTN       QKDKYL----------------------RLSAEFDNYRKRT----MKEKAELILNGGEKS
GRPE_PORGI       LNDTHL----------------------RLMAEYDNYRKRT----LKEKSELIRNGGEKV
GRPE_CHLPM       LRDEVL----------------------RRAAEFENFRKQK----EREAVQSSLRAKETI
GRPE_PELLD       FRDELL----------------------RRAAEFENFRKQK----EREAVMASQRATDNV
GRPE_CHLTE       LREEVM----------------------RRAAEFENFRKQK----EREAALSGTRMLENI
GRPE_CHLAB       LKAELKE---------------KNDKYLMVLAESENARKRM----QKERQEMMQYAVENA
GRPE_CHLPN       LKTELKE---------------KNDKYLMALAESENSRKRL----QKERQELMQYALENT
GRPE_CHLMU       LKAELKE---------------KNDRYLMALAEAENSRKRL----QKERTEMMQYAVENA
GRPE_PARUW       LKKEATE---------------YKDKYLRLLADSENARKRL----QKERQEISRYALENM
GRPE_LEPIC       LKDSWA----------------------RERAEFQNFKRRS----AQEFVSIRKEAVKSL
GRPE_LEPBJ       LKDSWA----------------------RERAEFQNFKRRS----AQEFVSIRKEAVKSL
GRPE_BDEBA       FKNDYL----------------------YLRAEFENYKRNA----IKERSELMKYGGERL
GRPE1_BUCAP      SQEKIIN------------------MQLKNHEEILKLNYRL----NSDIEKSRKFSLEKV
GRPE1_BUCAI      SEEKIIE------------------KEEIVEKEIVLIHNRF----NKEIEKSIKFSLEKI
GRPE_WIGBR       EKKSKHD------------------LILRNQAEMENLMKRT----QANIEKSYKFALEKF
GRPE2_BUCAI      NQKKIND------------------IELRKLANIENIKKNT----EEKIEKIKKTEIERF
GRPE2_BUCAP      NKKEINN------------------LKLRHLANIENIKKNT----EKKIKKIKNAEIENF
GRPE2_BUCBP      IKKHISE------------------VKLREQAEIENINKNT----KNKIKIIIDTQLENF
GRPE_MYCMS       LKKELKSE------------------KQLNLAEISNLTKKY----NQKELETKKYGASNL
GRPE_MYCCT       LKKDIESE------------------RQLNLAEISNLTKKY----NQKEIEIQKYGASKL
GRPE_MESFL       CQKEIEFQ------------------KSLRNADIANLTKKR----NEQEALVRKYGSSNL
GRPE_MYCGE       ANEEFALKFERMQ----------REAQNQIQAKLDELNLKN----KKELEQAKKYAIAKT
GRPE_MYCPN       VNEEFRLKVEKIQ----------EEAQKKIQEKVAELTIKS----KEELENAKKYVIEKS
GRPE_MYCGA       TNENFKTKVQEVE----------SKAQQKINDRIEELDKRK----KEEIENAKKYAIEKS
GRPE1_BUCBP      LNSDLLN------------------QQLLVKNNLKLYKIRA----EKEINRAYKFSLKSF
GRPE_RHOBA       ASKRVL----------------------QAQAEAENFRKRL----RRDTEAQLKFAGMPL
GRPE2_STRAW      LEDRWR----------------------RTLADLDNLRKRH----ARELERERAVERSRT
GRPE_MYCPE       LNENFKSE----------VIKKASEAQTKLDEKIKEFQAKY----ETELKHAKKYALKSS
GRPE_UREP2       LNQDFIKQ----------LETKAKQAQQILEQKVNELEARH----EAKVNDAVFKIFKFK
GRPE_MYCMO       LEKKVFDLTLENKKNIDDFNEKAKSFAKKAQEELDKYKLELKSFLENEFEEKKKFSFQKL
                                                                             

GRPE_ONYPE       ITNLLMPLEQLEKVIDMPTQNE------LLQKYLLGFKLLQQQIKKVLQ-DEGVEEIEAL
GRPE_AYWBP       INNLLMPLEQLEKVIDMPTQNE------LLQKYLLGFKLLQKQIKKVLQ-DEGVEEIEAL
GRPE_ACHLA       ATELLVPYEQFSKIVDFPSDNE------LLNNFLIGFKMIRDQFKSVLE-NEGVVEIKAL
GRPE_PEWBP       IKNILIPLEQFEKVLEMPKVDD------SVKSFLLGFKMIHKQVKDILQ-KEGVEEIKAL
GRPE_WOLTR       ARDMIDSCDNLKRVMEILKDD---------DPVHEGIKVAYKKIMNDLK-KHGIEEIDPI
GRPE_WOLPM       ARDMIDSCDNLKRVMEILKDG---------DPVHEGIKVAYQKIINDLK-KHGIKEVDPL
GRPE_EHRCJ       ARDLLSSCDNLETSLKNLKED---------DSIHAGVLMTYKELLNTLE-RHNITRIDPI
GRPE_FUSNN       ITQFLGSLDNFERAIESSSES------KDFDSLLQGVEMIVRNLKDIMSSE-DVEEIPTE
GRPE_FUSNP       ITQFLGSLDNLERAIESSIES------KDFDSLLKGIEMIVRNLKDIMSAE-GVEEIKTE
GRPE_BORBP       MKDVVNFLDNLERAINSSRKS------KDFDNLLTGISMIENEILSIFDKKYNLKKFGEN
GRPE_METS3       IKNILDSYEDLERALENS---------KTEKELRDGVELIYSKIKDVLTKE-GLEEIPAK
GRPE_METTH       ILKLLDVYEDLERAIEN------------QDSSMDGLEVIYRKFRDTLTKE-GLSEIPAE
GRPE_METST       ILKVLEAYEDLERALEVK---------E-DKNLREGVELIYKKLTKILEDE-GVEPIETK
GRPE_CALS4       IIELLPVIDNFERALANE---------GDYNSLREGLELIYRQFKKVLDKF-EVREIEAE
GRPE_CLOD6       ITELIPVIDSMERALDACEDK------E--DTMYKGISLVHKQLIDTLVKF-GVEEIEAE
GRPE_ALKOO       ALDLLNIIDNFERAIQSTEKT------EENDSLLQGISLVYKQLLDTLTKH-GVEEIEAM
GRPE_CLOAB       INEMLPTLDNLERAASTEGSA------ED---IKKGVEMVVKQFKNSLSKL-GIEEIPSE
GRPE_CLOTE       LKEILPVLDNLERAILAKGDI------ED---LKKGVDMTLKQFKDSFKNL-GVEEISTE
GRPE_CLOB8       LKEIVPILDNLERAVAADGSI------ED---LKKGIEMTIKGCKDSFAKL-GVEEIDAT
GRPE_CLOPS       LIKMLPVLDNLERALAVDGTV------ED---LKKGVEMTVRQFEDALEKL-QVEEISTE
GRPE_LACP7       IERILPVIDNFERGLAAVSVE------EKDSAFVQGIEKIYKQLVTTLEAA-GVKQIEAA
GRPE_METMA       LLDFVEVTDNFDRAIKSARTA------EDMGPIVSGIEQLSKQFFSILEKYGLERVKCEK
GRPE_METAC       LLDFVEVTDNFERALKSAQTA------EDMGSIVSGIEQLSKQFFSILQKYGLERIKCEK
GRPE_METBF       LLDFVEVTDNFDRALKSAKTA------EDMSSIVSGIEQLSRQFFSILEKYGLEKIESEK
GRPE_AQUAE       AYDLLEVMDNFERALEYGRQA------QDVKSILLGIEMIYSEMKKIFEKYGIREIPVE-
GRPE_THEMA       ISKLIPVLDDFERALNQGEKG------D---AFYEGVKMIYKKLLNVLEKEGLTKIHVG-
GRPE_PSELT       LVKLIPVLDDMERAFEEVRRS------KSYKNFYSGMEIIYKKLWKILNDEGLFKIEPK-
GRPE_VIBHA       AEELLPVIDNLERAIQAADA-----EHEVVKPILEGVELTHKTFVDAVS-KFGLKEINPE
GRPE_VIBVU       AEELLPVIDNLERAIQAADA-----ESEAVKPLLEGVELTHKTFVDVVS-KFGLKEINPE
GRPE_VIBPR       AEELLPIIDNLERAIQAADT-----ESEVVQPILEGITLTHKTFIDTIS-KFGLKEINPE
GRPE_VIBC3       AEELLPVIDNLERAIQAADG-----EVEAIKPLLEGVELTHKTFVDTIA-KFGLKEINPH
GRPE_PHOPR       TEELLPVIDNLERAIETADK-----NDEALKSMIEGVELTLKTMTATVE-KFGLKQHNPV
GRPE_ALIF1       AGELLPVLDNLERALESGDK-----ENEAAKALLEGVELTLQTFVSTVE-KFGLTVINPM
GRPE_SHELP       ANELLPVIDNMERALQGTSS-----EDEATKAIYEGVELTLKTFTSAVA-KFGLTQVDPQ
GRPE_SHESH       ANELLPVIDNMERALQGTDA-----EAEATKAVYEGVELTLKSFIGTVE-KFGLTVVNPQ
GRPE_SHEFN       ANELLPVIDNMERALQGTNP-----EDEATKAIYEGVELTMKGFLTSVE-KFGVTQVNPQ
GRPE_SHEON       ANELLPVLDNMERALQGTNP-----QDETTKAIYEGVELTQKSLLTAVA-KFGVKQIDPQ
GRPE_PSET1       ANELLPVIDNLERAIEFSDK-----ENETLKPVLEGISMTVKSFNDAVA-KFGVEIVNPQ
GRPE_PSYIN       ADGLLPVIDSLEMAISHADK-----EDETLKPMIEGVELTLKSMLDTVD-KFGLKVIDPK
GRPE_COLP3       AGEMLTSVDNLERALQNIDK-----EDESNKGVIEGVELTLQGLITSLD-KFGVKAVDPQ
GRPE_PSEP1       SSDLLPVIDSLELALAHSSA-----EDEHVKQIREGVELTLKMFQDTLK-RYNLEAVDPH
GRPE_PSEPG       SSDLLPVIDSLELALAHSSA-----DDEHVKQIREGVELTLKMFQDTLK-RYNLEAVDPH
GRPE_PSEE4       AGDLLPIIDSLERGLELSNA-----DDDTIKPMREGIELTLKMFHDTLK-RYNLEALEPH
GRPE_PSEMY       ANDLLPVVDSLERGLELSSP-----DDEAIKGVREGMQLTLKLFIDTLA-RHQLEAVEPH
GRPE_PSEU5       AGDLLAVADSLERGLELSNP-----DDEAVKPMREGVELTLKLLLDTLA-RHQLEQLDPH
GRPE_PSEAE       AGDLLAVVDTLERGLEMSDP-----NDEAIKPMREGMELTLKMFDDTLR-RYQVEALNPE
GRPE_PSEPF       AGDLLPIVDSLERGLELSSP-----DDESIRPMREGIELTLKMFHDTLT-RYQLVAVSPQ
GRPE_PSE14       AGDLLPIIDSLERGLDLSNP-----DDESIRPMREGIELTLKMFQDTLK-RYQLEAIDPY
GRPE_CHRSD       VKELLPVVDSLEKALESM-------QEGASEVHREGVSMTLKLQLDVLA-KFGVEAVDPQ
GRPE_ALCBS       AGDLLSVADNLERGLAALDA-----EDDALKGAREGIELTLKSLLDAFA-RYNIEQINPA
GRPE_YERE8       SAELLPVIDNLERALDTADK-----TNAELAAMIEGVELTLKSLLDAVG-KYGIQVVSET
GRPE_SERP5       SGDLLPVLDNLERALELADK-----NNPELTAMIEGIELTLKSLQDVVR-KYGIEIVGDT
GRPE_PECAS       ASEMLPVIDNLERALDTADK-----ANESLAAMIEGVELTLKSLLDAVH-KFGIEVVGDV
GRPE_SODGM       AGELLPVIDNLERALDMSDK-----ANAELASTIEGIELTLKSLLDAVR-KFGLDVVGDT
GRPE_PHOLL       ANELLPVIDNLERALEVADR-----TNTEIAPMVEGIELTLKSFLGAVG-KFGIEVVGDT
GRPE_ECOLI       INELLPVIDSLDRALEVADK-----ANPDMSAMVEGIELTLKSMLDVVR-KFGVEVIAET
GRPE_ENT38       VNELLPVIDSLDRALEVADK-----ANPDMTAMVEGLELTLKSMLDVVR-KFGVEVVAET
GRPE_KLEP7       VNELLPVIDSLDRALEVADK-----ANPELAPMVEGIELTLKSMLDVVR-KFGVEVIADT
GRPE_CROS8       INELLPVIDSLDRALEVANK-----ENQDMAAMVEGIELTLKSMLDVVR-KFGVEVIADT
GRPE_BAUCH       VSELLPVIDNLERALEMSDK-----SSQNLASTIEGIELTLKSLLNVVQ-KFGIKVVSET
GRPE_BLOFL       VSELLPVIDNLERTLGIIDR-----SNTTLSAIIEGIDLTLKSFLDTVY-KFGVKSIHEI
GRPE_PASMU       SKDILNTIDNLERALATPAN----LEDESIKSLFDGVELTLKELLATVS-RFGVEAVGVV
GRPE_ACTSZ       AKDLLNTIDNLERALATPAN----VEDESVKGLFDGVELTLKELLATVA-RFGIEPVGLV
GRPE_HAEIN       SKDILNTIDNLERALATPAN----KEDESVKALFDGVELTLKELVSTVG-RFGVEAVGVV
GRPE_HAES1       AKDLLETIDNLERALSTPAN----VENETIKSLVDGVELTLKGLLSTVA-RFGVEPVGVI
GRPE_HAEDU       AKELLTVVDNLERGLVALDTA---VTDEKTQALVDGVEMTHKEFVSTLA-KFGIEAIGEI
GRPE_ACTP2       SKELLTVVDNLERGLNALDTA---VTDEKTQALVDGVEMTHKEFISTLA-KFGVEAVGVV
GRPE_PSYS1       ARELLEIVDNLERAIENA---------DANDPVAEGVQLTHKALLAVLH-KNGIEVVDPQ
GRPE_ACIAD       AKSLLDSVDNLERAIQAAG--------KEKTPLLEGVELTLKSLTTTLE-KFDVVSVDTT
GRPE_XANOM       LGELLPVFDSLDAGLTAA--------GTQPSPLRDGLDMTYKQLLKVAA-DNGLTLLDP-
GRPE_XYLFT       LGELLPVFDSLDAGLTAS--------GSEPSPLRDGLELTYKQLLKVAI-DNGLMLLDP-
GRPE_ALKEH       AGDLLGVKDSLEMGVKAAKE-----EGADPQKLLEGSELTLKMLSQVLE-RFNVQEIDP-
GRPE_HALHL       CGDLLQVKDSLEMGVQAAED-----AEADREKLLEGSQLTLKMLNQVFE-RFEIEEINP-
GRPE_HYDCU       VNELLPVLDSMEMGLDASSK-----EDVTIDSIREGLDMTFKQFLDVMQ-KFNVERVNP-
GRPE_BURTA       AENLLPVLDSLEAAVGDT--------SGDLAKVREGVELTLRQLTSALE-KGRVAALNP-
GRPE_BURL3       AEHLLPVLDSLEAAVNDT--------SGDITKVREGVELTLRQLTNALE-KGRVVALNP-
GRPE_PARXL       AEHLLPVIDSLEAAVAHS--------SDDPAKVREGVELTLRQLTGALE-KGRVVALNP-
GRPE_RALSO       AEYLLPVMDSLQAALADA--------SGDVAKLREGVELTLKQLNAAFE-KGRVTELNP-
GRPE_POLAQ       AEHLVPVTDSLYAALSTD--------AGDAKAFKEGLEITLKQLLSAFE-KGRMTEINPA
GRPE_POLNA       AESLLPVLDSLEAGLNMK--------EATLEQLREGSQATLKQLKAALE-RNKVIEINPV
GRPE_ACIAC       AESLLPVADSLTAALAIK--------DATIEQLREGTDATLRQLTSALE-RNKVLAIQPG
GRPE_BORPE       AESLVPVKDSLEAALAQP--------DQAAQAWREGVEVTLKQLTAAFE-RNLLKEIAPA
GRPE_NITEC       ATQLLAVMDSLDAALAVE--------NSTIESLKDGVELTRKQLAAVFE-KFNIHTINP-
GRPE_NITEU       SVQLLAVMDSLDAALATE--------NSTLENLRDGVELTRKQLAAVFE-KFNIHTIDP-
GRPE_NITMU       STELLSVMDSLEAALAVE--------NATVENFKSGMELTLKQLTATFA-KFNIKQLSP-
GRPE_METFK       SSELLAVKDSLDAALNVG--------SATLESYRDGVELTAKQLTAVFE-KFSIVEINP-
GRPE_METSS       SSELLAVKDSLDAALVVE--------NATVESYKSGVELTAKQLLSVFE-KFHITEINP-
GRPE_DECAR       AGELLAVKDSLEAALAVQ--------EQTVDSFKSGVELTLKQLVSAFD-KNALNEVNP-
GRPE_NEIMB       AVEMLPVKDYLEMALLDQ--------SGNFDALKMGVQMTLNELQKAFD-ATQIKEINPK
GRPE_CHRVO       AAELVTVKDYLEMALLDQ--------SGQIDALKMGVDMTLKQLVSAFD-KAQIKDIAPK
GRPE_FRATO       AKELLPVIDSIEQALKHEVK----LEEAIAMK--EGIELTAKILVDILK-KNGVEELDP-
GRPE_FRAP2       AKELLPVIDSIEQALKHEVK----LEEAIAMK--EGIELTSKMLVDTLK-KNGLEELDP-
GRPE_DICNV       LKDLLPVIDSLNLGLQAALD----TENEAVKQFITGSEMTLTMFQETLA-RHGIEEINP-
GRPE_LEGPA       ISALLPVVDSLEQALQLADK----NSDP---SMHEGLELTMKLFLDALQ-KFDVEQIDP-
GRPE_COXBN       ITDLLPVADSLIHGLESPAS----E-DPQVKSMRDGMSLTLDLLHNTLA-KHGVQVINPN
GRPE_BRUME       ARDMLSVSDNLRRALDAIPADALEA-DSNLKSLSEGVEMTERAMLLALE-RHGVKKLEPE
GRPE_OCHA4       ARDMLSVSDNLRRALDAIPADALAT-DASLKSLADGVEMTERAMLQALE-RHGVKKLEPE
GRPE_BARQU       ARDMLSVSDNLNRALEAIPEGAKEN-DAGLKTLAEGVEMTERAMIAALE-RHGVQKIYPE
GRPE_BARHE       ARDMLSVSDNLNRALDAIPEGAKEN-DAGLKTLAEGVEMTERAMIAALE-RHGVQKIHPE
GRPE_RHIRD       ARDMLAVSDNLRRALEAIPDELKTNGEAGLNGLIEGVEMTERSMLSTLE-RHGVKKIDAE
GRPE_RHIME       ARDMLAVSDNLRRALDAIPADAREAGDAGLKALIEGVEMTERSMLAALE-RHGVKQLDPT
GRPE_RHIL3       ARDMLAVSDNLRRALDAISPETKATADAGLSTLIEGVEMTERAMLSALE-RHGVRKLEPV
GRPE_RHILO       ARDMLSVSDNLRRALDAIPAEAKASGDAGFKALIEGVDLTERAMLSALE-RHGVKKLAPE
GRPE_RHOPS       ARDVLEIADNLQRALDAVPAEARANADAGLKGLIEGVELTERSLINALE-KNGVKKFDPQ
GRPE_RHOPA       ARDVLDIADNLQRALDAVPADARANAEPGLKALIEGVELTERSLLNALE-KNGVKKFDPK
GRPE_BRASO       ARDVLDIADNLQRALDAVPAETRANADAGLKSLIEGVELTERSLLNTLE-KNGVKKFDPT
GRPE_RHOP5       ARDVLEIADNLQRALDAVPAEARANAEPGLKALIDGVELTERSLINALE-KNGVKKFDPS
GRPE_BRADU       ARDVLDIADNLQRALDAVPAEARAAADPGLTSLIEGVELTERSLLNALE-KHGVKKFDPQ
GRPE_RHOS4       ARDLLPVYDNLSRALEVATDEQRAA----AAALIEGVELTLRELRNVMN-KHGVRPITPQ
GRPE_RICTY       AKELLNVSDNLSRALAHKPSN----ADVEVTNIISGVQMTKDELDKIFH-KHHIEEIKPE
GRPE_RICCN       AKELLNVSDNLSRALAHKPAN----SDVEVTNIIAGVQMTKDELDKVFH-KHHIEEIKPE
GRPE_RICB8       AKELLNVSDNLSRALEHKPLD----ASVEVTNIIAGVQMTKDELDKVFH-KHHIEEIKPE
GRPE_CAUVC       ARDLLGAADNLGRATAHSPKDS---TDPAVKNFIIGVEMTEKELQSAFE-RNGLKKIDPA
GRPE_WOLSU       AKDLLPIVDTLEIALKSANEVSGEES-ELQAKFKEGLELTLDNFSKVLQ-RHGIEMIACE
GRPE_HELHP       MNDLLPVLDTLEKALESAQ--SNPE----AGAIAQGLQLTLEGFLKVLS-KHGVEVIATD
GRPE_HELAH       ALDLLPVIDALLGAHKSAS--GDDK----ESALTKGLELTMEKLHEVLA-RHGIEGIECL
GRPE_NITSB       AQDLLPALDSLDMALAAVSHDNLNAE-EAVKELKKGIELTIDQFIKAFN-KNGIEVIEIE
GRPE_ARCB4       AKDLLTPLDTLEMALNSAK-ADVDAN-ELLEKLKEGIELTLKNFITTFE-KHNITKVETD
GRPE_CAMC5       ARDLLPVIDALEIAANFDPDDD-----EFAKNVKEGVLITINQFKKCFE-KHGMSEIDTS
GRPE_CAMFF       ARDLLPVIDALEIASNLQSGDD-----EIANKIKDGINLTIEQFKKCFE-KYGIKEIRTD
GRPE_CAMJR       AKDLLDVLDALEAAVNVEC-QD-----EISLKIKEGVQNTLDLFLKKLE-KHGVALIKDE
GRPE_SULNB       AKDILAVLDSFENALSAIEGANKENAAEVLEKMQEGVKLTYEQLKKVLE-KNSIKEIESK
GRPE_PARTM       VSDLLPVLDNFERALKIKAE------DEQAKSILQGMEMVYRSVLDALK-KEGVEAIEAV
GRPE_GEOSE       VSDLLPALDNFERALKIETE------NEQAKSILQGMEMVYRSVLDALK-KEGVEAIEAV
GRPE_GEOKA       ASDLLPVLDNFERALKIETD------NEQAKSILQGMEMVYRSLVDALK-KEGVEAIEAV
GRPE_GEOTN       ASDLLPVLDNFERALKIETE------NEQAKSILQGVEMVYRSLLDALR-KEGVEVIEAV
GRPE_BACVZ       VTEILPALDNFERALQVEAE------SEQTKSLLQGMEMVRRQLMDALE-KEGVEAIEAV
GRPE_BACSU       VTDLLPALDSFERALQVEAD------NEQTKSLLQGMEMVHRQLVEALK-KEGVEAIEAV
GRPE_BACP2       VSDLLPALDNFERALGIDPD------NEQAKSLLEGMQMVYRQLVEALK-NEGVEPIEAV
GRPE_BACLD       ISDLLPALDNFERALQIDPD------NEQTKSLLQGMEMVHRQILEALK-NEGVEQIPSV
GRPE_BACCN       VSDILPALDNFERAMQVEAS------DEQTKSLLQGMEMVYRQLLEALN-KEGVEMIEAV
GRPE_BACHD       IEELLPALDNFERALLVEPE------QEETKTLLKGMEMVYRQVSEALK-KEGLEVIETK
GRPE_BACSK       IEKLLPALDNFERALLVEPK------HEEAKQLLQGMEMVYRQVEEALK-QEGVEPIPTE
GRPE_LISIN       AQDLLPALDSFEKALATTSD------QEEVKQILKGMEMVYNQILVAFE-KEGIEVIPAV
GRPE_LYSSH       LSDLLPVLDNFERALQVETT------SEETASIIKGIEMVYRSLLEATV-FEGLQVIKAE
GRPE_OCEIH       ITELLPAIDNFERALQVEVT------EE-NKSIIDGIMMVYRQLQEALT-SQGVEPIKTE
GRPE_STAAB       LTDILPAIDNIERALQIEGD------DETFKSLQKGVQMVHESLINALK-DNGLEVIKTE
GRPE_STAHJ       LTDILPTIDNIERALQIEGD------DESFKSLQKGVQMVHESLLRALK-DNGLEEIESE
GRPE_STAEQ       LTDILPSIDNIERALQIEGD------DESFKSLQKGVQMVHESLLRALK-DNGLEEILAE
GRPE_STAS1       LNDILPTIDNIERALQIDGE------DEQFKSLKKGVEMVHESLLNALK-NNGLEKIETE
GRPE_LACJO       AKEVLPAMDNLERALAVKAD------DEAAKQLQKGVQMTLDSLVKSMK-DQGITEIKAE
GRPE_LACAC       AKDVLPAMDNLERALSVEAD------DDVSKQLKKGVQMTLDALVKAMK-DHGVVEIEAD
GRPE_LACDB       GKDILSSVDNLERALQVKAD------DEASRQLKKGIEMTLEGLVRALK-DNGIEEIKAD
GRPE_LACPL       AKDVLPVLDNLERALATPAD------DEAAQQLKKGVEMVYGHLQDALK-KHGVTEVAAA
GRPE_LACSN       AKEVVPVMDDLKRALQVQVD------NDSGQQLKTGIEMVYKHLEKALN-DNDIKEIDAD
GRPE_LACSK       AKDVLPVLDNLERALAAEAT------DES---LKKGVQMTYDHMKHALE-DHGVKEIEAQ
GRPE_PEDPA       AKAILPALDNLERALAVESA------SEQ---LLKGVKMVQTDLLKALK-ENHVAEIEAE
GRPE_STRGC       AKAILPSLDNLERALAVEG---------LTDDVKKGLEMVQESLVHALK-EEGIEEIPAD
GRPE_STRPN       AKAILPSLDNLERALAVEG---------LTDDVKKGLGMVQESLIHALK-EEGIEEIAAD
GRPE_STRTD       AKAILPSLDNIERALAVEG---------LTDDVKKGLEMIQESLINGLK-EEGIEEIAAD
GRPE_STRA1       AKAILPSLDNLERALAVEG---------LTDDVKKGLEMTRDSLIQALK-EEGVEEVEVD
GRPE_STRMU       AKAILPSLDNLERALAVEG---------LTDDVKKGLEMVQESLIQALK-EEGVEEVELE
GRPE_STRS2       AKKILPSLDNLERALQVEG---------LTEDVKKGLEMVQESLIQALK-EEGVEEVATD
GRPE_LACLA       AKKILSSLDNLERALAVEG---------LTDDVKKGLEMVQESLISALK-EEGVEEVSYE
GRPE_TETHA       GKKLLPAIDNLERAVAIEVE------GEQNESLKKGVEMTLESLRSAMQ-EEGIEEISAQ
GRPE_ENTFA       GKKILPSIDNLERAMAIEVS------DEQGESLKKGISMVLESITVALK-EEGIEEIPAM
GRPE_LEUMM       ASAVLPAVDNLERALQVEAN------DEVSKQIKTGVEMTLKTLNQALT-DNGITSTGEI
GRPE_OENOB       AKSILPALDNLERALSVSAG------DPASKKIQDGVELTYKSLSNALT-DNGIVKIGRA
GRPE_GEOUR       ILEILPAIDNMERALEHAC-------DESMSAIVEGIKMTLCMLQSTLK-KFGVAPVDAG
GRPE_GEOSL       LQDILPVVDSMERALGHAD-------SESLSAVIEGIRMTHGMLLGTLK-KFGVVAVEAE
GRPE_PELPD       LEEILPVVDNLERALSHAN-------ENGSTGLTEGVQMIHGLLLNAMK-KFGVTPLETS
GRPE_MYXXD       LKDLLPVMDNLDRAIDAAAK------SPDLDSFEKGVAMTRKSFEDALG-RHGVKGFSAK
GRPE_DESVH       LADLLPTLDNLDLALQYGQG------SAECRNMLVGVEMTRKLLLEALG-RHGLEAVGEA
GRPE_STRCO       LSELLPVLDDVGRAREHGEL------------VGG-FKSVAESLETTVA-KLGLQQFG-K
GRPE1_STRAW      LTELLPTLDDIGRAREHGEL------------VGG-FKSVAESLETVAA-KMGLQQFG-K
GRPE_CUTAK       ITDLMPVLDSIAMARQHGEV------------EGG-FKLVVDELEKVAN-NHGLTSFG-E
GRPE_MYCTU       VSQLLGVLDDLERARKHGDL------------ESGPLKSVADKLDSALT-GLGLVAFG-A
GRPE_MYCPA       VNQLLGVLDDLERARKHGDL------------ESGPLKSVADKLESALT-GLGLTAFG-E
GRPE_MYCLE       ISQLLGVLDDFDRAREHGDL------------DSGPLKSVADKLMSALT-GLGLVAFG-V
GRPE_CORGL       VTQLLPLLDDLDLAEQHGDL------------NEGPLKSLSDKLINILG-GLKVESFG-E
GRPE_COREF       VSKLLPILDDLDLAEQHGDL------------EEGPLKAFADKFRNTLT-GLKVEAFG-V
GRPE_CORDI       LGELLPILDDLELAQKHGDL------------DEGPLKAFRDKLVSVVE-GLGVSAFG-A
GRPE_BIFAA       LTALLPALDDIDRIREHSEM-------------DDSFKAVANKIDKAFE-KFGVEKFG-E
GRPE_BIFLO       LTALLPALDDIDRIREHSEM-------------DDSFKAVATKIDKAFE-KFGVEKFG-E
GRPE_TROWT       IRVILPVLDDFARIEKHSTL-------------DDPFKAVVTKLRSAME-KIGLTAFG-N
GRPE_LEIXX       VKGLIPVLDDLERADTHGDLI-----------EGSAFATIAAKLRASVE-RLGLLPYG-E
GRPE_THET2       LRALLPVLDDLDRALEFAEASP--------ESIRQGVRAIRDGFFRILA-GLGVEEVP-G
GRPE_MEIRU       VRALLGTLDDLERALGFASVKP--------EDLIPGVRSVLENFTRSLK-SLGVEAVP-G
GRPE_DEIRA       AEALMPVYDDIDRALSLSVDDA--------AKLVPGMQAVQNKVLTIFG-TLGLEATG-R
GRPE_HALMT       VERVVTVRDNLVRALDQDE----------DADIRDGIESTLKEFDRILE-DENVEIIDPE
GRPE_HALSA       VERLLDVRDNLDRALDQEESESD------EDGIREGVELTRDEFDRVLE-TEGVTEIRPE
GRPE_NATPD       VEKLLEVRDNLNRALEQDA----------DADIREGVEATFRQLDDILD-GEGVEAIEPD
GRPE_RUBXD       VAELLPVLDNLDRALEAEGDI------------REGVRATRDQLTDVLS-REGLTPIA-S
GRPE_METTP       IKKLLVFLDSLEQAAKHD----------------EGAKALYDQLLDIMR-SEGLEPID-A
GRPE_THEAC       LKDFLPVLDSIDAAIQAEK--------------DNNLIRIRDQMLGVLS-RYGLKPIK-A
GRPE_THEVO       IKDFLPVIDSMDAAIQAEK--------------DNNLIRIRDQMLSILS-KYGLQPIK-A
GRPE_PICTO       IKTMLPVLDSLDAGILH----------------DEKLKPIRSQLIKILS-NYGLKEIE-S
GRPE_TREDE       LLDLVQVLDDFDRAIDAGKTQGG-ESV--NNAFVEGVVMIKNQMVSMLSSKYGLSYYP-A
GRPE_TREPA       LADIVAVLDDFDRAIEAADHASS-TEVEASSAFREGVLMIRKQLSSVLETKYGLEYYP-V
GRPE_SYNPX       LSEILPVVDNFERARQQLNPE-----SEEAQALHRSYQGLYKQLVDVLK-QQGVARME-V
GRPE_SYNS9       LTEILPVVDNFERARQQLNPE-----GEEAQALHRSYQGLYKQLVDVLK-QQGVARME-V
GRPE_PROMM       LSEILPVVDNFERARQQLEPQ-----GEEAQALHRSYQGLYKQLVDVLK-QMGVASMR-V
GRPE_PROM1       LSEILPIVDNFERARQQLNPE-----GEEAQALHRSYQGLYKQLVEVLK-NLGVAPMR-V
GRPE_PROMA       LSEILPVVDNFERARQQINPE-----GEEALTIHRNYQNLYKQLVDVLK-KLGVAPMR-V
GRPE_PROMS       LTAILPIVDNFERARQQLKPE-----SEEAQSLHRSYQGLYKQLVEVLK-QQGVSPMR-V
GRPE_PROM9       LTAILPIVDNFERARQQLKPE-----SEEAQALHRSYQGLYKQLVEVLK-QQGVSPMR-V
GRPE_PROM5       LTAILPIVDNFERARQQLKPE-----GDEAQTLHRSYQGLYKQLVEVLK-QQGVAPMR-V
GRPE_PROMP       LTAILPIVDNFERARQQLKPE-----SEEAQTLHRSYQGLYKQLVEVLK-QQGVSPMR-V
GRPE_NOSS1       ILELLPIVDNFERARSHLKPQ-----TESEMTIHKSYQGVYKQLVDSLK-RLGVSPMR-P
GRPE_SYNE7       ITELLPVIDNFDRARAQIKPQ-----GEEAEAIHKSYQGLYKQLVDCLK-RIGVSPMR-A
GRPE_TRIEI       IMELLPVIDNFERARSHIKPA-----NDGEMAIHKSYQSVYKQMVDSLK-RLGVSVMR-P
GRPE_THEEB       IADLLPVVDSFELARTHIQTE-----TEAEEKIHRSYQGVYKQLVECLK-RIGVSAMQ-A
GRPE_SYNY3       ITELLPVVDNFERARTQIKPN-----SDGENQIHKSYQGVYKNLVDSLK-GLGVAPMR-P
GRPE_GLOVI       LKDILPVFDNFDRARAFAQPD-----NEREEKLHNSYQQVYRQFLSVLE-KMGVTAME-A
GRPE_SYNJB       VLEILPVVDSFERAQQQLKLE-----TDRERELHNSYQSVYRLLVECLK-KMGVSRMK-S
GRPE_SYNJA       VLEILPVVDSFERAQQQLKLE-----TDREREVHNSYQSVYRLLVECLK-KMGVSRMK-S
GRPE_BACFR       IKSILPVIDDMERALTTMET------ATDVNAVKEGVELIYNKFLSILS-QDGVKVIE-T
GRPE_BACTN       ISSILPVIDDFERAIKTMET------AKDVKAVKEGVELIYNKFMAVMA-QNGVKVIE-T
GRPE_PORGI       LVDLLPVIDDFERALSNLGD------MSEPAAIKEGVELIYSKFMDYLQ-KQGVKKIE-T
GRPE_CHLPM       LRELLPVLDDVERVLANAPEPEA-I-PVAAKPFIEGVELMKKNLDRWLE-EKGVKPIE-A
GRPE_PELLD       LRDLLTLVDDVERVLANVPEPEE-I-PAAAKPYIDGVELLKKNLDRWLE-SKGVKPIE-A
GRPE_CHLTE       VRELLPLIDDLKRLMSHIPAEMQ-A-MAEAKPFIEGVELIHKNFMSLLE-RKGVKEIE-A
GRPE_CHLAB       LIDFLVPIESMEKALGFASQM-----SDEVKNWALGFNMILQQFKQVFE-EKGIVEYSSV
GRPE_CHLPN       LIDFLNPIESMEKALGFATQM-----SDDVKNWALGFNMILNQFKQIFE-EKGIIEYSSI
GRPE_CHLMU       LLDFLPPMESMEKALGFASQT-----SDEVKNWAIGFQMILQQFKQVFE-DKGVVEYSSK
GRPE_PARUW       VVDFLKPLDNLENALKFAQGM-----SDEVKNWAFGFQMILTQFKDVLA-SNGITALESQ
GRPE_LEPIC       VSGFLNPIDNLERVGATQTN------SEELKPFVDGVTMILKEFYSVLE-KSNVIRFDPK
GRPE_LEPBJ       VSGFLNPIDNLERVGATQSP------SEELKPFVEGVAMILKEFYAVLE-KSNVIRFDPK
GRPE_BDEBA       VRDLLEVVDNFDRALSVNVS------AENFNTFKQGVDMTAQELKSLLQ-RHNVIEIPAH
GRPE1_BUCAP      IIEFLPIIDNIERALSVIK----DKKEAFYLEIINKMNFIFSLLEEILS-EFNVSKINEK
GRPE1_BUCAI      IIDFLPIIDNIERALNLIETI--NLKQEKYTEILKKLQFICNLLEKFFY-LFNIKKINDT
GRPE_WIGBR       SIALLPIIDNLERTKNLLEKE--NEKNKNINPIEEGINLTLKEFIKVIH-SFGIKEIDKK
GRPE2_BUCAI      LKSIIPVIDSLEDIL-NLSTT--VDIKD--QPIIKGIELTLESLLNILN-KLGVKIEGQK
GRPE2_BUCAP      FKQIIPIINNLEDIL-TISTK--LNLND--EPSIQGIELTLKSLLSILI-KFGVKIEGKK
GRPE2_BUCBP      FRNLIPIIDSLKNIRKDINKY--NNIKD--NNMIQGIPLILKSLLTVTE-KFGLKINNKK
GRPE_MYCMS       AKDLIQPLEILKKVVNAPNNN------EVVQAYVKGFEMIINQINNVLE-SHHIKAMNVK
GRPE_MYCCT       ARDLIQPLEILKKVVNAPNNN------EVVQAYVKGFEMIVSQINNVLE-SHHIKAMNVK
GRPE_MESFL       AEDLIKPIDLLKKVVETPTDI------PELQNYLMGFKMIISQIENAFE-TNGIKAMGVK
GRPE_MYCGE       LDQPLNIIDQFEIALSYAQKD------PQVKNYTTGFTMVLDAFSRWLE-ANGVTKIKIE
GRPE_MYCPN       IDQPLIIIDQFEIALSYAQKD------PQVKNYTTGFNMVLDAFSRWLE-GFGVTKIAIE
GRPE_MYCGA       IDSAINIVDQLEIALEFASLD------PAVKNYVSGFKMVLNSFVNWLA-SVNIHRMDIK
GRPE1_BUCBP      ISSLFPVIDSMEYALNLFKKD-----DKILCLIFNELDNVSQSLMNLLV-KFGVTSIKDI
GRPE_RHOBA       VTDILQVRDNLLRAIEAATTAG---DGESAAGLVEGVSMVRKQLDDVLA-KHAIKEIPAE
GRPE2_STRAW      AAAFLPVLDNLELALTHAGA--------DPGAIVEGIRAVRDQAVNVLE-LLGYPRHAET
GRPE_MYCPE       AIELIDIVSNFELAVNSKVTN------PEIANYLKGFQMFANMFKNYFQ-QNGITEIPVN
GRPE_UREP2       MEPLLDAINHFTKIVNQNYDD------PKIQAFIEGFKMFSQNMIDGLD-NLKITKISPQ
GRPE_MYCMO       FENIINPLNNFRLAIDAGSKQE----NSSIKSYVQGFEMLLNQTINILE-SYGLIIIRPE
                     .   . .                                                 

GRPE_ONYPE       -NKPFDPALHHALETVCDPKKPDKT---NLAVLQKGYLYKKR----ILRPTLVKVNEWSD
GRPE_AYWBP       -NKPFDPTFHHALETVCDFEKPDKT---NLAVLQKGYLYKKR----ILRPTLVKVNEWSD
GRPE_ACHLA       -GEVFDAKVHHAIEKESNKDKPNGT---VLEVLQNGYLFKDR----ILRPAMVKINEWSE
GRPE_PEWBP       -GVKFDPNFHYALEKISDLKQPNGI---NVLVLQKGFLYKDL----VIKPAMVKVNEWSD
GRPE_WOLTR       -GELFDSNLHQAVVEREDNEKKTGT---IVEVLQTGYTIKNR----LLRPAMVIISKK--
GRPE_WOLPM       -GELFDSNLHQAVVEREDNEKEPGT---IVEVLQTGYTIKNR----LLRPAMVILSKKSA
GRPE_EHRCJ       -GEKFNPQFHKAVSQMTDEDKDENT---ILHVVQPGYIIKDK----LLRPASVIISKKS-
GRPE_FUSNN       -GA-FNPEYHHAVGVETSEDKKEDE---IVKVLQKGYMMKGK----VIRPAMVIVCKK--
GRPE_FUSNP       -GV-YDPVYHHAVGVEANEDFKEDE---IVKVLQKGYMMKGK----VIRPAMVIVCKK--
GRPE_BORBP       -GENFDPSRHEAISIEEKEDLKNPE---IVEVYQKGYCYNDR----ILRTAKVKVAQSKN
GRPE_METS3       -GEKFDPFKHEALMVANDENVENGY---IIDELMKGYTLKGK----VIKYSKVRVCKK--
GRPE_METTH       -GEKFDPFLHEAVMVEDHDGYEDGI---IIEELSRGYRLNDR----IIKHSIVKVCKKS-
GRPE_METST       -NQKFDPYKHEALMTEDNDDYENNE---IIQDLQKGYTLNSK----VIRYSKVKVCKK--
GRPE_CALS4       -GQMFDPYKHHALAQEEVEGKQPNE---IIEVFQKGYYLKDK----VIRPSLVKVAK---
GRPE_CLOD6       -SKEFDPNLHLAVMQESVDGVEANQ---IVMVLQKGYKLGTK----VVRPSMVKVSC---
GRPE_ALKOO       -EKPFDMNLHYAVMQEESEG-ASNY---VIDVLQKGYKIKDR----ILRPAMVKVSK---
GRPE_CLOAB       -G-KFDPNLHNAVMHIEDEGYGENE---VVEVLQKGYKRGDK----VLRHSMVKVAN---
GRPE_CLOTE       -N-GFDPNLHDAVMHVEDSQYGEKE---VVEVFLKGYKKGDK----IIRHSMVKVAN---
GRPE_CLOB8       -G-EFDPNLHNAVMHIEDEELGKNV---VAEVFQKGYKKDDK----IIRHTMVKVAN---
GRPE_CLOPS       -N-GFDPELHQAMMVVEQEGSEPNQ---VAQVFQKGYKRGDK----VIRHSMVTVTK---
GRPE_LACP7       -GKEFDPDFHNAVMHAEDEEYGENI---VAEEFQKGYMYRET----VVRHSMVKVVN---
GRPE_METMA       -AGEFDPHRHEAIHHIETSEVPDNT---IVEIYKEGYALNEK----VVRPALVSVARSPE
GRPE_METAC       -AGEFDPHRHEAVQHIETSEVPDNT---IVDVYKPGYSLNEK----VIRPALVSVARNPD
GRPE_METBF       -ASEFDPHRHEAVHHIETSEVPDNT---IVDVYKTGYALNSK----VIRPAMVSVARNPD
GRPE_AQUAE       -GKEFDPYVAEAVEKVETDQYPPNT---VVKVIRKGYYIHDK----VLRPARVAVAVPPQ
GRPE_THEMA       --EKFDPFEHEAVERVETEDVEEYT---ILEVVESGYKFHGK----VLKPAKVKVAVKPR
GRPE_PSELT       --EKFDPFEHEAVERVETDEKEEYS---ILKILENGYKFHKK----IVKPVKVQVAVRPR
GRPE_VIBHA       -GEAFNPEFHQAMSIQESPDHESNT---VMFVMQKGYELNGR----VVRPAMVMVAK---
GRPE_VIBVU       -GQPFNPEWHQAMSIQESPDHESNT---VMFVMQKAMN----------------------
GRPE_VIBPR       -GEAFNPELHQAMSIQESADHESNT---VMFVMQKGYELNGR----VIRPAMVMVAK---
GRPE_VIBC3       -GEVFNPEFHQAMSIQESAEHEPNT---VMFVMQKGYELNGR----VLRPAMVMVSK---
GRPE_PHOPR       -GEVFNPEFHQAMSIQESADHEPNT---VMLVMQKGYELNGR----IIRPAMVMVSKAAA
GRPE_ALIF1       -GEAFNPELHQAIGMQASPDHESNT---VMIVMQKGYTLNDQ----VLRPAMVMVAQ---
GRPE_SHELP       -GEAFNPDHHQAIGMQPSEEFPANT---VMMVMQKGYMLNER----LLRPAMVMVSQGG-
GRPE_SHESH       -GETFNPEHHQAIGMQPSPDFPANT---VMMVMQKGYILNER----LLRPAMVMVSQGG-
GRPE_SHEFN       -GQAFNPEHHQAIGMQPSAEYPANT---VMMVMQKGYLLNDR----LLRPAMVMVSQGG-
GRPE_SHEON       -GQAFNPDQHQAIGMQPSAEFPTNT---VMLVMQKGYELNSR----LLRPAMVMVSQGGP
GRPE_PSET1       -GEQFNPEFHQAMSIQPSNDVSPNT---VLAVMQKGYTLNGR----LLRPAMVMVSKAAD
GRPE_PSYIN       -DEAFDPEKHQAMSMRAVPDVAPNQ---VIAVMQKGYELNGR----VIRPAMVMVSKAED
GRPE_COLP3       -DQPFNPELHQAMSMQEVPGVAPNT---VIAVMQKGYELNGR----LIRPAMVMVSKAAP
GRPE_PSEP1       -GQPFNPEHHQAMAMQENAEVEPNS---VLNVFQKGYLLNGR----LLRPAMVVVSKAPS
GRPE_PSEPG       -GQPFNPEHHQAMAMQENAEVEPNS---VLNVFQKGYLLNGR----LLRPAMVVVSKAPA
GRPE_PSEE4       -GEPFNAEHHQAMAMQESADVEPNS---VLKVFQKGYLLNGR----LLRPAMVVVSKSPA
GRPE_PSEMY       -GEPFNPEHHQAMAMEESTHVEPNS---VLKVFQKGYLLNGR----LLRPAMVVVSKAPT
GRPE_PSEU5       -GEPFNPEHHQAMAMEESTHVEPGS---VLKVFQKGYLLNGR----LLRPAMVVVSKAPA
GRPE_PSEAE       -GEPFNPEQHQAMAMQESASAEPGS---VLKVFQKGYLLNGR----LLRPAMVVVSKAPA
GRPE_PSEPF       EGEPFNAVEHQAMAMQESADLEPNS---ILKVFQKGYQLNGR----LLRPAMVVVSKAPA
GRPE_PSE14       -GQPFSADQHQAMAMQESADVEPNT---VLKVFQKGYQLNGR----LLRPAMVVVSKAPS
GRPE_CHRSD       -GEPFDPQVHEAMTMVPNPEVEPNT---VIEVMQKGYLLNGR----LVRPAMVVVSQAAN
GRPE_ALCBS       -DEPFNPELHEAMTMVPVPNVDPNS---VIEVLEKGYQLNGR----LIRPARVVVSKAP-
GRPE_YERE8       -NVPFNPEVHQAMTMLESADHEPNH---VMMVMQKGYTLNGR----LLRPAMVAVSKAKA
GRPE_SERP5       -NVPFNPEVHQAMSLMESADHQPNH---VMMVMQKGYTLNGR----LLRPAMVAVSKAKA
GRPE_PECAS       -GVPFNPEVHQAMTMLPSADHQPNH---VMMVMQKGYTLNGR----LLRPAMVAVSKAQD
GRPE_SODGM       -HVPFNPEVHQAMTMLESDEHEPNQ---VMMVMQKGYTLNGR----LIRPAMVAVSKAKS
GRPE_PHOLL       -NVPFNPEIHQAMTMMESDQHEPNH---VMMVMQKGYTLNGR----LLRPAMVAVSK---
GRPE_ECOLI       -NVPLDPNVHQAIAMVESDDVAPGN---VLGIMQKGYTLNGR----TIRAAMVTVAKAKA
GRPE_ENT38       -NVALDPNVHQAIAMVESEDVAAGN---VLAVMQKGYTLNGR----TIRAAMVTVAKAKG
GRPE_KLEP7       -NVPLDPNVHQAIAMVESEDVAAGN---VLAVMQKGYTLNGR----TIRAAMVTVAKAK-
GRPE_CROS8       -NVPLDPNVHQAIAMVESEDVAPNH---VLAVMQKGYTLNGR----TIRAAMVTVAKAKA
GRPE_BAUCH       -HVPFNPDIHQAMTILESEEHEPNH---VIIVMQKGYLLNGR----LIRPAMVTVSKTKS
GRPE_BLOFL       -HIPFNPEIHQAISTMESEKYESNQ---VLTIVQKGYSLNGR----LVRPAMVIVAKSKS
GRPE_PASMU       -GETFNPEVHQAISMQPMEGFETNQ---ITVVLQKGYLLNGR----VIRPAMVMVAA---
GRPE_ACTSZ       -GESFNPEFHQAISMQPTEGFETNQ---ITTVLQKGYLLNSR----VIRPAMVMVAA---
GRPE_HAEIN       -GEAFNPDLHQAISMQPAEGFETNQ---ISVVLQKGYTLNGR----VIRPAMVMVAA---
GRPE_HAES1       -GETFNPELHQAISMQPTEGFESNQ---ITVVLQKGYLLNGR----VIRPAMVMVAQ---
GRPE_HAEDU       -GDVFNPELHQAISMQPAENIEANH---LSQVLQKGYTLQGR----VIRPAMVMVAA---
GRPE_ACTP2       -GEAFNPEVHEAISMQPAEGIEANH---ISVVLQKGYTLQGR----VLRPAMVMVAG---
GRPE_PSYS1       -GEKFNADLHEAVDIDAEAEA--DT---VGTVLQKGYSLNGR----LLRPAMVRVGQ---
GRPE_ACIAD       --NGFNAELHQAVGIDPNAKS--GE---IGNVLQKGYTLSGR----LLRPAMVTVGQ---
GRPE_XANOM       VGQPFNPDQHQAISQGEAEGIAPGH---VVQVFQKGYLLNDR----LLRPALVVVAKQD-
GRPE_XYLFT       VGQLFNPEHHQAISQTEVTDVEPGH---VIQVFQKGYLLNER----LLRPALVVVAKQD-
GRPE_ALKEH       QGERFNPEHHEAVAAQPSHEHEPNT---VLNVMQKGYALHDR----VLRPAMVVVSQKAP
GRPE_HALHL       QGERFNPDYHEAMAAQPSDEQEPNT---VLQVVQKGYRLQDR----LLRPALVVVAKKGD
GRPE_HYDCU       TGEKFDPQLHEAMTMIPSPDHDSQM---VIEVFQKGYVLNDR----LVRPARVVVAE---
GRPE_BURTA       VGEKFDPHLHQAISMVPA-DQEPNT---VVAVLQKGYTIADR----VLRPALVTVAQPK-
GRPE_BURL3       VGEKFDPHQHQAISMVPA-EQEPNT---VVTVLQKGYTIADR----VLRPALVTVAQPK-
GRPE_PARXL       VGEKFDPHRHQAISMVPA-DQEPNT---VVAVLQKGFVIADR----VLRPALVTVAAPK-
GRPE_RALSO       VGEKFDPHRHQAISMVPA-DQEANT---VVNVLQRGYTLADR----VLRPALVTVAAPK-
GRPE_POLAQ       VGDKFDPHHHQAIASVPS-EQDPNT---VVSVLQRGYTVADR----VLRPALVTVSAPK-
GRPE_POLNA       AGSKFDPHQHQAISMVPA-AQEANT---VVAVLQKGYLIAER----VLRPALVTVAAPQ-
GRPE_ACIAC       AGEKFDPHQHQAISMVPA-EQEPNT---IVSVLQKGYVIADR----VLRPALVTVAAPK-
GRPE_BORPE       QGDKFDPHLHQAISSVPA-DQPANT---VLQLLQKGYVIADR----TLRPALVVVSAGQG
GRPE_NITEC       QGEKFDPHQHEAMCTVES-DIPPNT---VTQVMQKGYVLHER----VIRPAMVAVSKAKS
GRPE_NITEU       QGEKFDPHQHEAMCAVES-DFAPNT---VIQVMQKGYMLHDR----VIRPAMVTVSKAKG
GRPE_NITMU       QGEKFDPHLHQAMCMVES-ELPHNT---VVQVMQKGYVLNDR----VIRPALVSVSKGKE
GRPE_METFK       VGEKFDPNKHQAIGTVES-EAESNT---VVNVLQKGYTLNDR----VLRPALVMVAK---
GRPE_METSS       LGEKFDPNKHQAISMLES-DQEPNS---VISVLQN------------VRPE---------
GRPE_DECAR       AGEKFDPHKHQAIGMVDS-EQEANT---VVTVLQKGYMIADR----VLRPALVMVAKGK-
GRPE_NEIMB       AGDKLDPNIHQAMQAVAS-EQEPNT---VVGVMKKGYTLSDR----VLRPAMVTVAQKEA
GRPE_CHRVO       LGDKLDPHQHQAMSAEES-DAEPNT---VVRVMQKGYLLADR----VLRPAMVVVAKAKA
GRPE_FRATO       KGEKFDPNLHEAMAMIPNPEFEDNT---IFDVFQKGYMLNGR----IVRAAKVVIVKN--
GRPE_FRAP2       KGEKFDPNLHEAMAMIPNSEFEDNT---IFDVFQKGYMLNGR----VVRAAKVVIVKN--
GRPE_DICNV       VGEKFNPELHEAVTMTPSEAHEPNT---VIQVTQKGYLLNGR----TVRAAQVIVSK---
GRPE_LEGPA       LGQTFDPQQHEAMSMQPAPGAPPNS---VITVFQKGYKLSDR----VIRPARVIVSTK--
GRPE_COXBN       PGDPFDPALHEAMSVQAVPDAKPDT---IIQVLQKGYQLNGR----VLRAARVIVAG---
GRPE_BRUME       -GQKFDPNFHQAMFEVPNPDLPNNT---VVQVVQAGYAIGDR----VLRPAMVGVSKGGP
GRPE_OCHA4       -GEKFDPNFHQAMFEVPNPDLPNNT---VVQVVQDGYAIGDR----VLRPAMVGVSKGGP
GRPE_BARQU       -GQKFDPHFHQAMFEIPNCDVPDNT---VQQVVQAGYIIGER----VLRPAIVGVAKGGT
GRPE_BARHE       -GQKFDPHFHQAMFEIPNSDVPDNT---VQQVVQAGYIIGER----VLRPAIVGVAKGGA
GRPE_RHIRD       -GQKFDPNFHQAMFEVPNTAVPNNT---VLQVIQAGFTIGDR----VLRPAMVGVAKGGP
GRPE_RHIME       -GQKFDPNFHQAMFEVPNTEVPNNT---VVQVVQAGYTIGER----VLRPAMVGVAKGGP
GRPE_RHIL3       -GQKFDPNFHQAMFEVPNPDVPNNT---VVQVVQAGFTIGER----VLRPAMVGVAKGGP
GRPE_RHILO       -GEKFDPNFHQAMFEVPNPDVPANT---VVQVVQPGYSIGER----VLRPAMVGVAKGGP
GRPE_RHOPS       -GEKFDPNFQQAMYEVPDPSVPAGT---VVQVVQAGFMIGER----VLRPALVGVSKGGA
GRPE_RHOPA       -GQKFDPNFQQAMYEVPDPSVPAGT---VVQVVQAGFTIGDR----VLRPALVGVAKGGA
GRPE_BRASO       -GQKFDPNFQQAMYEVPDPSVPSGT---VVQVVQAGFMIGER----VLRPALVGVSKGGA
GRPE_RHOP5       -GQKFDPNFQQAMYEVPDASVPAGT---VVQVVQAGFMLGER----VLRPALVGVSKGGA
GRPE_BRADU       -GQKFDPNFQQAMFEVPDASVPAGT---VVQVMQAGYTIGER----VLRPALVGVAKGGA
GRPE_RHOS4       VGDTFDPQQHQAMFEAPVPGTKAGQ---IIQVMTEGFMIHDR----LLRPAQVGVSSNTG
GRPE_RICTY       IGSMFDYNVHNAISHIEHPDHKPNS---IITLMQSGYKIRDR----LLRPATVQVVKKP-
GRPE_RICCN       IGSMFDYNLHNAIAQIEHPDHAPNS---IITLMQSGYKIRDR----LLRPATVQVVKKP-
GRPE_RICB8       IGSTFDYNLHNAISQIEHPDHEPNS---VINIMQVGYRIKDR----LLRPATVQVTKKT-
GRPE_CAUVC       KGDKFDPHLHQAVTEQPSTEVAAGG---VLMVMQAGYELMGR----LVRPAMVAVAAKGS
GRPE_WOLSU       --GEFDPHLHECIMQVPSPSHQEGE---IVQVFQKGYRYKER----VLRPAMVSIAKSN-
GRPE_HELHP       --GEFDPNLHECLMQVPDANKNDGE---ILQTLQKGFVYKHR----VLRPSMVSVVKN--
GRPE_HELAH       --EEFDPNFHNAIMQVKSEEKENGK---IVQVLQQGYKYKGR----VLRPAMVSIAKND-
GRPE_NITSB       EGGEFNPHLHEAILQVDDAEKKAGQ---IVQVIQKGYKYKER----ILRPAKVSVAKGNE
GRPE_ARCB4       --GEFDPNVHNAVMQVDSAEHNSGQ---IVQELQKGYVLKDR----LLRPSMVSIAN---
GRPE_CAMC5       --GEFDPNVHNAVLRVDSEDHTSGQ---IVQVMQKGYIINGR----VLRPAMVSVAN---
GRPE_CAMFF       --AEFNPEFHNAINYIESDEVESGK---IAAVYQKGYLYNDR----VLRPSMVVIAK---
GRPE_CAMJR       --KEFDPNLHEAMFHVDSENHQSGE---VVQVLQKGYKIADR----VIRPTKVSVAK---
GRPE_SULNB       --GTFNPEVHQAIMQVDSDEHKTDD---IVQVMQKGYTIKDR----VLRPAMVSTAK---
GRPE_PARTM       -GKPFDPHLHQAVMQVEDSNYEPNT---VVEELQKGYKLKDR----VIRPAMVKVSQ---
GRPE_GEOSE       -GKPFDPHLHQAVMQVEDSNYEPNT---VVEEFQKGYKLKDR----VIRPAMVKVSQ---
GRPE_GEOKA       -GKPFDPYLHQAVMQAEAEGYEPNT---VVEELQKGYKLKDR----VLRPAMVKVSQ---
GRPE_GEOTN       -GKPFDPHLHQAVMQTDEGGYEPNT---VVEELQKGYKLKDR----ILRPAMVKVSQ---
GRPE_BACVZ       -GQEFDPNLHQAVMQVEDENFGSNI---VIEELQKGYKLKDR----VIRPSMVKVNQ---
GRPE_BACSU       -GQEFDPNLHQAVMQAEDENYGSNI---VVEEMQKGYKLKDR----VIRPSMVKVNQ---
GRPE_BACP2       -GKEFDPNLHQAVMQVEDENFDSNI---VVEELQKGYKLKDR----VIRPSMVKVNQ---
GRPE_BACLD       -GEQFDPNMHQAVMQVEDEAYESNA---VVEELQKGYKLKDR----VIRPSMVKVNQ---
GRPE_BACCN       -GKQFDPHEHQAVMQVEDSEFESNA---VVEEFQKGYKLKDR----VIRPSMVKVNQ---
GRPE_BACHD       -GETFDPHLHQAVMQVEDAEFESNE---IVEELQKGYKLKDR----VIRPSMVKVNA---
GRPE_BACSK       -GELFDPHLHQAVMQVSEEGYEPNQ---IVEELQKGYKLKDR----VIRHSMVKVNQ---
GRPE_LISIN       -GEQFDPNFHQAVMQDSDENAGSNE---ITAELQKGYKLKDR----VIRPSMVKVNQ---
GRPE_LYSSH       -GEQFDPNIHQAVMQEQDSEKETGV---VLRELQKGYILKDR----VLRPTMVSVNE---
GRPE_OCEIH       -GEVFDPNLHHAVMQIEDENMDSNT---VVEELQKGYQLKDR----VIRPAMVKVNK---
GRPE_STAAB       -GEAFDPNIHQAVVQDDNPDFESGE---ITQELQKGYKLKDR----VLRPSMVKVNQ---
GRPE_STAHJ       -GQAFDPNFHQAVVQDDNPDFKSGD---ITQELQKGYKLKDR----VLRPSMVKVNQ---
GRPE_STAEQ       -GKEFDPNLHQAVVQDDNPDFKSGE---VTQELQKGYKLKDR----VLRPSMVKVNQ---
GRPE_STAS1       -GQQFDPNVHQAVVQDDNPDFESGQ---ITQELQSGYKLKER----VLRPSMVKVNQ---
GRPE_LACJO       -GETFDPSLHQAVQTVAAENDERKD--RVVKVLQKGYQYKDR----TLRPAMVVVAQ---
GRPE_LACAC       -GVKFDPTLHQAVQTVAAENDDQKD--HVVQVLQKGYQYKDR----TLRPAMVVVAQ---
GRPE_LACDB       -GEKFDPTLHQAVQSVPAENDDQKG--HVVQVLQKGYVYKDR----TLRPAMVVVAQ---
GRPE_LACPL       -GEKFDPNIHQAVQTVPVDDDHPAD--TVVQVLQRGYLLKDR----TLRPAMVVVAQ---
GRPE_LACSN       -GVAFDPELHQAVQTVPADDDHPAD--TVVQVLQSGYKLADR----VLRPAMVVVAQ---
GRPE_LACSK       -GQAFDPTIHQAVQTVAVDGDQKAD--TVVQVFQKGYYLKDR----VLRPAMVVVAQ---
GRPE_PEDPA       -GQAFDPNMHQAVQTVPADDDHPAD--TVVQVLQKGYILKDR----VLRPAMVIVAQ---
GRPE_STRGC       -G-EFDHNYHMAIQTVPADDEHPAD--TIAQVFQKGYKLHDR----ILRPAMVVVYN---
GRPE_STRPN       -G-EFDHNYHMAIQTLPADDEHPVD--TIAQVFQKGYKLHDR----ILRPAMVVVYN---
GRPE_STRTD       -G-EFDHNFHMAIQTMPADDEHPAD--TIAQVFQKGYKLHDR----ILRPAMVVVYKEN-
GRPE_STRA1       ---SFDHNFHMAVQTLPADDEHPAD--SIAEVFQKGYKLHER----LLRPAMVVVYN---
GRPE_STRMU       ---NFDPNLHMAVQTLDADDDHPAD--SIAQVLQKGYQLHER----LLRPAMVVVYN---
GRPE_STRS2       ---VFDPNLHMAIQTVPATDDCPAE--HIAQVFQKGYKLHER----LLRPAMVVVSE---
GRPE_LACLA       ---SFDHNIHMAVQTVPADDEHPAD--SIVQVFQKGYQLHER----LLRPAMVVVAQ---
GRPE_TETHA       -GETFDPTLHQAVQTVPATEDHPAE--TVVEVLQKGYKIYDR----VLRASMVVVAQ---
GRPE_ENTFA       -GETFDPNLHQAVQTVPASEETPAD--TIVEVLQKGYKLQDR----VLRPSMVIVAQ---
GRPE_LEUMM       -GESFDPTKHQAIQSVESDEVESDQ---IAQVLQKGYILQDR----VIRPAMVAVAK---
GRPE_OENOB       -GDQFDPNLHNAIQKTPIDDPEKQKEGTIAVVLQKGYQLHDR----VLRPAMVSVYTK--
GRPE_GEOUR       KGTTFDPAYHQAMNQVESSEHEPNT---IVSEFQKGYLLNER----LLRPALVSVATAPK
GRPE_GEOSL       RGTVFDPAYHQAMCQVEVSELPPNT---VVEVFQRGYLLNER----LLRPAMVSVATVPK
GRPE_PELPD       -GAPFDPSFHQAMTQIPTDEHPPNT---VVEEFQKGYLLKER----LLRPAMVSVATAPK
GRPE_MYXXD       -GQVFDPRVHEAIQQVETADVPAGH---VAYEVVRGFYLNER----LVRPAMVVVARAPA
GRPE_DESVH       -GEPFTPELHEAMSHEDRGDMPADH---VATVMMKGYRLKER----LLRPAKVTVSRTPG
GRPE_STRCO       EGEPFDPTIHEALMHSYAPDV-TET--TCVAILQPGYRIGER----TIRPARVAVAEPQP
GRPE1_STRAW      EGEPFDPTIHEALMHSYAPDV-TET--TCVAILQPGYRIGER----TIRPARVAVAEPQP
GRPE_CUTAK       VGDVFDPNLHEALMQMPMEGV-SVT--SVSQVMQPGYKLGDR----VLRPARVAVSDPDP
GRPE_MYCTU       EGEDFDPVLHEAVQHEGDGGQGSKP--VIGTVMRQGYQLGEQ----VLRHALVGVVDTVV
GRPE_MYCPA       EGEEFDPVLHEAVQHEGDG---SKP--VIGTVMRQGYKLGDQ----VLRHALVGVVDTVT
GRPE_MYCLE       EGEDFDPVLHEAVQHEGDGGEGSKP--VIGDVLRHGYKLGDQ----VLRHALVGVVDTIA
GRPE_CORGL       IGEAFDPEIHEAVQDLSQG---DVK--VLGTVLRKGYRLGDR----VIRTAMVLIGDPEE
GRPE_COREF       PGDTFDPEIHEAVQDLSEG---DTK--VLGTVLRKGYRFNDK----LIRNAMVIIADPEK
GRPE_CORDI       EGDVFDAERHEAVQDLSSG---DDK--VLGTVLRRGYQMNDR----LLRTAMVIIADPAE
GRPE_BIFAA       KGEDFDPTKHDAILHKPDPN-AEKE--TVDTVVEAGYRIGDR----VIRAARVVVASPQN
GRPE_BIFLO       KGEDFDPTKHDAILHKPDAD-AEKE--TVDTVVEAGYRIGDR----VIRAARVVVASPQN
GRPE_TROWT       PGDPFNPELHEALFQNPSPD-VQTE--TVQDVIEAGYCLGET----VIRAAKVVVQVPNG
GRPE_LEIXX       KGEPFDPQIHEAIFQQPTPG-VTAD--TVADVVETGYRLGST----TVRVAKVVVAVPA-
GRPE_THET2       EGEAFDPRYHEAVGLLPGE---PG---KVAKVFQRGFRMGEA----LVRPARVAVGE-EK
GRPE_MEIRU       VGAEFDPRYHEAIGAVEGE---EG---KVMHVYQQGFKYGDL----LVRPARVVVGSGAK
GRPE_DEIRA       EGEQFDPQWHEAIQVVAGD---EDE--KIVQTYQLGFKMGDR----LVRPARVVVSRKG-
GRPE_HALMT       PGTDVDPTRHEVMMRVESDQ--PAD--TIADVFQPGYEMAEK----VIRAAQVTVSKE--
GRPE_HALSA       PGDSVDAARHEVMMRVDSDQ--PAG--TIVDVYRPGYEMSGR----VVRAAQVTVSEE--
GRPE_NATPD       PGTETDPKRHEVLLQVESDE--PEG--TVAELHRPGYEMAGK----VLRAAQVTVSEGPS
GRPE_RUBXD       DGQHFDPSVHEAVMSQPSEE-HEEG--TIIQTFERGYMFNGR----PIRPAKVVVAV---
GRPE_METTP       VGKKFDPFVHEAMMQVESQE-AEDG--IVVQEFQKGYTLHSR----VIRTSKVAVAKHG-
GRPE_THEAC       EGSKFDPYLHEVVGVTAD---GEDG--MVKYEVQRGYTLNDG----VLRTSKVIVVKR--
GRPE_THEVO       EGEKFDPYLHEAIGMTQD---GEDG--KIKYEVQRGYTLNNS----VLRTSKVIVVKR--
GRPE_PICTO       RGKKFDPYLNEVVGIVK----GDDD--IVVEEVQKGYILNNE----VLRTSKVIVSKGGN
GRPE_TREDE       KGEAFDPNLHEAVSMIQSPD-VKEA--VVGEELQKGYKLKER----VIRHSKVMVLMPAE
GRPE_TREPA       LGERFDPNLHEALSMSPSAS-VHEK--IVGAELQKGYRVRNR----ILRHAKVMVLTPEE
GRPE_SYNPX       VGQLFDPTLHEAVLREEST-EQPED--VVIEELQRGYHLNGK----VLRHALVKVSMGPG
GRPE_SYNS9       VGQEFDPTLHEAVLREENQ-EHAED--IVCEELQRGYHRDGR----VLRHAMVKVSMGPG
GRPE_PROMM       VGQVFDPTLHEAVSREPSE-EHPED--VVTEELQRGYHLNGR----VLRHALVKVSMGPG
GRPE_PROM1       VDQAFDPSLHEAVMREPSD-EKAED--IVIEELQRGYHLNGR----VLRHALVKVSMGPG
GRPE_PROMA       VGQSFDPTLHEALLREPSE-LMVED--MILEELVRGYHLNGR----VLRHAQVKVSMGPG
GRPE_PROMS       VGQQFDPSLHEAVLREPSE-KFEED--FIIEELQRGYHLEGK----VLRHALVKVSMGPG
GRPE_PROM9       VGQQFDPNLHEAVLREPSE-EFKED--LIVEELQRGYHLEGK----VLRHALVKVSMGHG
GRPE_PROM5       VGQQFDPNLHEAVLREPSE-EQNED--IIIEELQRGYHLEGK----VLRHALVKVSMGPG
GRPE_PROMP       VAQQFDPKLHEAVLREPSQ-EFNED--IIIEELQRGYHLEGK----VLRHALVKVSMGPG
GRPE_NOSS1       EGQEFDPNLHEAVMREPTD-EHPEG--TVLEELVRGYYLGDR----VLRHSMVKVAAPKE
GRPE_SYNE7       EGQPFDPSLHDAVLREETT-EHPDG--IVLEELQRGYLLGDL----VLRHALVKVSIAAE
GRPE_TRIEI       EGQEFDPNLHEAVMREATA-EHPEG--TVIEELVRGYILGER----VLRHAMVKVATAPD
GRPE_THEEB       KGKPFDPNLHEAVLREATN-EHPEG--TVIEELKRGYMLGDR----VLRHAMVKVAAPPE
GRPE_SYNY3       EGKPFDPKYHEAMLREPTA-EYPED--TVIEELVRGYLLDDI----VLRHSMVKVAVAPE
GRPE_GLOVI       IGQPFDPAQHEAILREESA-GVSQE--TVVAELQKGYLLADK----VLRPAMVKVAIPEA
GRPE_SYNJB       VGQPFDPNLHEAIARQPSP-DYPED--VVAVEYQPGYKLGDL----VIRHAMVAVSAGSP
GRPE_SYNJA       VGQPFDPNLHEAIARQPSS-EYPED--VVAVEYQPGYKLGDL----VIRHAMVAVSSGSP
GRPE_BACFR       KDQPLDTDYHEAIAVIPAPTEEQKG--KILDCVQTGYTLNGK----VIRHAKVVVGE---
GRPE_BACTN       KDQPLDTDYHEAIAVIPAPSEEQKG--KILDCVQTGYTLNDK----VIRHAKVVVGE---
GRPE_PORGI       ADLPFDADLCDAVAMIPAPSAEQKG--KVIDCVKTGYTLNDK----VIRHAHVVVGE---
GRPE_CHLPM       IGLKLDVDFHEAISQIEHPEAEPD---TIVEQYQTGYLLGDR----VIRHAKVIVSR---
GRPE_PELLD       IGMKLDVDFHEAISQIEHPDAEPE---TIVEQYQTGYLLGDR----VLRHAKVIVAR---
GRPE_CHLTE       KGKMLDVNFHEAITQIDAPGAEPD---TIVEEYQTGYTLGDR----VIRHAKVIVAK---
GRPE_CHLAB       -GQKFNPFLHEAVETEETTKVPEGT---IVEEFSKGYKIGDR----PIRVAKVKVSKAPA
GRPE_CHLPN       -GQKFNPFLHEAVQTEETSEVPEGT---ILEEFAKGYKIGER----PIRVAKVKVAKAPT
GRPE_CHLMU       -GELFNPYLHEAVEIEETTDIPEGT---ILEEFTKGYKIGDR----PIRVAKVKVAKFPT
GRPE_PARUW       -GTFFDPHLHEAIEMVETDSYAPGI---IVEENVRGYKMGDR----MIRPARVKVAKAIS
GRPE_LEPIC       -GEPFDPMSMEALSSEEGDQYSEET---VIDVYQPGYYYKENEDKFTLRPARVRIGKPKS
GRPE_LEPBJ       -GESFDPMSMEALSSEEGDQYSEET---VIDVYQAGYYYKENEDKFTLRPARVRIGKPKS
GRPE_BDEBA       -GAPFDPSVHEALSSEATDQMAPGH---IVRVFKKPYKLHDK----VIRPGQVVVAKKPE
GRPE1_BUCAP      -NISFDPEIHQAMSINYNDEIEDNH---VVDVMQSGYMLHK---ARLLRPAMVIVSKRKN
GRPE1_BUCAI      -NVLFNPSIHQAMSIHYTNDIISNQ---IVTVMQSGYILHK---SRLLRPAMVVVSKEKI
GRPE_WIGBR       -NIPFDPKIHEAMTVIDDKNKKTNQ---VVEIMQKGYILN----GRLLRPAMVVVSK---
GRPE2_BUCAI      -NKVFNPDIHELVSRELSKETLPNH---VISVNKKGFTFNK---IVLRKASVIVAEN---
GRPE2_BUCAP      -NEIFNPKIHDVILTESSNTIEPNY---IISVKKKGFIFKK---TILRKAAVVISKT---
GRPE2_BUCBP      -GKLFDPKLHTTIPNENCKNINEYY---VSEIIQDGYTFHE---KIIRKAIVKLSKDKKT
GRPE_MYCMS       VGDMFDPHLHDANEAVETDEYKTNQ---IVGVLSDGYMIHDK----VLVYAIVKVAK---
GRPE_MYCCT       VGDMFNPHLHDANEAVESDEYKTNQ---IVGVLSDGYMIHDK----VLIYAIVKVAK---
GRPE_MESFL       AGDEFDSSFHEANESLENSGMESNK---IVSVISDGYMIHDR----VLIHAIVKVAK---
GRPE_MYCGE       PGMEFDEKIMSALELVDS-NLAKNK---VVRVSKSGYKLYDK----VIRFASVFVSKG--
GRPE_MYCPN       PGAQFDEKVMAALEVVPS-DQPANT---VVKVSKSGYKLHDK----VIRFASVVVSQG--
GRPE_MYCGA       PGDKFDEKYMSASDKASDPDYPADH---VCKVMKSGYKLYDR----VVRHAMVAVSDGVG
GRPE1_BUCBP      -NIAFNPDIHQAITTQVSKDIKNNY---VISIMQKGYLLYDR----LLRPAMVIVSKNDI
GRPE_RHOBA       -GELFDPNFHEAISQMPHPEIASGM---VAHVATPGFQMHDR----VVRPAQVVVSTGDG
GRPE2_STRAW      -GVAFDPARHEVVGVVQDPDAPPGT---VVEVLRPGYGDGER----QLRPAAVTVTKRE-
GRPE_MYCPE       LNDDFNAEVMQAFETQKAPNTQPNK---VIKIIKKGYKLHDI----VLVPATVIVSE---
GRPE_UREP2       VNDSLNDEIMEVFEVVENTNKPSMH---VVEVISDGFKYNDK----VIKFAVVKVAK---
GRPE_MYCMO       IGDTFNPEVHNAVELREEG--TPNR---ILKINSLGYQFHER----VLKPASVIVSK---
                                                                             

GRPE_ONYPE       KNDKNE------------------------------------------------------
GRPE_AYWBP       KNEKNE------------------------------------------------------
GRPE_ACHLA       DNGEDK------------------------------------------------------
GRPE_PEWBP       KNND--------------------------------------------------------
GRPE_WOLTR       NC----------------------------------------------------------
GRPE_WOLPM       DCGND-------------------------------------------------------
GRPE_EHRCJ       D-----------------------------------------------------------
GRPE_FUSNN       ------------------------------------------------------------
GRPE_FUSNP       ------------------------------------------------------------
GRPE_BORBP       ------------------------------------------------------------
GRPE_METS3       ------------------------------------------------------------
GRPE_METTH       ------------------------------------------------------------
GRPE_METST       ------------------------------------------------------------
GRPE_CALS4       ------------------------------------------------------------
GRPE_CLOD6       ------------------------------------------------------------
GRPE_ALKOO       ------------------------------------------------------------
GRPE_CLOAB       ------------------------------------------------------------
GRPE_CLOTE       ------------------------------------------------------------
GRPE_CLOB8       ------------------------------------------------------------
GRPE_CLOPS       ------------------------------------------------------------
GRPE_LACP7       ------------------------------------------------------------
GRPE_METMA       EAEK--------------------------------------------------------
GRPE_METAC       ETEK--------------------------------------------------------
GRPE_METBF       EAEK--------------------------------------------------------
GRPE_AQUAE       EEEGEEIT----------------------------------------------------
GRPE_THEMA       KKEERKVEEPSDKKE---------------------------------------------
GRPE_PSELT       GENGAKTE----------------------------------------------------
GRPE_VIBHA       ------------------------------------------------------------
GRPE_VIBVU       ------------------------------------------------------------
GRPE_VIBPR       ------------------------------------------------------------
GRPE_VIBC3       ------------------------------------------------------------
GRPE_PHOPR       GSVDMQA-----------------------------------------------------
GRPE_ALIF1       ------------------------------------------------------------
GRPE_SHELP       ----ASVDTQA-------------------------------------------------
GRPE_SHESH       ----AAVDTQA-------------------------------------------------
GRPE_SHEFN       ----GSVDVEA-------------------------------------------------
GRPE_SHEON       SQESASIDIEA-------------------------------------------------
GRPE_PSET1       A-----------------------------------------------------------
GRPE_PSYIN       ------------------------------------------------------------
GRPE_COLP3       TVDATA------------------------------------------------------
GRPE_PSEP1       AAQPSINEKA--------------------------------------------------
GRPE_PSEPG       APQPSIDEKA--------------------------------------------------
GRPE_PSEE4       PAQPSIDEKA--------------------------------------------------
GRPE_PSEMY       TPPPSIDEQA--------------------------------------------------
GRPE_PSEU5       DAPPSIDEKA--------------------------------------------------
GRPE_PSEAE       ETPPSIDEQA--------------------------------------------------
GRPE_PSEPF       PVSPSIDEKA--------------------------------------------------
GRPE_PSE14       PATPSINEQA--------------------------------------------------
GRPE_CHRSD       ------------------------------------------------------------
GRPE_ALCBS       ------------------------------------------------------------
GRPE_YERE8       ------------------------------------------------------------
GRPE_SERP5       ------------------------------------------------------------
GRPE_PECAS       ------------------------------------------------------------
GRPE_SODGM       ------------------------------------------------------------
GRPE_PHOLL       ------------------------------------------------------------
GRPE_ECOLI       ------------------------------------------------------------
GRPE_ENT38       ------------------------------------------------------------
GRPE_KLEP7       ------------------------------------------------------------
GRPE_CROS8       ------------------------------------------------------------
GRPE_BAUCH       ------------------------------------------------------------
GRPE_BLOFL       ------------------------------------------------------------
GRPE_PASMU       ------------------------------------------------------------
GRPE_ACTSZ       ------------------------------------------------------------
GRPE_HAEIN       ------------------------------------------------------------
GRPE_HAES1       ------------------------------------------------------------
GRPE_HAEDU       ------------------------------------------------------------
GRPE_ACTP2       ------------------------------------------------------------
GRPE_PSYS1       ------------------------------------------------------------
GRPE_ACIAD       ------------------------------------------------------------
GRPE_XANOM       ------------------------------------------------------------
GRPE_XYLFT       ------------------------------------------------------------
GRPE_ALKEH       EPPPSG-SIDEQA-----------------------------------------------
GRPE_HALHL       GGAGSGGSVDETA-----------------------------------------------
GRPE_HYDCU       ------------------------------------------------------------
GRPE_BURTA       ------------------------------------------------------------
GRPE_BURL3       ------------------------------------------------------------
GRPE_PARXL       ------------------------------------------------------------
GRPE_RALSO       ------------------------------------------------------------
GRPE_POLAQ       ------------------------------------------------------------
GRPE_POLNA       ------------------------------------------------------------
GRPE_ACIAC       ------------------------------------------------------------
GRPE_BORPE       ------------------------------------------------------------
GRPE_NITEC       T-----------------------------------------------------------
GRPE_NITEU       T-----------------------------------------------------------
GRPE_NITMU       S-----------------------------------------------------------
GRPE_METFK       ------------------------------------------------------------
GRPE_METSS       ------------------------------------------------------------
GRPE_DECAR       ------------------------------------------------------------
GRPE_NEIMB       ------------------------------------------------------------
GRPE_CHRVO       ------------------------------------------------------------
GRPE_FRATO       ------------------------------------------------------------
GRPE_FRAP2       ------------------------------------------------------------
GRPE_DICNV       ------------------------------------------------------------
GRPE_LEGPA       ------------------------------------------------------------
GRPE_COXBN       ------------------------------------------------------------
GRPE_BRUME       KVSAENGASTSEDNA---------------------------------------------
GRPE_OCHA4       KATADNGASEGNG-----------------------------------------------
GRPE_BARQU       KGVPVESGSA--------------------------------------------------
GRPE_BARHE       KDISVESDSD--------------------------------------------------
GRPE_RHIRD       KAEPSASAEPGTSS-LNEKDA---------------------------------------
GRPE_RHIME       KAATSESETPAA------------------------------------------------
GRPE_RHIL3       KPAEAETNSVFD-----EKDA---------------------------------------
GRPE_RHILO       KIAAEAPVEPGPVNEQAEKDA---------------------------------------
GRPE_RHOPS       KPAPAAA-NGNEGGVA--------------------------------------------
GRPE_RHOPA       KAAPSDG-GGETGNLN--------------------------------------------
GRPE_BRASO       KAAPAAS-NDQSNSAA--------------------------------------------
GRPE_RHOP5       KAAPAAAANGESNSAA--------------------------------------------
GRPE_BRADU       KAASAAN----SNEVN--------------------------------------------
GRPE_RHOS4       A-----------------------------------------------------------
GRPE_RICTY       ------------------------------------------------------------
GRPE_RICCN       ------------------------------------------------------------
GRPE_RICB8       ------------------------------------------------------------
GRPE_CAUVC       TGPASPDAPAASANPYAGAAAEGDSTGGAFDAKA--------------------------
GRPE_WOLSU       ------------------------------------------------------------
GRPE_HELHP       ------------------------------------------------------------
GRPE_HELAH       ------------------------------------------------------------
GRPE_NITSB       ------------------------------------------------------------
GRPE_ARCB4       ------------------------------------------------------------
GRPE_CAMC5       ------------------------------------------------------------
GRPE_CAMFF       ------------------------------------------------------------
GRPE_CAMJR       ------------------------------------------------------------
GRPE_SULNB       ------------------------------------------------------------
GRPE_PARTM       ------------------------------------------------------------
GRPE_GEOSE       ------------------------------------------------------------
GRPE_GEOKA       ------------------------------------------------------------
GRPE_GEOTN       ------------------------------------------------------------
GRPE_BACVZ       ------------------------------------------------------------
GRPE_BACSU       ------------------------------------------------------------
GRPE_BACP2       ------------------------------------------------------------
GRPE_BACLD       ------------------------------------------------------------
GRPE_BACCN       ------------------------------------------------------------
GRPE_BACHD       ------------------------------------------------------------
GRPE_BACSK       ------------------------------------------------------------
GRPE_LISIN       ------------------------------------------------------------
GRPE_LYSSH       ------------------------------------------------------------
GRPE_OCEIH       ------------------------------------------------------------
GRPE_STAAB       ------------------------------------------------------------
GRPE_STAHJ       ------------------------------------------------------------
GRPE_STAEQ       ------------------------------------------------------------
GRPE_STAS1       ------------------------------------------------------------
GRPE_LACJO       ------------------------------------------------------------
GRPE_LACAC       ------------------------------------------------------------
GRPE_LACDB       ------------------------------------------------------------
GRPE_LACPL       ------------------------------------------------------------
GRPE_LACSN       ------------------------------------------------------------
GRPE_LACSK       ------------------------------------------------------------
GRPE_PEDPA       ------------------------------------------------------------
GRPE_STRGC       ------------------------------------------------------------
GRPE_STRPN       ------------------------------------------------------------
GRPE_STRTD       ------------------------------------------------------------
GRPE_STRA1       ------------------------------------------------------------
GRPE_STRMU       ------------------------------------------------------------
GRPE_STRS2       ------------------------------------------------------------
GRPE_LACLA       ------------------------------------------------------------
GRPE_TETHA       ------------------------------------------------------------
GRPE_ENTFA       ------------------------------------------------------------
GRPE_LEUMM       ------------------------------------------------------------
GRPE_OENOB       ------------------------------------------------------------
GRPE_GEOUR       EQ----------------------------------------------------------
GRPE_GEOSL       DAA---------------------------------------------------------
GRPE_PELPD       ------------------------------------------------------------
GRPE_MYXXD       EPVAAAEPPAVAEPATATTDTEAPAAPAQSENSSGGSQ----------------------
GRPE_DESVH       ------------------------------------------------------------
GRPE_STRCO       GAQTVKPA--EDAAEAQDSSGAEDDAGTKESGGPDEG-----------------------
GRPE1_STRAW      GAQTVKA----DEAEAADD---------KESGGPEEG-----------------------
GRPE_CUTAK       NATSADESSQADGESAQAD---------EDDETPRNE-----------------------
GRPE_MYCTU       VDA-AELESVDDGTAVADTAENDQADQGNSADTSGEQAESEPSGS---------------
GRPE_MYCPA       EEGDGEAAATDEPTAAAAETRPPESD--DNAGASGD------------------------
GRPE_MYCLE       GDGAETVAIVAPVDSTAKTEQGELGDNVTPHKEDGD------------------------
GRPE_CORGL       S-----------------------------------------------------------
GRPE_COREF       ------------------------------------------------------------
GRPE_CORDI       DAQ---------------------------------------------------------
GRPE_BIFAA       ------------------------------------------------------------
GRPE_BIFLO       ------------------------------------------------------------
GRPE_TROWT       ------------------------------------------------------------
GRPE_LEIXX       ------------------------------------------------------------
GRPE_THET2       QEEADLE-----------------------------------------------------
GRPE_MEIRU       PEEAEA------------------------------------------------------
GRPE_DEIRA       ------------------------------------------------------------
GRPE_HALMT       ------------------------------------------------------------
GRPE_HALSA       ------------------------------------------------------------
GRPE_NATPD       GDSEAEDDADGEDGDE--------------------------------------------
GRPE_RUBXD       ------------------------------------------------------------
GRPE_METTP       ------------------------------------------------------------
GRPE_THEAC       ------------------------------------------------------------
GRPE_THEVO       ------------------------------------------------------------
GRPE_PICTO       NEQDNRN-----------------------------------------------------
GRPE_TREDE       KQDEKKAEESEAADKKNEN-----------------------------------------
GRPE_TREPA       Q------TEPDRGDGPSE------------------------------------------
GRPE_SYNPX       PSADAEGAASAEAEDS--------------------------------------------
GRPE_SYNS9       PESSSDAASEQPQEGDA-------------------------------------------
GRPE_PROMM       PQSGASPSSAQPNDDSTATFQGEADPAQPGV-----------------------------
GRPE_PROM1       PKAVNEEIPDQSASNQELSESVDGPTKDEN------------------------------
GRPE_PROMA       PKVDEEDKQIDEDSQADKRDEATTASNELD------------------------------
GRPE_PROMS       KQNSQEEVEKDKVEGDIDSEENTSEDV---------------------------------
GRPE_PROM9       QQNSQEEVEKDTVEEDIDSEENTSEDV---------------------------------
GRPE_PROM5       QQISQESEEKDKVDKDIDSEGSISEEN---------------------------------
GRPE_PROMP       QQNSQEPEEKDKVEEDIDSENPISEEN---------------------------------
GRPE_NOSS1       DTLPAQENQSSPADS---------------------------------------------
GRPE_SYNE7       ------ENSAAVTE----------------------------------------------
GRPE_TRIEI       -TDAETENQTDPES----------------------------------------------
GRPE_THEEB       EGSASNTNPTNDVTDV--------------------------------------------
GRPE_SYNY3       EGAEVVNGEAGANP----------------------------------------------
GRPE_GLOVI       GS----------------------------------------------------------
GRPE_SYNJB       SSEPSPPAQATIEAGPENTPASPQNPQPS-------------------------------
GRPE_SYNJA       TSEPSPSDPATPKPEPESTPASPQNPQHS-------------------------------
GRPE_BACFR       ------------------------------------------------------------
GRPE_BACTN       ------------------------------------------------------------
GRPE_PORGI       ------------------------------------------------------------
GRPE_CHLPM       ------------------------------------------------------------
GRPE_PELLD       ------------------------------------------------------------
GRPE_CHLTE       ------------------------------------------------------------
GRPE_CHLAB       PQGTEAEIENNNE-----------------------------------------------
GRPE_CHLPN       PK------ENKE------------------------------------------------
GRPE_CHLMU       KGNNDSN-EEKE------------------------------------------------
GRPE_PARUW       AIDPQDKSELNENN----------------------------------------------
GRPE_LEPIC       ------------------------------------------------------------
GRPE_LEPBJ       ------------------------------------------------------------
GRPE_BDEBA       ------------------------------------------------------------
GRPE1_BUCAP      N-----------------------------------------------------------
GRPE1_BUCAI      ------------------------------------------------------------
GRPE_WIGBR       ------------------------------------------------------------
GRPE2_BUCAI      ------------------------------------------------------------
GRPE2_BUCAP      ------------------------------------------------------------
GRPE2_BUCBP      ------------------------------------------------------------
GRPE_MYCMS       ------------------------------------------------------------
GRPE_MYCCT       ------------------------------------------------------------
GRPE_MESFL       ------------------------------------------------------------
GRPE_MYCGE       ----------------------------------------------NKKS----------
GRPE_MYCPN       ----------------------------------------------NKTE----------
GRPE_MYCGA       YVEPASSEQEQPQTPAKSTQTPPAQETASAPAKTKPTAPPTNNLNANKPPVVSNPPHQKP
GRPE1_BUCBP      ------------------------------------------------------------
GRPE_RHOBA       SA----------------------------------------------------------
GRPE2_STRAW      ------------------------------------------------------------
GRPE_MYCPE       ------------------------------------------------------------
GRPE_UREP2       ------------------------------------------------------------
GRPE_MYCMO       ------------------------------------------------------------
                                                                             

GRPE_ONYPE       -----------------------
GRPE_AYWBP       -----------------------
GRPE_ACHLA       -----------------------
GRPE_PEWBP       -----------------------
GRPE_WOLTR       -----------------------
GRPE_WOLPM       -----------------------
GRPE_EHRCJ       -----------------------
GRPE_FUSNN       -----------------------
GRPE_FUSNP       -----------------------
GRPE_BORBP       -----------------------
GRPE_METS3       -----------------------
GRPE_METTH       -----------------------
GRPE_METST       -----------------------
GRPE_CALS4       -----------------------
GRPE_CLOD6       -----------------------
GRPE_ALKOO       -----------------------
GRPE_CLOAB       -----------------------
GRPE_CLOTE       -----------------------
GRPE_CLOB8       -----------------------
GRPE_CLOPS       -----------------------
GRPE_LACP7       -----------------------
GRPE_METMA       -----------------------
GRPE_METAC       -----------------------
GRPE_METBF       -----------------------
GRPE_AQUAE       -----------------------
GRPE_THEMA       -----------------------
GRPE_PSELT       -----------------------
GRPE_VIBHA       -----------------------
GRPE_VIBVU       -----------------------
GRPE_VIBPR       -----------------------
GRPE_VIBC3       -----------------------
GRPE_PHOPR       -----------------------
GRPE_ALIF1       -----------------------
GRPE_SHELP       -----------------------
GRPE_SHESH       -----------------------
GRPE_SHEFN       -----------------------
GRPE_SHEON       -----------------------
GRPE_PSET1       -----------------------
GRPE_PSYIN       -----------------------
GRPE_COLP3       -----------------------
GRPE_PSEP1       -----------------------
GRPE_PSEPG       -----------------------
GRPE_PSEE4       -----------------------
GRPE_PSEMY       -----------------------
GRPE_PSEU5       -----------------------
GRPE_PSEAE       -----------------------
GRPE_PSEPF       -----------------------
GRPE_PSE14       -----------------------
GRPE_CHRSD       -----------------------
GRPE_ALCBS       -----------------------
GRPE_YERE8       -----------------------
GRPE_SERP5       -----------------------
GRPE_PECAS       -----------------------
GRPE_SODGM       -----------------------
GRPE_PHOLL       -----------------------
GRPE_ECOLI       -----------------------
GRPE_ENT38       -----------------------
GRPE_KLEP7       -----------------------
GRPE_CROS8       -----------------------
GRPE_BAUCH       -----------------------
GRPE_BLOFL       -----------------------
GRPE_PASMU       -----------------------
GRPE_ACTSZ       -----------------------
GRPE_HAEIN       -----------------------
GRPE_HAES1       -----------------------
GRPE_HAEDU       -----------------------
GRPE_ACTP2       -----------------------
GRPE_PSYS1       -----------------------
GRPE_ACIAD       -----------------------
GRPE_XANOM       -----------------------
GRPE_XYLFT       -----------------------
GRPE_ALKEH       -----------------------
GRPE_HALHL       -----------------------
GRPE_HYDCU       -----------------------
GRPE_BURTA       -----------------------
GRPE_BURL3       -----------------------
GRPE_PARXL       -----------------------
GRPE_RALSO       -----------------------
GRPE_POLAQ       -----------------------
GRPE_POLNA       -----------------------
GRPE_ACIAC       -----------------------
GRPE_BORPE       -----------------------
GRPE_NITEC       -----------------------
GRPE_NITEU       -----------------------
GRPE_NITMU       -----------------------
GRPE_METFK       -----------------------
GRPE_METSS       -----------------------
GRPE_DECAR       -----------------------
GRPE_NEIMB       -----------------------
GRPE_CHRVO       -----------------------
GRPE_FRATO       -----------------------
GRPE_FRAP2       -----------------------
GRPE_DICNV       -----------------------
GRPE_LEGPA       -----------------------
GRPE_COXBN       -----------------------
GRPE_BRUME       -----------------------
GRPE_OCHA4       -----------------------
GRPE_BARQU       -----------------------
GRPE_BARHE       -----------------------
GRPE_RHIRD       -----------------------
GRPE_RHIME       -----------------------
GRPE_RHIL3       -----------------------
GRPE_RHILO       -----------------------
GRPE_RHOPS       -----------------------
GRPE_RHOPA       -----------------------
GRPE_BRASO       -----------------------
GRPE_RHOP5       -----------------------
GRPE_BRADU       -----------------------
GRPE_RHOS4       -----------------------
GRPE_RICTY       -----------------------
GRPE_RICCN       -----------------------
GRPE_RICB8       -----------------------
GRPE_CAUVC       -----------------------
GRPE_WOLSU       -----------------------
GRPE_HELHP       -----------------------
GRPE_HELAH       -----------------------
GRPE_NITSB       -----------------------
GRPE_ARCB4       -----------------------
GRPE_CAMC5       -----------------------
GRPE_CAMFF       -----------------------
GRPE_CAMJR       -----------------------
GRPE_SULNB       -----------------------
GRPE_PARTM       -----------------------
GRPE_GEOSE       -----------------------
GRPE_GEOKA       -----------------------
GRPE_GEOTN       -----------------------
GRPE_BACVZ       -----------------------
GRPE_BACSU       -----------------------
GRPE_BACP2       -----------------------
GRPE_BACLD       -----------------------
GRPE_BACCN       -----------------------
GRPE_BACHD       -----------------------
GRPE_BACSK       -----------------------
GRPE_LISIN       -----------------------
GRPE_LYSSH       -----------------------
GRPE_OCEIH       -----------------------
GRPE_STAAB       -----------------------
GRPE_STAHJ       -----------------------
GRPE_STAEQ       -----------------------
GRPE_STAS1       -----------------------
GRPE_LACJO       -----------------------
GRPE_LACAC       -----------------------
GRPE_LACDB       -----------------------
GRPE_LACPL       -----------------------
GRPE_LACSN       -----------------------
GRPE_LACSK       -----------------------
GRPE_PEDPA       -----------------------
GRPE_STRGC       -----------------------
GRPE_STRPN       -----------------------
GRPE_STRTD       -----------------------
GRPE_STRA1       -----------------------
GRPE_STRMU       -----------------------
GRPE_STRS2       -----------------------
GRPE_LACLA       -----------------------
GRPE_TETHA       -----------------------
GRPE_ENTFA       -----------------------
GRPE_LEUMM       -----------------------
GRPE_OENOB       -----------------------
GRPE_GEOUR       -----------------------
GRPE_GEOSL       -----------------------
GRPE_PELPD       -----------------------
GRPE_MYXXD       -----------------------
GRPE_DESVH       -----------------------
GRPE_STRCO       -----------------------
GRPE1_STRAW      -----------------------
GRPE_CUTAK       -----------------------
GRPE_MYCTU       -----------------------
GRPE_MYCPA       -----------------------
GRPE_MYCLE       -----------------------
GRPE_CORGL       -----------------------
GRPE_COREF       -----------------------
GRPE_CORDI       -----------------------
GRPE_BIFAA       -----------------------
GRPE_BIFLO       -----------------------
GRPE_TROWT       -----------------------
GRPE_LEIXX       -----------------------
GRPE_THET2       -----------------------
GRPE_MEIRU       -----------------------
GRPE_DEIRA       -----------------------
GRPE_HALMT       -----------------------
GRPE_HALSA       -----------------------
GRPE_NATPD       -----------------------
GRPE_RUBXD       -----------------------
GRPE_METTP       -----------------------
GRPE_THEAC       -----------------------
GRPE_THEVO       -----------------------
GRPE_PICTO       -----------------------
GRPE_TREDE       -----------------------
GRPE_TREPA       -----------------------
GRPE_SYNPX       -----------------------
GRPE_SYNS9       -----------------------
GRPE_PROMM       -----------------------
GRPE_PROM1       -----------------------
GRPE_PROMA       -----------------------
GRPE_PROMS       -----------------------
GRPE_PROM9       -----------------------
GRPE_PROM5       -----------------------
GRPE_PROMP       -----------------------
GRPE_NOSS1       -----------------------
GRPE_SYNE7       -----------------------
GRPE_TRIEI       -----------------------
GRPE_THEEB       -----------------------
GRPE_SYNY3       -----------------------
GRPE_GLOVI       -----------------------
GRPE_SYNJB       -----------------------
GRPE_SYNJA       -----------------------
GRPE_BACFR       -----------------------
GRPE_BACTN       -----------------------
GRPE_PORGI       -----------------------
GRPE_CHLPM       -----------------------
GRPE_PELLD       -----------------------
GRPE_CHLTE       -----------------------
GRPE_CHLAB       -----------------------
GRPE_CHLPN       -----------------------
GRPE_CHLMU       -----------------------
GRPE_PARUW       -----------------------
GRPE_LEPIC       -----------------------
GRPE_LEPBJ       -----------------------
GRPE_BDEBA       -----------------------
GRPE1_BUCAP      -----------------------
GRPE1_BUCAI      -----------------------
GRPE_WIGBR       -----------------------
GRPE2_BUCAI      -----------------------
GRPE2_BUCAP      -----------------------
GRPE2_BUCBP      -----------------------
GRPE_MYCMS       -----------------------
GRPE_MYCCT       -----------------------
GRPE_MESFL       -----------------------
GRPE_MYCGE       -----------------------
GRPE_MYCPN       -----------------------
GRPE_MYCGA       VQPPQSNTPGPKQPITHQVIKKS
GRPE1_BUCBP      -----------------------
GRPE_RHOBA       -----------------------
GRPE2_STRAW      -----------------------
GRPE_MYCPE       -----------------------
GRPE_UREP2       -----------------------
GRPE_MYCMO       -----------------------