CLUSTAL format seed alignment for MF_01152

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DNAJ2_COREF      -MNNAEWANKDYYADLGVSKNASAEDIKKAYRKLARENHPDKNPG-----DKVAEDR---
DNAJ2_CORGL      -MNNSEWANKNYYADLGVSSSASEDEIKKAYRKLARENHPDKNPG-----DKAAEDR---
DNAJ2_CORDI      MAAKNEWAEKDYYADLGVSSSATEAEIKKAYRKLARENHPDSHPG-----DAAAEER---
DNAJ1_MYCBO      -MAQREWVEKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPG-----NPAAGER---
DNAJ1_MYCTU      -MAQREWVEKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPG-----NPAAGER---
DNAJ2_MYCPA      -MAQREWVEKDFYKELGVSSDASPEEIKRAYRKLARDLHPDANPD-----NPAAGER---
DNAJ1_MYCLE      -MAQREWVEKDFYKELGVSSDASPEEIKRAYRKLARYLHPDANPD-----N-SAGER---
DNAJ2_NOCFA      -MSQREWIEKDYYKELGVSSTASQDEIKKAYRKLARDLHPDANPG-----DSKAEER---
DNAJ1_STRAW      -MSTKDFIEKDYYKVLGVPKDATEAEIKKAYRKLAREFHPDANKG-----NAKAEER---
DNAJ1_STRCO      -MSTKDFIEKDYYKVLGVPKDATEAEIKKAYRKLARENHPDANKG-----NVKAEER---
DNAJ2_CUTAK      -MSTKDWAEKDYYKILGVSKDAKPEEIKKAFRKIARDNHPDSHPG-----DKAAEAR---
DNAJ1_AQUAE      ----MSQAVKDYYEILGVNRDATKEEIKKAYRKLVRIYHPDINPD------PSAQE----
DNAJ2_AQUAE      ---MASSTKKDYYEILGVPRNASQEEIKKAYRRLVRKYHPDICKK------PECEE----
DNAJ_THEMA       ----MKKEKKDYYEILGVPRDATQEEIKRAYKRLVKEWHPDRHPEN----RKEAEQ----
DNAJ_BORBU       -------MKKDYYEILGLSKGASKDEIKKAYRKIAIKYHPDRNQG-----NEEAAS----
DNAJ_BORBP       -------MKKDYYEILGLSKGASKDEIKKAYRKIAIKYHPDRNQG-----NEEAAS----
DNAJ_CAMJE       -------MEISYYEILEITQNADKETIKKAYRKMALKYHPDRNQG-----DKEAED----
DNAJ_CAMJR       -------MEISYYEILEITQNADKETIKKAYRKMALKYHPDRNQG-----DKEAED----
DNAJ_HELHP       ------METFDYYEILEITRTSDKETIKKAYRKMALKYHPDRNPD-----DKDAEE----
DNAJ_WOLSU       ------MEEFDYYEILEIERSASGEEIKKAYRKMAMKYHPDRNEG-----SSEAEE----
DNAJ_HELPJ       -------MELSYYEILEVEKHSNQETIKKSYRKLALKYHPDRNAG-----DKEAEE----
DNAJ_HELPY       -------MELSYYEILEVEKHSNQETIKKSYRKLALKYHPDRNAG-----DKEAEE----
DNAJ_ECO57       ------MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQG-----DKEAEA----
DNAJ_ECOL6       ------MAKQDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQG-----DKEAEA----
DNAJ_ECOLI       ------MAKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQG-----DKEAEA----
DNAJ_SHIFL       ------MAKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQG-----DKEAEA----
DNAJ_SALTI       ------MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQG-----DKEAEA----
DNAJ_SALTY       ------MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQG-----DKEAEA----
DNAJ_SALPA       ------MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQG-----DKEAEA----
DNAJ_YERPE       ------MAKRDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSE-----DKNAEE----
DNAJ_YERPS       ------MAKRDYYEVLGVSRDAEEREIKKAYKRLAMKFHPDRQSE-----DKNAEE----
DNAJ_PECAS       ------MAKQDYYESLGVAKSADDREIKKAYKRLAMKYHPDRNPG-----DSEAEA----
DNAJ_PHOLL       ------MAKRDYYEVLGVSKTASEKEIKKAYKRLAMKYHPDRNQG-----DKEAES----
DNAJ_BLOFL       ------MVKSDYYEILGVSKNADEREIKKSYKRLAMKFHPDRNPG-----DVSAES----
DNAJ_WIGBR       ------MAKSDYYDILGISKNASDREIKTAYKRLAVKFHPDRNPG-----NLEAES----
DNAJ_BUCAI       ------MAKKDYYQILGIPKSAEEREIKKAYKKLAMKYHPDRNQG-----DKTAEG----
DNAJ_BUCAP       ------MAKKDYYQILGIPKSAEEREIKKAYKRLAMKYHPDRNQG-----DKNAEN----
DNAJ_BUCBP       ------MSKQDYYKTLGVTQSSDEREIKRAYKKLAMKYHPDRNPG-----NKNSEE----
DNAJ_VIBVU       ------MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQG-----DESAAD----
DNAJ_VIBVY       ------MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQG-----DESAAD----
DNAJ_VIBPA       ------MSKRDFYEVLGVSRDASERDIKKAYKRLAMKFHPDRNQG-----DESAAD----
DNAJ_VIBCH       ------MSKRDFYEVLGVGRDASERDIKKAYKRLAMKYHPDRNSG-----DAGAAE----
DNAJ_PHOPR       ------MSKRDFYEVLGVGRDAGERDIKKAYKRLAMKFHPDRNQ------EADATE----
DNAJ_SHEON       ------MSKRDYYEVLGVGRDASEREIKKAYKRLAMKFHPDRNPG-----DKAAEA----
DNAJ_IDILO       ------MATQDFYQVLGVSKDANERDIKKAYKRMAMKYHPDRTEG-----DKDMEI----
DNAJ_MANSM       ------MAKQDYYETLGVQKGADEKEIKRAYKRLAMKYHPDRTNG-----DKAAEE----
DNAJ_PASMU       ------MAKKDYYDVLGVERGADEKEIKRAYKKLAMKYHPDRTQG-----NKELEE----
DNAJ_HAEIN       ------MAKKDYYEVLGLQKGASEDEIKRAYKRLASKHHPDKNQG-----SKEAEE----
DNAJ_HAEDU       ------MAKKDYYEVLGLQKGATEKDIKRAYKRLAAKYHPDKNQG-----SKDSEE----
DNAJ_XANAC       ------MSKRDYYEVLGVARGASDEELKKAYRRCAMKHHPDRNPG-----DAAAEA----
DNAJ_XANCP       ------MSKRDYYEVLGVARGASDEELKKAYRRCAMKYHPDRNPG-----DAAAEA----
DNAJ_XYLFA       ------MSKRDYYQVLGVPRTASEDDLKKAYRRCAMKYHPDRNPG-----DAAAEA----
DNAJ_XYLFT       ------MSKRDYYQVLGVPRTASEDDLKKAYRRCAMKYHPDRNPG-----DAAAEA----
DNAJ_ACIAD       ------MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPD-----NAEAED----
DNAJ2_AROAE      ------MAKRDYYEVLGVNRDASDNEIKKAYRKLAMKHHPDRNPD-----NKDSED----
DNAJ_CHRVO       ------MSKRDYYDVLGVNRDASDDDIKKAYRKLAMKYHPDRNPD-----SKEAED----
DNAJ_NITEU       ------MSQSDYYEVLGVGRDADENELKKAYRKLAMKYHPDRNAG-----DTKAEE----
DNAJ_BORPA       ------MAKRDYYEVLGVAKNASDEDLKKAYRKLAMKYHPDRNPD-----SKEAEE----
DNAJ_BORPE       ------MAKRDYYEVLGVAKNASDEDLKKAYRKLAMKYHPDRNPD-----SKEAEE----
DNAJ_BORBR       ------MAKRDYYEVLGVAKNASDEDLKKAYRKLAMKYHPDRNPD-----SKEAEE----
DNAJ_BURMA       ------MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPD-----SKDAEE----
DNAJ_BURPS       ------MAKRDYYEVLGVAKNASDDEIKKAYRKLAMKYHPDRNPD-----SKDAEE----
DNAJ_RALSO       ------MAKRDYYEVLGVGKNASDDEIKKAYRKLAMKYHPDRNPD-----SKEAEE----
DNAJ_LEGPA       ------MEQRDYYELLEVSRNASDAEIKKAYRRLAMKYHPDRNPG-----DTSAEE----
DNAJ_LEGPH       ------MEQRDYYELLEVSRNASDAEIKKAYRRLAMKYHPDRNPG-----DTSAEE----
DNAJ_LEGPL       ------MEQRDYYELLEVSRNASDAEIKKAYRRLAMKYHPDRNPG-----DTSAEE----
DNAJ_PSEPK       ------MSKRDYYEVLGVERGATEADLKKAYRRLAMKYHPDRNPG-----DKESED----
DNAJ_PSESM       ------MAKRDYYEVLGVERGSSEADLKKAYRRLAMKHHPDRNPD-----DKASEE----
DNAJ_PSEAE       ------MAKRDFYEVLGVERGASEADLKKAYRRLAMKYHPDRNPG-----DKEAED----
DNAJ_METCA       ------MAKEDYYETLGVPRNASDSDIKKAFRRLAMKYHPDRNKD-----NPEAEE----
DNAJ_COXBU       ------MAKRDYYEVLGVNLNATEAEVKKAFRRLAMKYHPDRNPG-----DKDAEV----
DNAJ_NEIMA       ------MSNQDFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPD-----NKEAEE----
DNAJ_NEIMB       ------MSNQDFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPD-----NKEAEE----
DNAJ_FRATT       ------MQQKCYYEILNVSKTASGVEIKRAYRKLAMEYHPDRNPG-----DKEAEI----
DNAJ_AGRFC       ------MAKADFYETLGVSKTADEKELKSAFRKLAMKFHPDKNPD-----DADSER----
DNAJ_RHIME       -------MKRDLYETLGVQKNADEKELKSAFRKLAMKYHPDRNPG-----DQESEK----
DNAJ_BRUME       -------MKIDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPD-----DPEAER----
DNAJ_BRUSU       -------MKIDYYEALGVTRTADDKTLKAAFRKLAMQYHPDRNPD-----DPEAER----
DNAJ_RHILO       -------MKADFYETLGVQKGADEKELKSAFRKLAMQFHPDRNPG-----DHSCEH----
DNAJ_BARHE       -------MKVDYYEILGVTRECDDKKLKSAFRKLAMQYHPDRNAG-----DKEAER----
DNAJ_BARQU       -------MKVDYYEILGVTRECDDKKLKSAFRKLAMQYHPDRNAG-----DKEAER----
DNAJ_BRADU       ---MSTSTKRCYYETLEVERDADESKLKSSFRKLAMKFHPDRNPG-----DDTSEV----
DNAJ_RHOPA       ----MSTTKRCYYETLEVERNADDSTLKSAFRKLAMKWHPDRNPG-----DPQCEI----
DNAJ_CAUVC       --------MRDYYEILGVTRTIDEAGLKSAFRKLAMEHHPDRNGG-----CENAAG----
DNAJ_GLUOX       -----MATRIDYYESLEVSRTASQDELKKAFRKQAMRYHPDRNPG-----DDAAEQ----
DNAJ_ZYMMO       ------MSELDYYSLLEVERTADDKTIKTSYRRLAMRYHPDRNPG-----DSDAEE----
DNAJ_RICPR       ------MSQ-DYYQVLGVSKTASQADIKKAYLKLAKQYHPDTTNA-----N-DAEK----
DNAJ_RICTY       ------MSQ-DYYQVLGVSKTASQADIKKAYLKLAKQYHPDTTNA-----H-DAEK----
DNAJ_RICCN       ------MSQ-NYYQILGVSKTASQADLKKAYLKLAKQYHPDTTDA-----K-DAEK----
DNAJ_RUEPO       ------MSKRDYYDVLGVSKGASADEIKKAYRGKAKELHPDRNKD-----NPDAES----
DNAJ_ANAMM       ------MSGNDYYEILEVSRNASAEEIKKSYRKMVFKYHPDKNPG-----DKKAEE----
DNAJ_EHRRW       ------MSKSDYYDLLGLSKNATPEEIKKAYRKMALKYHPDKNPG-----DKAAEE----
DNAJ_WOLPM       ------MSKKDYYDLLEVGRNASIDEIKKAYKKLALRYHPDRNPG-----NQEAEE----
DNAJ_BDEBA       -----MAGKRDYYEILGVEKGADQDTIKKAYRKLAMQFHPDKNPG-----NKEAEE----
DNAJ_DESPS       -------MTIDYYETLSVERDADQGTIKKAYRKLAMKYHPDRNQG-----DKEAET----
DNAJ_DESVH       ------MSQRDYYEVLGVARDASEDDIKRAYRKLALQYHPDRNPD-----DPEAEQ----
DNAJ_RHOBA       -----MATKTCYYEVLKVERTATKQQVDRAYRKLAIKYHPDSNRD-----DGSATA----
DNAJ_CHLCV       ---------MDYYDVLGVSKTASPEEIKKSYRKLAVKYHPDKNPG-----DAEAEK----
DNAJ_CHLPN       ---------MDYYSILGISKTASAEEIKKAYRKLAVKYHPDKNPG-----DAAAEK----
DNAJ_CHLMU       ---------MDYYTILGVAKTATPEEIKKAYRKLAVKYHPDKNPG-----DAEAER----
DNAJ_CHLTR       ---------MDYYTILGVAKTATPEEIKKAYRKLAVKYHPDKNPG-----DAEAER----
DNAJ_PARUW       --------MADYYEILEVARGATPEEIKKAYRKKAVQYHPDKNPG-----DADAEK----
DNAJ_TREDE       ----MPASKRDYYEVLGVDKKASNDDIKKAYRKLAIKYHPDKNQG-----DKAAEE----
DNAJ_LEPIC       ------MSERSYYDILGVSKSANDEEIKSAYRKLAIKYHPDKNKG-----NKESEE----
DNAJ_LEPIN       ------MSERSYYDILGVSKSANDEEIKSAYRKLAIKYHPDKNKG-----NKESEE----
DNAJ_GEOSL       ----MAADKRDYYEVLGVHKNASDTEIKKAFRKLAIQYHPDKNPD-----DKEAEE----
DNAJ_BACAN       ------MSKRDYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSK------EENAIE----
DNAJ_BACHK       ------MSKRDYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSK------EENAIE----
DNAJ_BACCZ       ------MSKRDYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSK------EENAIE----
DNAJ_BACC1       ------MSKRDYYEVLGLSKGASKDEIKKAYRRLAKKYHPDVSK------EENAIE----
DNAJ_BACCR       ------MSKRDYYEVLGLSKGASTDEIKKAYRRLAKKYHPDVSK------EENAIE----
DNAJ_OCEIH       ------MGKRDYYEILGIDKSASQDEIKKNYRKLARKYHPDVNK------EADAAE----
DNAJ_BACHD       ------MSKRDYYEVLGVDRNASADEVKKAYRKLARKYHPDVNK------APDAED----
DNAJ_BACSK       ------MSKRDYYEVLGVDRNASVEEVKKAYRKLARKYHPDVNK------EEDAEA----
DNAJ_BACLD       ------MSKRDYYEVLGVGKSASKDEIKKAYRKLSKKYHPDINK------EAGAAE----
DNAJ_BACSU       ------MSKRDYYEVLGVSKSASKDEIKKAYRKLSKKYHPDINK------EAGSDE----
DNAJ_LISIN       ------MAKRDYYEVLGISKSASADEIKKAYRKLSKQYHPDINK------EAGADE----
DNAJ_LISMF       ------MAKRDYYEVLGVSKSASADEIKKAYRKLSKQYHPDINK------EAGADE----
DNAJ_LISMO       ------MAKRDYYEVLGISKSASADEIKKAYRKLSKQYHPDINK------EAGADE----
DNAJ_GEOKA       ------MAKRDYYEILGVSKNATKDEIKKAYRKLSKQYHPDVNK------APDAAE----
DNAJ_STAAC       ------MAKRDYYEVLGISKDASKDEIKKAYRKLSKKYHPDINK------EEGADE----
DNAJ_STAAM       ------MAKRDYYEVLGISKDASKDEIKKAYRKLSKKYHPDINK------EEGADE----
DNAJ_STAAN       ------MAKRDYYEVLGISKDASKDEIKKAYRKLSKKYHPDINK------EEGADE----
DNAJ_STAAS       ------MAKRDYYEVLGISKDASKDEIKKAYRKLSKKYHPDINK------EEGADE----
DNAJ_STAAW       ------MAKRDYYEVLGISKDASKDEIKKAYRKLSKKYHPDINK------EEGADE----
DNAJ_STAAR       ------MAKRDYYEVLGISKDASKDEIKKAYRKLSKKYHPDINK------EEGADE----
DNAJ_STAES       ------MAKRDYYEVLGVNKSASKDEIKKAYRKLSKKYHPDINK------EEGADE----
DNAJ_STAEQ       ------MAKRDYYEVLGVNKSASKDEIKKAYRKLSKKYHPDINK------EEGADE----
DNAJ_STRA3       ------MNNTEFYDRLGVSKDASQDEIKKAYRRMSKKYHPDINK------ETGAEE----
DNAJ_STRA5       ------MNNTEFYDRLGVSKDASQDEIKKAYRRMSKKYHPDINK------ETGAEE----
DNAJ_STRP3       ------MNNTEYYDRLGVSKDASQDDIKKAYRKMSKKYHPDINK------EAGAEQ----
DNAJ_STRP1       ------MNNTEYYDRLGVSKDASQDDIKKAYRKMSKKYHPDINK------EAGAEQ----
DNAJ_STRP6       ------MNNTEYYDRLGVSKDASQDDIKKAYRKMSKKYHPDINK------EAGAEQ----
DNAJ_STRP8       ------MNNTEYYDRLGVSKDASQDDIKKAYRKMSKKYHPDINK------EAGAEQ----
DNAJ_STRMU       ------MNNQEYYDRLGVSKDASQDEIKKAYRRMSKKYHPDINK------EPGAEE----
DNAJ_STRT1       ------MNNTEYYDRLGLSKDASQDEIKRAYRKLSKKYHPDINK------EPGAEE----
DNAJ_STRT2       ------MNNTEYYDRLGLSKDASQDEIKRAYRKLSKKYHPDINK------EPGAEE----
DNAJ_STRPN       ------MNNTEFYDRLGVSKNASADEIKKAYRKLSKKYHPDINK------EPGAED----
DNAJ_STRR6       ------MNNTEFYDRLGVSKNASADEIKKAYRKLSKKYHPDINK------EPGAED----
DNAJ_LACLA       ------MNNTEYYERLGVDKNASQDEIKKAYRKMSKKYHPDLNK------EEGAEE----
DNAJ_ENTFA       -----MATKRDYYEVLGLAKGASDDEIKKAYRKLSKKYHPDINK------EADAEE----
DNAJ_LACPL       ------MAEQDLYKVLGVEKDASQDEIKKAYRKLSKKYHPDLNH------EPGAEE----
DNAJ_LACJO       ------MAQRDYYDVLGVDKNASESEISKAYRKLAKKYHPDLNH------EPGAEE----
DNAJ_CLOAB       ------MANKDYYEVLGLEKGASDDEIKKAFRKLAIKYHPDKNRG-----NKEAEE----
DNAJ_CLOTE       ------MPKKDFYEVLGVEKGANDAEIKKAFRKLALKYHPDKNAG-----NKEAEE----
DNAJ_CLOPE       ------MAKRDYYEVLGLQKGASDDEIKRAFRKMAMKYHPDRNPG-----DKEAEE----
DNAJ_CALS4       ------MPKKDLYEILGVDRNASQEEIKKAYRRLAKKYHPDLNPG-----DKEAEQ----
DNAJ_METAC       -----MATKRDYYEILGLPKDASVEDIKKTYRKLALQYHPDRNK------DPGAED----
DNAJ_METMA       -----MATKRDYYEILGLSKDSSVEDIKKTYRKLALQYHPDRNK------EPGAEE----
DNAJ_BACFR       -----MAEKRDYYEVLEVTKESTVEEIKKAYRKKAIQYHPDKNP-----GDKEAEE----
DNAJ_BACTN       -----MAEKRDYYEVLEVTKTATVEEIKKAYRKKAIQYHPDKNP-----GDKEAEE----
DNAJ_PORGI       -----MAEKRDYYEVLGVSKNATDDELKKAYRKKAIQYHPDKNP-----GDKEAEE----
DNAJ_CHLTE       -------MKRDYYEILGVARSADKDEIKKAYRKLALKYHPDKNP-----DNKEAEE----
DNAJ_THEAC       -------MAKDYYKILGVDRNATDEEIKKAFRELAKKWHPDLHP----ENKQEAEE----
DNAJ_THEVO       -------MAKDYYKILGVDRNASEEDIKKAFRELAKKWHPDLHP----DNKAEAEE----
DNAJ_PICTO       -------MAKDYYAILGVDRNASQDDIKKAFRELAKKYHPDANP----GNK-EAEE----
DNAJ_FUSNN       ------MAKRDYYEVLGIDKSASENDIKKAYRKAAMKYHPDKFANASDAEKKDAEE----
DNAJ_MESFL       ------MAKRDYYEVLGVSKTSTEQEIKSAYRKLAKKYHPDMNK------ESGAEE----
DNAJ_MYCMS       ------MKKKDYYEVLGVSKTASEQEIRQAYRKLAKQYHPDLNK------SPDAHD----
DNAJ_MYCGE       ----MAAGKRDYYEVLGISKNASSQDIKRAFRKLAMQYHPDRHKAENETTQKQNEE----
DNAJ_MYCPN       ----MAAGKRDYYEVLGVSRSATAQDIKRAFRKLAMQYHPDRHKGEGETVQKQNEE----
DNAJ_MYCGA       ----MSS-KRDYYEILEVSRSATQQDIKKAFRKLAMKYHPDRNK------DSDAEE----
DNAJ_MYCPE       ----MSS-KRDYYEVLGVSKDATDDQIKSAFRKKAMQYHPDRNK------EPDAEE----
DNAJ_UREPA       ------MAKRDYYEILGVSKSATPEEIKAAFRKLAKEHHPDRNK-------SADDT----
DNAJ_MYCH2       ------MAKQDFYKILGVEKSASLTEIKKAYRNLVNIYHPDKNT------KKSAEEQKQA
DNAJ_MYCMO       -------MKKDYYEILGLTKSASKDEIKKAYRTLAKTYHPDVNK------ETNAEE----
DNAJ_MYCPU       -----MNKKEDYYKILGIDKSANEKEIKKAYRKLAMEHHPDRSS------SKESEA----
DNAJ_NOSS1       -------MARDYYEILGVARDADKEEIKQAYRRLARKYHPDVNKE------PGAEE----
DNAJ_SYNP6       -------MAADYYQLLGVARDADKDEIKRAYRRLARKYHPDVNKE------PGAED----
DNAJ1_SYNY3      -------MPGDYYQTLGVTRDADKDEIKRAYRRLARKYHPDVNKE------PGAEE----
DNAJ_THEEB       -------MARDFYEILGVSRSADAEELKRAYRRLARKYHPDVNKE------PGAEE----
DNAJ_PROMM       --------MADYYDLLGVSKDADGDTLKRAYRRLARQYHPDINKD------PGAED----
DNAJ_SYNPX       --------MADYYDLLGVGRDADADTLKRAYRSKARKYHPDINKE------PGAED----
DNAJ_PROMA       --------MADFYDTLGVNRNADADSLKRAYRRLARQYHPDINKE------AGAEE----
DNAJ_PROMP       --------MADFYQILGVSRDADANTLKSAYRKLARQYHPDVNKD------PGAED----
DNAJ_GLOVI       -------MARDLYETLNVSRDASKEDIKRAYRKLARQYHPDVNKD------AGAED----
DNAJ1_COREF      -------MARDYYGILGVDRNATDSEIKKAYRKLARKYHPDVNPS------EEAAE----
DNAJ1_CORGL      -------MARDYYGILGVDRNATESEIKKAYRKLARKYHPDVNPG------EEAAE----
DNAJ1_CORDI      -------MARDYYAILGVERDATDNEIKKAYRKLARKYHPDVNDT------EEAAE----
DNAJ2_MYCBO      -------MARDYYGLLGVSKNASDADIKRAYRKLARELHPDVNPD------EAAQA----
DNAJ2_MYCTU      -------MARDYYGLLGVSKNASDADIKRAYRKLARELHPDVNPD------EAAQA----
DNAJ1_MYCPA      -------MARDYYGLLGVSRGASDAEIKRAYRKLARELHPDVNPD------EAAQA----
DNAJ2_MYCLE      -------MARDYYGLLGVSRNASDADIKRAYRKLARELHPDINPD------EAAQA----
DNAJ1_NOCFA      -------MARDYYGLLGVARNATDQEIKRAYRKLARELHPDVNPD------EAAQA----
DNAJ2_STRAW      -------MATDYYAVLGVRRDASQDEIKKAFRRLARELHPDVNPD------PKTQE----
DNAJ2_STRCO      -------MATDYYAVLGVRRDASQDEIKKAFRRLARELHPDVNPD------PKTQE----
DNAJ1_CUTAK      -------MSNDYYEILGVSHDASADEIKKAYRRKAMKLHPDVAG-------PGSEE----
DNAJ_LEIXX       --------MADHYEVLGVERNATPDEIKKAYRRLARELHPDVNPS------TEAQE----
DNAJ_BIFLO       --------MADYYETLGVERGASDDEIKKAYRKLSRKYHPDIAG-------PEFED----
DNAJ_TROW8       --------MEDLYGILGVDHDASVDEIRRAYRRLARELHPDINP--------DSAD----
DNAJ_TROWT       --------MEDLYGILGVDHNASVDEIRRAYRRLARELHPDINP--------DSAD----
DNAJ_THET2       --------MKDYYAILGVSREASQEEIKKAYRRLALKYHPDRNPG-----DKEAEE----
DNAJ1_THET8      --------MKDYYAILGVSREASQEEIKKAYRRLALKYHPDRNPG-----DKEAEE----
DNAJ_DEIRA       ---------MDYYELLGVSRTASADEIKSAYRKLALKLHPDRNK------EEGAAE----
DNAJ_SYMTH       ---MDRLAKRDYYEILGVPRNATEAEIKKAFRNLARKYHPDANKD-----DPDAAE----
DNAJ_METTH       ------MAKRDYYEILGVDRGADKKEIKKAYRRLARKYHPDVS-D-----DPDAAE----
DNAJ_HALMA       -------MSQDFYEILGVSRDASEDEIQEAYREKAREYHPDVS-D-----DPDAEE----
DNAJ_HALSA       -------MSEDFYDVLGVSRDATEDEIMQAYRDQVSEYHPDVS-D-----DPDAEE----
DNAJ1_AROAE      ------MSPTDPHSLLGLSPGAGEREIKHAFRRLAMRWHPDRNAD------PAAIE----
                             :  * :        :   :       ***                   

DNAJ2_COREF      ---FKKAAEAYDVVGDETKRREYDDLKKLLAS-GGIRGG-FGSGGADFPGGFR------S
DNAJ2_CORGL      ---FKKAAEAYDVLGDDKKRKEYDELKALLAS-GGIRGG-FGSGGAGFPGGFRT-----S
DNAJ2_CORDI      ---FKKVAEAYDVVGDETKRKEYDEFRSMIAS-GGF-------GGAGFPGGFRTQ----E
DNAJ1_MYCBO      ---FKAVSEAHNVLSDPAKRKEYDETRRLFAG-GGFGGRRFDSGFGGGFGGFGVGG---D
DNAJ1_MYCTU      ---FKAVSEAHNVLSDPAKRKEYDETRRLFAG-GGFGGRRFDSGFGGGFGGFGVGG---D
DNAJ2_MYCPA      ---FKAVSEAHNVLSDPAKRKEYDETRRLFAG-GGFGGRRFDTG---GFGGFNVGG---D
DNAJ1_MYCLE      ---FKVVSEAHNVLSDPVKRKEYDETRRLFAG-GWLGGRRFDSS----FGDFGMGG---D
DNAJ2_NOCFA      ---FKAVSEAHAVLSDPAKRKEYDETRRLFAG-GGYPRGGFGPG--------GAGG---F
DNAJ1_STRAW      ---FKEISEANDILGDTKKRKEYDEARTLFGN-GGFRPGPGAQGG---------------
DNAJ1_STRCO      ---FKEISEANDILGDPKKRKEYDEARALFGN-GGFRPGPGAGGGG--------------
DNAJ2_CUTAK      ---FKEASEANDVLSNAKKRKEYDQARSLFGSAGGFRFP---RGGA--------------
DNAJ1_AQUAE      --KFKEINEAYHVLIDDERRSEYD----------AILSRNDV------------------
DNAJ2_AQUAE      --KFKEINEAYQVLSDPEKRKLYDMYGHAAFEGAGAQQRVET------------------
DNAJ_THEMA       --RFKEIQEAYEVLSDPQKRAMYDRFGYVG-EQPTYQETESG------------------
DNAJ_BORBU       --IFKEATQAYEILIDDNKKAKYDRFGHSAFEGG------------GFEGFSGGF-----
DNAJ_BORBP       --IFKEATQAYEVLIDDNKKAKYDRFGHSAFEGG------------GFEGFSGGF-----
DNAJ_CAMJE       --KFKLVNEAYEVLSNDEKRAIYDRYGKDALKGG------------GFGSSS--------
DNAJ_CAMJR       --KFKLVNEAYEVLSNDEKRAIYDRYGKDALKGG------------GFGSSS--------
DNAJ_HELHP       --QFKRVNEAYEVLSDDSKRQIYDKYGKEGLQNS------------GFSGFSG-------
DNAJ_WOLSU       --MFKRVNEAYQVLSDEGKRQLYDRYGKQGLESQ------------GYSGFSG-------
DNAJ_HELPJ       --KFKLINEAYGVLGDEKKRALYDRYGKKGLNQA------------GTSQS---------
DNAJ_HELPY       --KFKLINEAYGVLSDEKKRALYDRYGKKGLNQA------------GASQG---------
DNAJ_ECO57       --KFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMG----------GGGFGGG------
DNAJ_ECOL6       --KFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMG----------GGGFGGG------
DNAJ_ECOLI       --KFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMG----------GGGFGGG------
DNAJ_SHIFL       --KFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGGMG----------GGGFGGG------
DNAJ_SALTI       --KFKEIKEAYEVLTDAQKRAAYDQYGHAAFEQGGMGG---G----FGGGFNGG------
DNAJ_SALTY       --KFKEIKEAYEVLTDAQKRAAYDQYGHAAFEQGGMGG---G----FGGGFNGG------
DNAJ_SALPA       --KFKEIKEAYEVLTDAQKRAAYDQYGHAAFEQG-------G----MGGGFNGG------
DNAJ_YERPE       --KFKEAKEAYEILTDAQKRAAYDQYGHAAFEQGGMGG---G----GFGGGGGG------
DNAJ_YERPS       --KFKEAKEAYEILTDAQKRAAYDQYGHAAFEQGGMGG---G----GFGGGGGG------
DNAJ_PECAS       --KFKEIKEAYEILIDSQKRAAYDQYGHAAFEQGGMGG---G----GGGGFGGGG-----
DNAJ_PHOLL       --QFKEVKEAYEILTDDQKRAAYDQYGHAAFEQGGMG--------------GGG------
DNAJ_BLOFL       --KFKEIKEAYEVLSNPEKRSAYDQYGHAIFEQNSGG---------MGGSNTGG------
DNAJ_WIGBR       --KFKEIKEAYEVLLDPKKRAAYNQYGHTAFDQGSS-----------NTEFTSN------
DNAJ_BUCAI       --KFKEIKEAYEILINEEKRSAYDQYGHAAFENGQS---NST----YS-TFTNS------
DNAJ_BUCAP       --KFKEIKEAYEILINEEKRTAYDQYGHAAFENGYNQ--NNT----YS-TFTSS------
DNAJ_BUCBP       --KFKTIKEAYEILIDPKKRTAYDQYGHSAFEQGNSTGNNNT----FTHSFSSN------
DNAJ_VIBVU       --KFKEVKEAYEILTDPQKKAAYDQYGHAAFEQG----GGGF----GGG-FGGGG-----
DNAJ_VIBVY       --KFKEVKEAYEILTDPQKKAAYDQYGHAAFEQG----GGGF----GGG-FGGGG-----
DNAJ_VIBPA       --KFKEVKEAYEVLTDSQKKAAYDQYGHAAFEQG----GGGF----GGG-FGGGG-----
DNAJ_VIBCH       --KFKEVKEAYEILTDAQKKAAYDQYGHAAFEQG----AGGF----GGGGFGGGG-----
DNAJ_PHOPR       --KFKEVKTAYEILTDPQKKAAYDQYGHAAFEQG----SGGG----GYG--GGGG-----
DNAJ_SHEON       --SFKEVKEAYEILTDANKKAAYDQFGHAGVDPN----RGG-----GGG--YGGA-----
DNAJ_IDILO       --KFKEIKQAYEVLSDPQKRQMYDQYGHEAFEQARQG-GAGH----GAGGFGGGG-----
DNAJ_MANSM       --KFKEVNEAYEILMDKEKRAAYDQYGHAAFEQGGF-----G----GGA--GGFG-----
DNAJ_PASMU       --KFKEIQEAYEVLSDKQKRANYDQYGHAAFEQGGF-----G----GG---GFSG-----
DNAJ_HAEIN       --KFKEINEAYEVLGDDQKRAAYDQYGHAAFEQGGG-----A----GGFGGGFGG-----
DNAJ_HAEDU       --KFKQITEAYEILTDDQKRAAYDQYGHAAFEQGSS-----N----GGF--NGFG-----
DNAJ_XANAC       --AFKECKEAYEVLSDGNKRRAYDAHGHAAFEHGM-----------GGGGG-PGG-----
DNAJ_XANCP       --TFKECKEAYEVLSDGNKRRAYDAHGHAAFEHGM-----------GGGGGGPGG-----
DNAJ_XYLFA       --AFKECKEAYEVLADTKKRKLYDTHGHAAFEHGV-----------GGGNA---------
DNAJ_XYLFT       --AFKECKEAYEVLADTKKRKLYDTHGHAAFEHGV-----------GSGNT---------
DNAJ_ACIAD       --KFKEASEAYEVLSDSEKRSMYDRMGHNAFEGGG-----------GGGFGGFSA-----
DNAJ2_AROAE      --HFKEAKNAYEILSDAQKRAAYDRYGHAGVDPSAGAG---P----GGQGFDG-------
DNAJ_CHRVO       --KFKEVKEAYEILSDSQKRGAYDQFGHAGVDPQAGMG---G----GGQGFGG-------
DNAJ_NITEU       --RFKNIKEAYEILSDPNKRAAYDQFGHAGLN----GG---M----GGAGAQG-------
DNAJ_BORPA       --KFKEAKEAYEVLGDEQKRAAYDRYGHAGVDPNAAGMG-GG----MGGGMGGG------
DNAJ_BORPE       --KFKEAKEAYEVLGDEQKRAAYDRYGHAGVDPNAAGMG-GG----MGGGMGGGMG---G
DNAJ_BORBR       --KFKEAKEAYEVLGDEQKRAAYDRYGHAGVDPNAAGMG-GG----MGGG----------
DNAJ_BURMA       --HFKEAKEAYEMLSDGQKRAAYDQYGHAGVDPNVGA----A----GAQGFGG-------
DNAJ_BURPS       --HFKEAKEAYEMLSDGQKRAAYDQYGHAGVDPNVGA----A----GAQGFGG-------
DNAJ_RALSO       --KFKEAKEAYEMLSDADKKAAYDQYGHAGVDPNMAGGF-GA----GAQGFGG-------
DNAJ_LEGPA       --KFKEIQKAYNILSDKQKRAAYDQFGHAGVDPSMGGG--PG----GFGGFGG-------
DNAJ_LEGPH       --KFKEIQKAYNILSDKQKRAAYDQFGHAGVDPSMGGG--PG----GFGGFGG-------
DNAJ_LEGPL       --KFKEIQKAYNILSDKQKRAAYDQFGHAGVDPSMGGG--PG----GFGGFGG-------
DNAJ_PSEPK       --KFKEANEAYEVLSDASKRAAFDQYGHAGVDPSMGGG--G-------AGFGGA------
DNAJ_PSESM       --MFKEANEAYEVLSDASKRAAYDQYGHAGVDPSMGGG--GG----FGGGAGGA------
DNAJ_PSEAE       --KFKEANEAYEVLSDASKRAAYDQYGHAGVDPNMGGG--AG------AGFGGA------
DNAJ_METCA       --RFKSVKEAYDVLSDPKKRSAYDQFGHAGIDPSMGGG--GG------FGFTGD------
DNAJ_COXBU       --KFKEAREAYEVLCDSRKRASYDQFGHAGVEQTFGGA--GA----GGFGFGD-------
DNAJ_NEIMA       --KFKEVQKAYETLSDKEKRAMYDQYGHAAFEGGGQG---------GFGGFGGFG-----
DNAJ_NEIMB       --KFKEVQKAYETLSDKEKRAMYDQYGHAAFEGGGQG---------GFGGFGGFG-----
DNAJ_FRATT       --KFKEISEAYEILSDDSKRSRYDQFGHAGVNQQSG----FG----GTGGFGG-------
DNAJ_AGRFC       --KFKEINEAYETLKDPQKRAAYDRFGHAAFENG--GMGGG-----GMGGGGFAN-----
DNAJ_RHIME       --SFKEINEAYETLKDPQKRAAYDRYGHAAFEQG--GMGAGF----GNGFAGGGA-----
DNAJ_BRUME       --KFKEIGEAYETLKDPQKRAAYDRFGHAAFENG--GMGGGF----GNGFGG--A-----
DNAJ_BRUSU       --KFKEIGEAYETLKDPQKRAAYDRFGHAAFENG--GMGGGF----GNGFGG--A-----
DNAJ_RHILO       --KFKEINEAYETLKDPQKRAAYDRFGHAAFEQG--GMNGG-----AQGFG---A-----
DNAJ_BARHE       --KFKEIGEAYEVLKDPQKRAAYDRFGHAAFENN--NNGGG------SPFSGFSA-----
DNAJ_BARQU       --RFKEIGEAYEVLKDPQKRAAYDRFGHAAFENN--NQGGG------NPFGGFAA-----
DNAJ_BRADU       --KFKEINEAYEVLKDKDKRAAYDRFGHAAFEQG--GPGGG------AGFGAGFA-----
DNAJ_RHOPA       --KFKEINEAYEVLKDGDKRAAYDRYGHAAFEQG--GFGGG------AGFGAGFA-----
DNAJ_CAUVC       --RFKEINEAYSVLSDPQKRAAYDRFGHAGVNGP--QGGPGG----FGGQGFDAS-----
DNAJ_GLUOX       --KFKEINEAYDVLKDEQKRAAYDRYGHDAFEGG--MGGMGG----GFGGGFAGA-----
DNAJ_ZYMMO       --RFKAISEAYDCLKDPQKRAAYDRYGKDAFQGG--GGFGG------FGGGAQDF-----
DNAJ_RICPR       --KFKEINAAYDVLKDEQKRAAYDRFGHDAFQSQ----QARG----GG-NNGSFH-----
DNAJ_RICTY       --KFKEINAAYDVLKDEQKRAAYDRFGHDAFQNQ----QARG----GG-NNSGFH-----
DNAJ_RICCN       --KFKEINAAYDVLKDEQKRAAYDRLGHDAFQNQ----QSRG----GGGNHGGFH-----
DNAJ_RUEPO       --LFKEVNEAYEVLKDAEKKAAYDRFGHAAFEGGMGGGQRPG----GGFGSGDFS-----
DNAJ_ANAMM       --KFKKISEAYEVLSNPEKRAAYDRYGHSTFTSG-----GAS----GFDFTSGFS-----
DNAJ_EHRRW       --KFKELSEAYDVLIDKDKRAAYDRYGHSAFSDGS----GRG----GFDFNSGFS-----
DNAJ_WOLPM       --KFKEVTAAYEVLSDSEKRAGYDRYGHEGASGG------FQ----GFSSAG--------
DNAJ_BDEBA       --KFKEAAGAYEVLSDAQKRAQYDRFGHDAFTR-GGGGGGFT----------DAE-----
DNAJ_DESPS       --LFKECTEAYEVLRDESKRRIYDTYGHEGLK--NNGQRDTG----------GAG-----
DNAJ_DESVH       --KFKEAAEAYDVLRDGEKRARYDRFGHAGVGNGGGFGQGFS----------SNE-----
DNAJ_RHOBA       --KFKEATEAYEVLSDANKRARYDQYGHAGVE---GATQQYG----------DVE-----
DNAJ_CHLCV       --RFKEVSEAYEVLSDPQKRESYDRYGKNGPFAGAGGFGGMGGMGNMEDALRTFM-----
DNAJ_CHLPN       --RFKEVSEAYEVLSDPQKRDSYDRFGKDGPFAGAGGFGGAGGMGNMEDALRTFM-----
DNAJ_CHLMU       --RFKEVSEAYEVLGDAQKRESYDRYGKDGPFAGAGGFGGAG-MGNMEDALRTFM-----
DNAJ_CHLTR       --RFKEVSEAYEVLGDAQKRESYDRYGKDGPFAGAGGFGGAG-MGNMEDALRTFM-----
DNAJ_PARUW       --RFKEISEAYEVLSDEKKRQVYDRYGKEALQGAAGG--GQG-FSSMDEALRTFM-----
DNAJ_TREDE       --KFKEATEAYEILIDEKKRSMYDQFGHAGVDGMSGG----G--GYDPSAFQGFE-----
DNAJ_LEPIC       --KFKEATEAYEILRDPKKRQAYDQFGKAGVSGGAGGFGQGA--------YTDFS-----
DNAJ_LEPIN       --KFKEATEAYEILRDPKKRQAYDQFGKAGVSGGAGGFGQGA--------YTDFS-----
DNAJ_GEOSL       --KFKEITEAYEVLSDPQKRAQYDQFGHAGV--GAGGFSGGG--------FGGFGA----
DNAJ_BACAN       --KFKEVQEAYEVLSDDQKRAQYDQFGHAGA----------------NQGFGGF-----G
DNAJ_BACHK       --KFKEVQEAYEVLSDDQKRAQYDQFGHAGA----------------NQGFGGF-----G
DNAJ_BACCZ       --KFKEVQEAYEVLSDDQKRAQYDQFGHAGA----------------NQGFGGF-----G
DNAJ_BACC1       --KFKEVQEAYEVLSDDQKRAQYDQFGHAGA----------------NQGFGGF-----G
DNAJ_BACCR       --KFKEVQEAYEVLSDDQKRAQYDQFGHAGA----------------NQGFGGF-----G
DNAJ_OCEIH       --KFKEVKEAYEVLSDDQKRAQYDQFGHSGP--Q-------------SQGFGGF-----G
DNAJ_BACHD       --KFKEVKEAFDTLSDPQKKAHYDQFGHTDP----------------NQGFGGG-----G
DNAJ_BACSK       --KFKEVKEAYDTLSDPQKKARYDQFGHADP----------------NQGFGGA-----G
DNAJ_BACLD       --KFKEVKEAYETLSDDQKRAHYDQFGHTDP----------------NQGFGGG-----G
DNAJ_BACSU       --KFKEVKEAYETLSDDQKRAHYDQFGHTDP----------------NQGFGGG-----G
DNAJ_LISIN       --KFKEISEAYEALSDPQKRAQYDQYGHVDP----------------NQGFGGG-A-GGG
DNAJ_LISMF       --KFKEISEAYEALSDPQKRAQYDQYGHVDP----------------NQGFGGG-A-GGG
DNAJ_LISMO       --KFKEISEAYEALSDPQKRAQYDQYGHVDP----------------NQGFGGGGA-GGG
DNAJ_GEOKA       --KFKEIKEAYEVLSDDEKRARYDRFGHADP----------------NETFGGGGFQGGG
DNAJ_STAAC       --KFKEISEAYEVLSDDNKRASYDQFGHDGP----------------QG-FGGQ-----G
DNAJ_STAAM       --KFKEISEAYEVLSDDNKRASYDQFGHDGP----------------QG-FGGQ-----G
DNAJ_STAAN       --KFKEISEAYEVLSDDNKRASYDQFGHDGP----------------QG-FGGQ-----G
DNAJ_STAAS       --KFKEISEAYEVLSDDNKRASYDQFGHDGP----------------QG-FGGQ-----G
DNAJ_STAAW       --KFKEISEAYEVLSDDNKRASYDQFGHDGP----------------QG-FGGQ-----G
DNAJ_STAAR       --KFKEISEAYEVLSDDNKRASYDQFGHDGP----------------QG-FGGQ-----G
DNAJ_STAES       --KFKEISEAYEVLSDENKRANYDQFGHDGP----------------QGGFGSQ-----G
DNAJ_STAEQ       --KFKEISEAYEVLSDENKRVNYDQFGHDGP----------------QGGFGSQ-----G
DNAJ_STRA3       --KYKEVQEAYETLSDTQKRAAYDQYGAAG--A--------------NGGFGGF------
DNAJ_STRA5       --KYKEVQEAYETLSDTQKRAAYDQYGAAG--A--------------NGGFGGF------
DNAJ_STRP3       --KYKDVQEAYETLSDSQKRAAYDQYGAAG--A--------------QGGFGG-------
DNAJ_STRP1       --KYKDVQEAYETLSDSQKRAAYDQYGAAG--A--------------QGGFGG-------
DNAJ_STRP6       --KYKDVQEAYETLSDSQKRAAYDQYGAAG--A--------------QGGFGG-------
DNAJ_STRP8       --KYKDVQEAYETLSDSQKRAAYDQYGAAG--A--------------QGGFGG-------
DNAJ_STRMU       --KYKEIQEAYDTLGDEQKRAAYDQYGPAG--A--------------NGGFGD-------
DNAJ_STRT1       --KYKEILEAYETLSDAQKRAAYDQYGPDG--A--------------NG-FGG-------
DNAJ_STRT2       --KYKEILEAYETLSDAQKRAAYDQYGPDG--A--------------NG-FGG-------
DNAJ_STRPN       --KYKEVQEAYETLSDDQKRAAYDQYGAAG--A--------------NGGFGG-------
DNAJ_STRR6       --KYKEVQEAYETLSDDQKRAAYDQYGAAG--A--------------NGG----------
DNAJ_LACLA       --KYKEVQEAYETLSDEQKRAAYDQYGEAG--A--------------NGGFGGGG----F
DNAJ_ENTFA       --KFKEVSEAYEVLSDPQKKAAYDQYGHAG--T--------------DPNYGG-------
DNAJ_LACPL       --KFKAVNEAYETLGDAQKRAQYDQFGSTG--G--------------QQGFGGAG----G
DNAJ_LACJO       --KYKEVNEAYEVLHDKQKRAQYDQFGQAGVNG--------------QGGFGG-------
DNAJ_CLOAB       --KFKEINEAYQVLSDPDKKANYDRFGTADFN----------------------------
DNAJ_CLOTE       --RFKEINEAYQVLSDPQKRAQYDQFGTADFN----------------------------
DNAJ_CLOPE       --NFKEVNEAYDVLKDPDKKAKYDQFGHAAFDG--------------SGGF---------
DNAJ_CALS4       --KFKEINEAYEILSDPQKRAQYDQFGHAAFEQGGSQ----------QGGFGDFGE---G
DNAJ_METAC       --KFKEISEAYAVLSDTEKRAQYDRFGHAGI----------------DNQYSAEDI----
DNAJ_METMA       --KFKEISEAYAVLSDAEKRAQYDRFGHAGI----------------DNQYSAEDI----
DNAJ_BACFR       --KFKEAAEAYDVLSNPDKRARYDQFGHAGMSGAAGNG--------GPFGGFSG------
DNAJ_BACTN       --KFKEAAEAYDVLSNPDKRSRYDQFGHAGVSGAAGNG--------GPFGGFGGE-----
DNAJ_PORGI       --HFKEVAEAYDVLSDPQKRSQYDQFGHAGLGGAAG-------------GGFSGG-----
DNAJ_CHLTE       --KFKEVNEAYEVLSNDDKRRRYDQFGHAGVGSSAASG--------S--GPGGAG-----
DNAJ_THEAC       --KFKEISEAYEVLSDPQKRRMYDQTGTVDFGAGGQ-------------NFNWDN-----
DNAJ_THEVO       --KFKEISEAYEVLSDPEKRRIYDQTGSVDFGGGGS-------------NFNWDN-----
DNAJ_PICTO       --KFKEIAEAYEVLSDPQKRKQYDETGTTDFNAG-S-------------GFNWQD-----
DNAJ_FUSNN       --KFKEINEAYQILSDSQKKQQYDQFGHAAFEQGGA-------------GFGGGF-----
DNAJ_MESFL       --KFKEVNEAASVLLDADKKAKYDQFGHAAFDGSSGFGGSGFGGFEDFFSNMG-------
DNAJ_MYCMS       --KMVEINEAADVLLDKDKRKQYDQFGHNAFDGSSGFS-SNFADFEDLFSNMGSS-----
DNAJ_MYCGE       --KFKEVNEAYEVLSDEEKRKLYDQFGHEGLNAS-GFHEAGFNPFDIFNSVFGE------
DNAJ_MYCPN       --KFKEVNEAYEVLSDTEKRGMYDRFGHEGLNAS-GFHETGFNPFDIFNSVFGE------
DNAJ_MYCGA       --KFKEVNEAYEVLSDEEKRKLYDTYGHEGLNAS-GFHQGGFNPYDVFNSVFS-------
DNAJ_MYCPE       --KFKEVNQAYEVLSDPDKRANYDRFGHEGVDGQ-FGGGAGFDPFDIFNQFFGGGRG--G
DNAJ_UREPA       --LFKEINEAYEVLSDSKKRAQYDQFGHDG--------PQGFSSASGFSGFSGGF----G
DNAJ_MYCH2       EAKFKEIQEAYEILSDETKRKQYDKFGHAAFD-QQFGG--------GSSGFSGFD-----
DNAJ_MYCMO       --KFKEITEAYEILNDDVKREQYNQFGHAAFD-PNAGGFGGQNPFTNAEGFSGFSD----
DNAJ_MYCPU       --KMREINEAYEVLSNPEKKAIYDKYGHEAANNPGFNGFNAGS--AGFGNFGGFSN----
DNAJ_NOSS1       --RFKEINRAYEVLSEPETRARYDRFGPEGVSGAGV-GFQDM------------------
DNAJ_SYNP6       --KFKEINRAYEVLSEPETRARYDQFGEAGVSGAGAAGFQDF------------------
DNAJ1_SYNY3      --KFKEINRAYEVLSEPEIRQRYDQFGEAGVSGGGAQGFDV-------------------
DNAJ_THEEB       --KFKEINRAYEVLSDPQARANYDRFGEAGVSGVGAAGFSDFG-----------------
DNAJ_PROMM       --RFKEIGRAYEVLSDPQTRGRYDQFGEAGL--GGAAGMPDV------------------
DNAJ_SYNPX       --RFKEIGRAYEVLSDPQTRARYDQFGEAGL--GGAAGASDM------------------
DNAJ_PROMA       --RFKEIGRAYEVLGDPEKRARYDQFGEAGL--GGSAGMPDM------------------
DNAJ_PROMP       --KFKEIGKAYEALADPETRARYDQFGEAGI--GGAAGMPDM------------------
DNAJ_GLOVI       --TFKELSRAYEVLSDDDQRARYDRFGEAGLNGGVGGGPGDFA-----------------
DNAJ1_COREF      --KFREASVAHEVLTDPDKRRIVDMGGDPMEQGGGAG---HPG-----------------
DNAJ1_CORGL      --KFREASVAHEVLTDPDKRRIVDMGGDPMEQGGGAGAGGFGG-----------------
DNAJ1_CORDI      --KFSKISIAQEVLLDAEKRRIVDMGGDPMAQGGGDA-----------------------
DNAJ2_MYCBO      --KFKEISVAYEVLSDPDKRRIVDLGGDPLESAAAGGN----------------------
DNAJ2_MYCTU      --KFKEISVAYEVLSDPDKRRIVDLGGDPLESAAAGGN----------------------
DNAJ1_MYCPA      --KFKEISVAYEVLSDPEKRRIVDLGGDPLEGAAAAGG----------------------
DNAJ2_MYCLE      --KFKEISMAYEVLSDPEKRRIVDLGGDPMENAAASPS----------------------
DNAJ1_NOCFA      --RFKEVSTAYEVLSDPEKRRIVDMGGDPLESGGGAGGF---------------------
DNAJ2_STRAW      --RFKEINAAYEVLSDPQKKQVYDLGGDPLSQSGGGGAGGF-------------------
DNAJ2_STRCO      --RFKEINAAYEVLSDPQKKQVYDLGGDPLSQAAGGGAGGF-------------------
DNAJ1_CUTAK      --EFKKVQEAYEILQDPQKRAVFDRGGDPNARMGGFGEGGF-------------------
DNAJ_LEIXX       --RFKLVTHAYDVLSDPQQRQQYDRGG-----ASGFGGG---------------------
DNAJ_BIFLO       --KFKEVNNAYDVLSNPDKRRMYDSGVDPNNPNAGAGGF---------------------
DNAJ_TROW8       --RFKAVTHAYNILSDPEQRQRYDRHVSG-------------------------------
DNAJ_TROWT       --RFKAVTHAYNILSDPEQRQRYDRHVSG-------------------------------
DNAJ_THET2       --RFKEINEAYAVLSDPKKRAAYDR-----------------------------------
DNAJ1_THET8      --RFKEINEAYAVLSDPKKRAAYDR-----------------------------------
DNAJ_DEIRA       --KFAQVSEAYSVLSDTEKRAHYDRFGSAPGAGMPGG------------DXFGGM-----
DNAJ_SYMTH       --KFKEINEAYQVLSDPEKRARYDQFGHAAEQMGGAGG--------NPFEGFGGF-----
DNAJ_METTH       --KFKEISEAYAVLSDDEKRARYDRFGHAGMD-GFSQE--------DIFNNINFE-----
DNAJ_HALMA       --KFKQAKKAKEVLTDEEKRQMYDQMGHERFEQAEKRG--------GAG-GGGGR-----
DNAJ_HALSA       --KFKKIQKAKDVLTDEETRQQYDQLGHERFEEAEKRG--------ATGNGGGGA-----
DNAJ1_AROAE      --HFKRLRAAYEDLLAEYSRCPAPAAAPHDAQAA--------------------------
                          *   :     :                                        

DNAJ2_COREF      TQGFDASDLFGGAGPGGGFSA-----DGGLGDIFGGIFNRGS------------------
DNAJ2_CORGL      TGGFDTSDLFGG-GQGGGFST-----DGGLGDIFGGLFNRGA------------------
DNAJ2_CORDI      GFDFDLGDIFGS-GAGRGHAP-----QGGFGDIFGGIFNRGG------------------
DNAJ1_MYCBO      GAEFNLNDLFDAASRTGGTT---------IGDLFGGLFGRGG------------------
DNAJ1_MYCTU      GAEFNLNDLFDAASRTGGTT---------IGDLFGGLFGRGG------------------
DNAJ2_MYCPA      GAEFNLNDLFDAAGRSGGTN---------IGDLFGGLFGRAS------------------
DNAJ1_MYCLE      GAEFNLNDLFDAASRTGGTN---------IGDLFGGLFGRGA------------------
DNAJ2_NOCFA      SQGFDIGDIFGGTA-AGDGG---------LGDILGGLFNRGG------------------
DNAJ1_STRAW      SFNFDLGDLFGGGAQQGGGAG--GGFGGGIGDVFGGLFNRGGA-----------------
DNAJ1_STRCO      TFNFDLGDLFGGGAQGGGGQGGAGGFGGGLGDVFGGLFNRTGG-----------------
DNAJ2_CUTAK      QTSVNVEDFLRTASN-----------GDGFGDLFGNLFGASG------------------
DNAJ1_AQUAE      ---GKFRDFL---------------------EYIQEFVE---------------------
DNAJ2_AQUAE      ---TEIPPIE---------------------EILREFFDFDIG-----------------
DNAJ_THEMA       ---GFFDDIF---------------------RDFENIFNRDIF-----------------
DNAJ_BORBU       ---SGFSDIFED-----------------FGDIFDSFFTGN-----KGQERN--------
DNAJ_BORBP       ---SGFSDIFED-----------------FGDIFDSFFTGN-----KGQERN--------
DNAJ_CAMJE       ----SGFGGFED-----------------LGDIFSSFFGEG-----FGSSRR--------
DNAJ_CAMJR       ----SGFGGFED-----------------LGDIFSSFFGEG-----FGSSRR--------
DNAJ_HELHP       ---RDFSDIFGD-----------------LGSIFESAFGAN-----FGFSTQ--------
DNAJ_WOLSU       ---RGFEDVFDD-----------------LGSIFDSVFGGG-----FSSSSR--------
DNAJ_HELPJ       ----DFSDFFED-----------------LGSFFEDAFGFG-----ARGSKR--------
DNAJ_HELPY       ----DFSDFFED-----------------LGSFFEDAFGFG-----ARGSKR--------
DNAJ_ECO57       ---ADFSDI--------------------FGDVFGDIFGGG-----RG------------
DNAJ_ECOL6       ---ADFSDI--------------------FGDVFGDIFGGG-----RG------------
DNAJ_ECOLI       ---ADFSDI--------------------FGDVFGDIFGGG-----RG------------
DNAJ_SHIFL       ---ADFSDI--------------------FGDVFGDIFGGG-----RG------------
DNAJ_SALTI       ---ADFSDI--------------------FGDVFGDIFGGG-----RG------------
DNAJ_SALTY       ---ADFSDI--------------------FGDVFGDIFGGG-----RG------------
DNAJ_SALPA       ---ADFSDI--------------------FGDVFGDIFGGG-----RG------------
DNAJ_YERPE       ---ADFSDI--------------------FGDVFGDIFGGG-----RR------------
DNAJ_YERPS       ---ADFSDI--------------------FGDVFGDIFGGG-----RR------------
DNAJ_PECAS       ---ADFGDI--------------------FGDVFGDIFGGG-----R-------------
DNAJ_PHOLL       ---ADFSDI--------------------FGDVFGDIFGGG-----RR------------
DNAJ_BLOFL       ---SDFSDI--------------------FGDVFGDIFGGS-----R-------------
DNAJ_WIGBR       ---ADFSDI--------------------FGDVFGDIFGNN-----R-------------
DNAJ_BUCAI       ---ADFSDI--------------------FGDVFGDIFGGN-----RT------------
DNAJ_BUCAP       ---TDFGDI--------------------FGDVFGDIFGGS-----RN------------
DNAJ_BUCBP       ---SDFSDI--------------------FGDVFGDIFGGT-----RK------------
DNAJ_VIBVU       ---ADFGDI--------------------FGDVFGDIFGGG-----RRGG----------
DNAJ_VIBVY       ---ADFGDI--------------------FGDVFGDIFGGG-----RRGG----------
DNAJ_VIBPA       ---ADFGDI--------------------FGDVFGDIFGGG-----RRGG----------
DNAJ_VIBCH       ---ADFGDI--------------------FGDVFGDIFGGG-----RRGG----------
DNAJ_PHOPR       ---ADFGDI--------------------FGDVFGDIFGGA-----GGGR----------
DNAJ_SHEON       ---GDFGDI--------------------FGDVFGDIFGGG-----RRGG----------
DNAJ_IDILO       ---ADFADI--------------------FGDVFGDIFGGG-----R-------------
DNAJ_MANSM       ---GGFGGFG-G-----------------FEDIFSEMFGGG-------------------
DNAJ_PASMU       ---ADFGDI--------------------FGDMFGDIFGGG-------------------
DNAJ_HAEIN       ---ADFGDM--------------------FGDIFGDIFGGG-----G-------------
DNAJ_HAEDU       ---GGFGGF---------------------EDIFSEMFGGG-----FGGG----------
DNAJ_XANAC       ---PDMGDI--------------------FGDIFGNIFGGG-----AA------------
DNAJ_XANCP       ---PDMGDI--------------------FGDIFGNIFGGG-----AA------------
DNAJ_XYLFA       ---PDMNDI--------------------FGDIFGNIFGGA-------------------
DNAJ_XYLFT       ---PDMNDI--------------------FGDIFGNIFGGA-------------------
DNAJ_ACIAD       ---EDIFSQ--------------------FGDIFGGAFGGG-----GR------------
DNAJ2_AROAE      -----FADA--------------------FSDIFGDIFGGA------GGA----------
DNAJ_CHRVO       -----FGD---------------------FADIFSDIFGGG-----RGGS----------
DNAJ_NITEU       -----FSDA--------------------FSDIFSDLFGMR-------------------
DNAJ_BORPA       -----FADA--------------------FGDIFGEIFGAG-----RRGG----------
DNAJ_BORPE       GMGGGFADA--------------------FGDIFGEIFGAG-----RRGG----------
DNAJ_BORBR       -----FADA--------------------FGDIFGEIFGAG-----RRGG----------
DNAJ_BURMA       -----FADA--------------------FGDIFGDIFGQA-----AGGGR---------
DNAJ_BURPS       -----FADA--------------------FGDIFGDIFGQA-----AGGGR---------
DNAJ_RALSO       -----FAEA--------------------FGDIFGDIFGQA-----QQGGR---------
DNAJ_LEGPA       -----FGDV--------------------FEDIFENIFSGG-------RG----------
DNAJ_LEGPH       -----FGDV--------------------FEDIFENIFSGG-------RG----------
DNAJ_LEGPL       -----FGDV--------------------FEDIFENIFSGG-------RG----------
DNAJ_PSEPK       ----NFSDI--------------------FGDVFSDFFGGG-------GR----------
DNAJ_PSESM       ----NFSDI--------------------FGDVFSDFFGGG-----RGGG----------
DNAJ_PSEAE       ----SFSDI--------------------FGDVFSDFFGGG------GAR----------
DNAJ_METCA       ----SFSDI--------------------FGDVFGDIFGGG-------------------
DNAJ_COXBU       -----LGDI--------------------FGDIFGDIFGGA-------------------
DNAJ_NEIMA       -----GAQGF-D-----------------FGDIFSQMFGGG-----SG------------
DNAJ_NEIMB       -----GAQGF-D-----------------FGDIFSQMFGGG-----SG------------
DNAJ_FRATT       -----------------------------FEDIFDTFFGGG-----TSRG----------
DNAJ_AGRFC       ---GGFSDI--------------------FEDIFGEMMGGG-----RAR-----------
DNAJ_RHIME       ---HGFSDI--------------------FEDIFGEMMGG------RQR-----------
DNAJ_BRUME       ---GGFADI--------------------FEDIFGEMMGG------GRR-----------
DNAJ_BRUSU       ---GGFADI--------------------FEDIFGEMMGG------GRR-----------
DNAJ_RHILO       ---GGFADI--------------------FEDIFGDMMGG------RQR-----------
DNAJ_BARHE       ---GGFADI--------------------FEDFFGEIMGG------GHR-----------
DNAJ_BARQU       ---GGFSDI--------------------FEDFFGEIMGG------GHR-----------
DNAJ_BRADU       ---SSFSDI--------------------FEDLFG--MAG-------QR-----------
DNAJ_RHOPA       ---SSFSDI--------------------FEDLFG--MAA-------QR-----------
DNAJ_CAUVC       ---DIFNDV--------------------FGDVFGEMFGG-------GR-----------
DNAJ_GLUOX       ---GGLGDI--------------------FDQMFGDMMGG--------------------
DNAJ_ZYMMO       ---GGFSDI--------------------FESVFGEFMGG-------RG-----------
DNAJ_RICPR       ---PDINDI--------------------FGDFFSDFMGS------GRR-----------
DNAJ_RICTY       ---HDINDI--------------------FGDFFSDFMGS------GRR-----------
DNAJ_RICCN       ---PDINDI--------------------FGDFFSDFMGG------SRRS----------
DNAJ_RUEPO       ---SAFSDV--------------------FEDLFGDFMGG------QRG-----------
DNAJ_ANAMM       ---TDFSDI--------------------FQDFFGGGFGKS-----QRAS----------
DNAJ_EHRRW       ---TDFSDI--------------------FNDLFGGGFRGG-----RSSS----------
DNAJ_WOLPM       ----DFSDI--------------------FNDFFGGGFGGG-----ASRSR---------
DNAJ_BDEBA       ---DIFSH---------------------FGDIFGDFFGGG-----MGGQQR--------
DNAJ_DESPS       ---DIFSH---------------------FGDLFG--FGGG-----GG---R--------
DNAJ_DESVH       ---DIFAH---------------------FSDIFGDLFGFA-----GAAGGR--------
DNAJ_RHOBA       ---DIFEA---------------------FGDLFGGGFGDF-----FGGGSR--------
DNAJ_CHLCV       ---GAFGGE--------------------FGGGG-SFFEGL-----FGGLGE--------
DNAJ_CHLPN       ---GAFGGE--------------------FGGG--SFFDGL-----FGGLGE--------
DNAJ_CHLMU       ---GAFGGD--------------------FGGNGGGFFEGL-----FGGLGE--------
DNAJ_CHLTR       ---GAFGGD--------------------FGGNGGGFFEGL-----FGGLGE--------
DNAJ_PARUW       ---GAFG----------------------MGGGGESIFDFF-----GGGNGA--------
DNAJ_TREDE       ---DIFGGS--------------------FSDIFENLFGGG-----FSSRSS--------
DNAJ_LEPIC       ---DIFGD---------------------FGDIFGDFFGGG--------RSS--------
DNAJ_LEPIN       ---DIFGD---------------------FGDIFGDFFGGG--------RSS--------
DNAJ_GEOSL       --GTPFGDI--------------------FGDIFGDIFGG---------RPR--------
DNAJ_BACAN       GGGDFGGGFG-------------------FEDIFSSFFG--------GGGG---------
DNAJ_BACHK       GGGDFGGGFG-------------------FEDIFSSFFG--------GGGG---------
DNAJ_BACCZ       GGGDFGGGFG-------------------FEDIFSSFFG--------GGGG---------
DNAJ_BACC1       GGGDFGGGFG-------------------FEDIFSSFFG--------GGGG---------
DNAJ_BACCR       GGGDFGGGFG-------------------FEDIFSSFFG--------GGGG---------
DNAJ_OCEIH       GGAQDFGGFG---------------------DIFDMFFG--------GGG----------
DNAJ_BACHD       --AGDFGGF---------------------SDIFDMFFG--------GGG----------
DNAJ_BACSK       A-SGDFGGF---------------------SDIFDMFFG--------GGG----------
DNAJ_BACLD       FGGGDFGGFG-------------------FDDIFSSIFG--------GGA----------
DNAJ_BACSU       FGGGDFGGFG-------------------FDDIFSSIFG--------GGT----------
DNAJ_LISIN       FGGGGFSGF---------------------EDIFDTFFG--------GGG----------
DNAJ_LISMF       FSGGGFSGF---------------------EDIFDTFFG--------GGG----------
DNAJ_LISMO       FGGGGFSGF---------------------EDIFDTFFG--------GGG----------
DNAJ_GEOKA       FDFGGFSGFGG------------------FEDIFETFFG--------AGP----------
DNAJ_STAAC       FNGSDFGGFSGFGG-------------GGFEDIFSSFFG--------GG-----------
DNAJ_STAAM       FNGSDFGGFSGFGG-------------GGFEDIFSSFFG--------GG-----------
DNAJ_STAAN       FNGSDFGGFSGFGG-------------GGFEDIFSSFFG--------GG-----------
DNAJ_STAAS       FNGSDFGGFSGFGG-------------GGFEDIFSSFFG--------GG-----------
DNAJ_STAAW       FNGSDFGGFSGFGG-------------GGFEDIFSSFFG--------GG-----------
DNAJ_STAAR       FNGSDFGGFSGFGG-------------GGFEDIFSSFFG--------GG-----------
DNAJ_STAES       FGGSDF---------------------GGFEDIFSSFFG--------GGS----------
DNAJ_STAEQ       FGGSDF---------------------GGFEDIFSSFFG--------GGS----------
DNAJ_STRA3       -DGGGFGGFDGG------GF-------GGFEDIFSSFFG--------GGGM---------
DNAJ_STRA5       -DGGGFGGFDGG------GF-------GGFEDIFSSFFG--------GGGM---------
DNAJ_STRP3       -GAGGFGGFDGG------GF-------GGFEDIFSSFFG--------GGGS---------
DNAJ_STRP1       -GAGGFGGFDGG------GF-------GGFEDIFSSFFG--------GGGS---------
DNAJ_STRP6       -GAGGFGGFDGG------GF-------GGFEDIFSSFFG--------GGGS---------
DNAJ_STRP8       -GAGGFGGFDGG------GF-------GGFEDIFSSFFG--------GGGS---------
DNAJ_STRMU       --GSGFSGFDSS------GF-------GGFEDIFSSFFG--------GGAS---------
DNAJ_STRT1       --QGSFGGFDGGA-----GF-------GGFEDIFSSFFG--------GGAT---------
DNAJ_STRT2       --QGSFGGFDGGA-----GF-------GGFEDIFSSFFG--------GGAT---------
DNAJ_STRPN       --AGGFGGFNGAG-----GF-------GGFEDIFSSFFG--------GGGSS--------
DNAJ_STRR6       -----FGGFNGAG-----GF-------GGFEDIFSSFFG--------GGGSS--------
DNAJ_LACLA       GGASGFSGFGGGSG----GF-------GGFEDIFSSFFG--------GGGAQ--------
DNAJ_ENTFA       -GAGGFGGFGGGGFSSS-GF-------GGFEDIFDSFFG--------GGGGR--------
DNAJ_LACPL       FGGQDFGGFGGG---------------GGFEDIFSSFFG--------GGAGG--------
DNAJ_LACJO       ---QGFGGFGGQGGYSSQGF-------GDFGDIFGDIFGSA-----FGGGRS--------
DNAJ_CLOAB       -GGGGFGDFSGG----FGDF-------GDLGDIFNSFFGGG-----FSG-G---------
DNAJ_CLOTE       -GGG--AGFSG-----FEDF--------DLGDIFESFFGGG-----FGGFG---------
DNAJ_CLOPE       -GGGGFGGFDAGGF-DFSEM-------GGFGDIFESFFGGG-----FGG-----------
DNAJ_CALS4       GFDFDFGGFGDI-----------------FGDIFSDFFG--------TGRR---------
DNAJ_METAC       FRGADFGGFG---------------------DIFEMFFG--------GGRR---------
DNAJ_METMA       FRGADFGGFG---------------------DIFEMFFG--------GGRR---------
DNAJ_BACFR       --GMSMDDI---------------------FSMFGDIFGGHSGGGFGGGF----------
DNAJ_BACTN       --GMSMDDI---------------------FSMFGDIFGGR-GGGFSGGF----------
DNAJ_PORGI       --GMSMEDI---------------------FSRFGDLFGGF------GGF----------
DNAJ_CHLTE       --YGDINDI---------------------FSAFNDMFSGGGGRARTGGSPFSGFEDVFS
DNAJ_THEAC       --FTHYSDL---------------------NDIFNDIFGGN----FASDF----------
DNAJ_THEVO       --FTHFSDI---------------------NDIFNEIFGGN----FGSDF----------
DNAJ_PICTO       --FTHFDDI---------------------NDIFNQFFGGN----FGDTF----------
DNAJ_FUSNN       --NAGGFDF---------------------GDIFGDIFGGG----GFGGFE---------
DNAJ_MESFL       ----GGMDFG---------------------DIFSDLFGG-GR-----------------
DNAJ_MYCMS       ----GFSSFT---------------------NIFSDFFG---------------------
DNAJ_MYCGE       GFSFGMDGD----------------------SPFDFIFNR-SK-----------------
DNAJ_MYCPN       GFSFDMDGG----------------------SPFDFIFSR-GK-----------------
DNAJ_MYCGA       GFDFEGGFG----------------------DVFSQFFGGGGS-----------------
DNAJ_MYCPE       GAHFEQSFGG---------------------SGFEDIFSNFFG-----------------
DNAJ_UREPA       GVDFDINDI------------------------FGSFFNNASS-----------------
DNAJ_MYCH2       --------FG---------------------DIFSSFTSGFGFG----------------
DNAJ_MYCMO       -----FSGFG---------------------SIFTDFFGGFGN-----------------
DNAJ_MYCPU       -----FGGFD---------------------SIFEEFFGGSRS-----------------
DNAJ_NOSS1       ------SDMG------------------GFADIFESIFSGFAG-----------------
DNAJ_SYNP6       ------GDMG------------------GFADIFETFFSGF-------------------
DNAJ1_SYNY3      ------GNMG------------------DFADIFETIFGGF-G-----------------
DNAJ_THEEB       -----IGDMG------------------GFADIFETFFGGF-------------------
DNAJ_PROMM       ------GDMG------------------GFADLFETFFSGF-------------------
DNAJ_SYNPX       ------GDMG------------------GFADLFETFFQGF-------------------
DNAJ_PROMA       ------GDMG------------------GFADIFETFFSGF-------------------
DNAJ_PROMP       ------GDMG------------------GFGDLFETFFNGF-------------------
DNAJ_GLOVI       ----GAAGFG------------------DISDIFESFFGGF-------------------
DNAJ1_COREF      ----GFG-SG------------------GLGDIFDAFFGG--------------------
DNAJ1_CORGL      ----GFGGSG------------------GLGDIFDAFFGG--------------------
DNAJ1_CORDI      ----GYGAGG------------------GLGDIFEAFFGG--------------------
DNAJ2_MYCBO      ----GFGGFG------------------GLGDVFEAFFGGG-------------------
DNAJ2_MYCTU      ----GFGGFG------------------GLGDVFEAFFGGG-------------------
DNAJ1_MYCPA      ----GFGGFG------------------GLGDVFEAFFGGG-------------------
DNAJ2_MYCLE      ----GFGGFG------------------GLGDVFEAFFGG--------------------
DNAJ1_NOCFA      ----SGAGFG------------------GLGDVFEAFFGGM-------------------
DNAJ2_STRAW      ----GAGGFG------------------NFSDIMDAFFGTA-------------------
DNAJ2_STRCO      ----GAGGFG------------------NFSDIMDAFFGTA-------------------
DNAJ1_CUTAK      ----SSAGF-------------------DFTNLVDAMFGGS-------------------
DNAJ_LEIXX       ----GGADFS------------------GFGDIFETFFGGG-------------------
DNAJ_BIFLO       ----SGAGFG------------------DMSDVFSTFFGSA-------------------
DNAJ_TROW8       ----GFSSDF------------------NLSDLFQSFFDT--------------------
DNAJ_TROWT       ----GFSSDF------------------NLSDLFQSFFDT--------------------
DNAJ_THET2       ---GHLEAPEYRPE-----------------DLFDLFFQEV-------------------
DNAJ1_THET8      ---GHLEAPEYRPE-----------------DLFDLFFQEV-------------------
DNAJ_DEIRA       ---GGMGGVGFDPM-----------------DIFEQLFGGA-------------------
DNAJ_SYMTH       ---GDFGGFS---------------------DIFEMFFGG--------------------
DNAJ_METTH       ---DIFSGLGFDIG-----------------NIFDMFGFG--------------------
DNAJ_HALMA       ---GGMGG--DPFGGGAGGF--------DMQDIFDQFFGG--------------------
DNAJ_HALSA       ---GGMGGAGGPFGGGMGGGAG-----GGMGDIFEQFFGGA-------------------
DNAJ1_AROAE      -------------------------------DARPEPPPE--------------------
                                                                             

DNAJ2_COREF      ---------SPRQSARPTRGADVETDITLEFREAAKGTTIPVELTGEAPCNTCHGSG-SA
DNAJ2_CORGL      ---------GSHQSARPTRGADVQTEITLSFVEAAKGTTIPVELTGDAPCNTCHGSG-SK
DNAJ2_CORDI      ---------GARNAARPTRGSDVETEITLEFREAAKGTTIPLQLTGDAPCHTCHGSG-SR
DNAJ1_MYCBO      ---------SAR-PSRPRRGNDLETETELDFVEAAKGVAMPLRLTSPAPCTNCHGSG-AR
DNAJ1_MYCTU      ---------SAR-PSRPRRGNDLETETELDFVEAAKGVAMPLRLTSPAPCTNCHGSG-AR
DNAJ2_MYCPA      ---------GGR-PSRPRRGNDLETETQLDFVEAAKGVAMPLRLTSPAPCTNCHGSG-AR
DNAJ1_MYCLE      ---------SVR-PSRPRRGNDLETEADLDFVEAAKGVAMPLRLTSPAPCTNCHGSG-AR
DNAJ2_NOCFA      ---------TRT-TSRPRRGADVETETTLGFREAAQGVTVPLRMTSPSPCTTCHGSG-AK
DNAJ1_STRAW      -------GPGTGTRTQPRRGQDIESEVTLSFTEAVDGATVPLRMSSQAPCKACSGTG-DA
DNAJ1_STRCO      -------GPGTGTRTQPRRGQDIESEVTLSFTEAIEGATVPLRMSSQAPCKACSGTG-DK
DNAJ2_CUTAK      -------GRRTASRS-PRRGADVEGETTISFDDAVSGTTVTMDMVSQAPCQACRGTG-AR
DNAJ1_AQUAE      SIIQGEKGKK----RRPRKGQDIKMKLPLTLEEAGLGCEKEIIYSRWMDCPVCEGMGVKG
DNAJ2_AQUAE      SIFERATGRRRARRRRSVKGEDIVVPVEITLEEAFKGTTVPIEVEREVPCSACGGTGYD-
DNAJ_THEMA       DVFFGERPHQEERREYARRGEDIRYEIEVTLSDLINGAEIPVEYERYETCPRCGGTGVEP
DNAJ_BORBU       ---RKHAK-----------GEDLGYNIEISLENAYFGYKNNINITRQMLCDSCLGKK-SE
DNAJ_BORBP       ---RKHAR-----------GEDLGYNIEISLENAYFGYKNNINITRQILCHSCLGKK-SE
DNAJ_CAMJE       ---RKSSN-------DEKIPSDFIVNLKLSFKEAVFGCKKNIDFTYKCSCKTCNGTG-AK
DNAJ_CAMJR       ---RKSSN-------DEKIPSDFIVNLKLSFKEAVFGCKKNIDFTYKCSCKTCNGTG-AK
DNAJ_HELHP       ---KRGGG---------KYNLDEIVGLELSFTEAVFGCKKEIHNSFKIACSDCKGTG-AK
DNAJ_WOLSU       ---KRSGP---------KYNLDLAMELDLSFKEAIFGCKKEIKIRYKDACPDCKGTG-AK
DNAJ_HELPJ       ---QKSS-----------IAPDYLQMIELSFKEAVFGCKKTIKAQYQSVCESCDGTG-AK
DNAJ_HELPY       ---QKSS-----------IAPDYLQTLELSFKEAVFGCKKTIKVQYQSVCESCDGTG-AK
DNAJ_ECO57       ------RQ-------RAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSG-AK
DNAJ_ECOL6       ------RQ-------RAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSG-AK
DNAJ_ECOLI       ------RQ-------RAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSG-AK
DNAJ_SHIFL       ------RQ-------RAARGADLRYNMELTLEEAVRGVTKEIRIPTLEECDVCHGSG-AK
DNAJ_SALTI       ------RQ-------RAARGADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSG-AK
DNAJ_SALTY       ------RQ-------RAARGADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSG-AK
DNAJ_SALPA       ------RQ-------RAARGADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSG-AK
DNAJ_YERPE       ------QQ-------RASRGSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSG-AK
DNAJ_YERPS       ------QQ-------RASRGSDLRYNMDLTLEEAVRGVTKEIRIPTLDECDVCHGSG-AK
DNAJ_PECAS       ------RQ-------RASRGSDLRYNMELSLEEAVRGVTKEIRIPALEECDVCHGNG-AK
DNAJ_PHOLL       ------QQ-------RPSRGADLRYSMELTLEEAVRGVTKEIRIPTLETCDICHGSG-AK
DNAJ_BLOFL       ------RS-------RSRRGSDLRYDIELSLEEAVKGVVREICVPTLVTCLQCRGSG-AK
DNAJ_WIGBR       ------RK-------RSNRGSDLQYNINLSLEEAVKGISKEITIPKLERCNICSGKG-MQ
DNAJ_BUCAI       ------QR--------AKKGADLCYNMEITLEEAVKGIKKEIQIPTLQKCKTCYGSG-TR
DNAJ_BUCAP       ------QR--------VKKGADLCYNMEISLEEAVKGTTKEIRIPTFQKCKTCYGMG-TS
DNAJ_BUCBP       ------QK-------SERQGSDLRYDMTLTLEEAVRGTIKEIKIPTLQKCPTCYGYG-TK
DNAJ_VIBVU       ----GH-A-------RPQRGADLRYNMELSLEEAVRGVSKEIEVPTLVHCDTCEGTG-AK
DNAJ_VIBVY       ----GH-A-------RPQRGADLRYNMELSLEEAVRGVSKEIEVPTLVHCDTCEGTG-AK
DNAJ_VIBPA       ----GG-H-------RAQRGADLRYNMELTLEEAVRGVTKEIEVPTLVHCDSCDGSG-AK
DNAJ_VIBCH       ----G--P-------RAQRGSDLRYNMELSLEEAVRGCSKEIEVPTLVHCDACDGSG-AK
DNAJ_PHOPR       ----RQQQ-------RAQRGSDLRYNMELTLEEAVRGCSKEIRVPTLVGCDSCDGSG-AK
DNAJ_SHEON       ----GQ-R-------QAARGSDLRYNLELSLEEAVKGLTKELRIPTLASCDVCDGSG-AK
DNAJ_IDILO       ----RQQA-------RAQRGADLRYNLDMSLEEAVRGKTVELEIPTLVECRDCNGSG-AK
DNAJ_MANSM       ----ASRQ-------RVVRGEDLRYDIEITLEEAVRGTTKDIKINTLAACDHCDGSG-AE
DNAJ_PASMU       ----RARQ-------RVVRGDDLRYDLEISLEEAVRGTTKDIQINTLAHCDSCDGSG-AE
DNAJ_HAEIN       ----RGRQ-------RVVRGEDLRYDLEISLEEAVKGTTKDIQINTLAHCDSCGGSG-AE
DNAJ_HAEDU       ----SRRQ-------HVVRGQDLRYDIEISLEEAVKGCKKDIRLSTLAECDNCHGTG-AE
DNAJ_XANAC       -----GPR-------AARRGADVGYVLELDLEEAVAGIERRIEIPTLIECAPCHGSG-SE
DNAJ_XANCP       -----GPR-------AARRGADVGYVLELDLEEAVAGIERRIEIPTLIECEPCHGSG-SE
DNAJ_XYLFA       -------R-------ASRRGADVGYMVELDLEEAVAGVERQIQIPTLVECTHCHGSG-SE
DNAJ_XYLFT       -------R-------ASRRGADVGYMVELDLEEAVAGVERQIQIPTLVECTHCHGSG-SE
DNAJ_ACIAD       -----QQQ-------RQRRGSDLRYVMELSLEEAVRGVKKTITFTAPAPCEVCDGKG-SK
DNAJ2_AROAE      ---GRGRS-------NVYRGADLRYNLEISLEEAARGADKTIRIPTVEECETCHGSG-AK
DNAJ_CHRVO       ---GGGRS-------NVYRGADLRYNMEITLEEAARGCEKQIRIPSHESCSTCNGTG-AK
DNAJ_NITEU       ---GGGRS-------SVHRGADLRYNLEITLEQAARGAETQIRIPRQEVCDTCHGSG-AK
DNAJ_BORPA       -----GGP-------QVYRGADLKYALEITLEQAASGFDTEIRVPSWENCDTCHGSG-AK
DNAJ_BORPE       -----GGP-------QVYRGADLKYALEITLEQAASGFDTEIRVPSWENCDTCHGSG-AK
DNAJ_BORBR       -----GGP-------QVYRGADLKYALEITLEQAASGFDTEIRVPSWENCDTCHGSG-AK
DNAJ_BURMA       ---ARGGP-------QVYRGADLRYSMEITLEQAAHGYDTQIRVPSWAACGVCHGSG-AK
DNAJ_BURPS       ---ARGGP-------QVYRGADLRYSMEITLEQAAHGYDTQIRVPSWAACGVCHGSG-AK
DNAJ_RALSO       ---RGAGP-------QMYRGADLRYSMEITLEQAAHGYDTQIRVPHWDECDHCHGKG-AE
DNAJ_LEGPA       ---HGRQS-------RGQRGADLQFNVQLTLEEAAIGKEVEITVPRHGTCTVCEGSG-AK
DNAJ_LEGPH       ---HGRQS-------RGQRGADLQFNVQLTLEEAAIGKEVEITVPRHGTCTVCEGSG-AK
DNAJ_LEGPL       ---QGRQS-------RGQRGADLQFNVQLTLEEAAIGKEVEITVPRHGTCTVCEGSG-AK
DNAJ_PSEPK       ---GGGRG-------GAQRGSDLRYTLELNLEEAVRGTTVSIRVPTLVNCQPCDGSG-AK
DNAJ_PSESM       ---GGGRG-------GAQRGSDLRYTLELNLEEAVRGTTVNIRVPTLVNCKPCDGSG-AK
DNAJ_PSEAE       ---GGSRG-------GAQRGADLRYTLDLDLEEAVRGTTVTIRVPTLVGCKTCNGSG-AK
DNAJ_METCA       ---GRRRG-------RGQRGSDLRYNLELTLEEAVAGTEAKIKVPTWVTCTECGGSG-AK
DNAJ_COXBU       ---RGGQA-------REQRGADLAYELVLSLEEAVHGLSRTIKVPTWINCKTCNGSG-AK
DNAJ_NEIMA       -----RAQ-------PDYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSG-AK
DNAJ_NEIMB       -----RAQ-------PDYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSG-AK
DNAJ_FRATT       ----SNRS-------RASRGSDLEYTLEITLEEAFFGVEKEITIPRMESCDSCDGTG-SK
DNAJ_AGRFC       ----RSSG-------GRERGADLRYNMEITLEEAFAGKTAQIRVPTSITCDVCSGSG-AK
DNAJ_RHIME       ----RSSG-------GRERGADLRYNMEISLEEAYSGKTAQIRVPTSITCDVCTGTG-AK
DNAJ_BRUME       ----RSNG-------GRERGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSG-AK
DNAJ_BRUSU       ----RSNG-------GRERGADLRYNMEVTLEEAYAGKTAQIRVPTSITCDECSGSG-AK
DNAJ_RHILO       ----RSSG-------GRERGADLRYNMEISLEEAFAGKTAQIRVPASISCTECSGSG-AK
DNAJ_BARHE       ----KRSD-------GRERGADLSYNMEVTLEEAFSGKTAQINIPSSVVCDACEGSG-AK
DNAJ_BARQU       ----KRSD-------GRERGADLSYNMEVTLEEAFSGKTAQINIPSSIVCDSCEGSG-AK
DNAJ_BRADU       ----GRG--------GRERGADLRYNMEITLEEAFGGKTAQIEIPVSVTCEACSGIG-AK
DNAJ_RHOPA       ----GRGT-------GRERGADLRYNMEITLEDAFKGKTAQIEIPVSVTCEACSGTG-AK
DNAJ_CAUVC       ----RQSN-------APQRGQDLRYDLEITLEQAYAGAEVEITVPAAMTCEVCEGSG-AK
DNAJ_GLUOX       ----RRDG-------GRRTGADVQVQVEITLMEAFTGVTKDVEVRTRVTCEACHGSGSAD
DNAJ_ZYMMO       ----QARS-------SVQRGADLRYDLKISLEEAFKGKTVDIEIDVASVCDACHGSG-AK
DNAJ_RICPR       ----KQTS-------SKIRGSDLKYDLTIKLEEAFHGIEKNISFSSEVKCDTCHGTG-SE
DNAJ_RICTY       ----KQTS-------SKIRGSDLKYDLTIKLEEAFHGIEKNISFSSEVKCDACHGTG-SE
DNAJ_RICCN       ---SRPTS-------AKVRGSDLKYNLTINLEEAFHGIEKNISFSSAVKCDTCHGSG-SE
DNAJ_RUEPO       ----GGGR-------RAARGSDLRYNLRVTLEEAFSGLQKTINVPTAVACSSCEGTG-AE
DNAJ_ANAMM       ----SRE---------HLRGSDLRYDVEVSLEDAFKGIKVPISYVTNVKCSSCSGIG-SE
DNAJ_EHRRW       ----KRQD-------GGTVGSDLRLDIEITLEDSFNGTKVPINYVTHVKCSSCSGSG-SE
DNAJ_WOLPM       ---AKRST-------TGVSGADLRYDLEITLEDAFKGIQAPIHYVTNVKCDTCQGTG-GE
DNAJ_BDEBA       ---QRRNR------NEPRRGSDLRYVTEITLKDVITGIEKEIEFDTDKNCDECKGTG-AE
DNAJ_DESPS       ---SQARR------NGPIEGNDLRYDVSISFMESIQGVSKEVKLSRRETCWTCEGTG-SR
DNAJ_DESVH       ---SRG--------PRPQAGSDLRYNLTISFRQAAKGDEVTLRLPKSVPCDECGGSG-AA
DNAJ_RHOBA       ---RGGGR------RRVRRGADVRCDVTLTLEEAARGCHKDIVFRRRVSCDTCDGSG-AA
DNAJ_CHLCV       ---AFGMRGDP---AGARQGASKKVHITLTFEEAARGVEKELLVSGYKTCETCLGSG-AA
DNAJ_CHLPN       ---AFGMRSDP---AGARQGASKKVHINLTFEEAAHGVEKELVVSGYKSCETCSGQG-AV
DNAJ_CHLMU       ---AFGMRGGS---EGARQGASKKVHITLSFEEAAKGVEKELLVSGYKSCDACSGSG-AK
DNAJ_CHLTR       ---AFGMRGGS---ESSRQGASKKVHITLSFEEAAKGVEKELLVSGYKSCDACSGSG-AN
DNAJ_PARUW       ---EFGGREGG---RGARQGASKRVNINVSFEEAVKGVDKELVISNYANCNVCNGKG-SS
DNAJ_TREDE       ---GFGGRH-----AGPVRGSNLRYDLQISFVDAVYGKKAELSYTRNEKCSECHGTG-SE
DNAJ_LEPIC       ---GFGGGR-R---SGPQRGSDLRYNLEVSLEDAALGREYKIEIPRLESCVDCNGSG-AS
DNAJ_LEPIN       ---GFGGGR-R---SGPQRGSDLRYNLEVSLEDAALGREYKIEIPRLESCVDCNGSG-AS
DNAJ_GEOSL       ---GSRG----------RRGDDLQYNMELSFEEAAFGAEKEIQVPYGKRCGDCGGSG-AK
DNAJ_BACAN       ----RRRDPN-----APRQGADLQYQVTLEFEEAIFGKELNVEIPVEDPCDTCKGSG-AK
DNAJ_BACHK       ----RRRDPN-----APRQGADLQYQVTLEFEEAIFGKELNVEIPVEDPCDTCKGSG-AK
DNAJ_BACCZ       ----RRRDPN-----APRQGADLQYQVTLDFEEAIFGKELNVEIPVEDPCDTCKGSG-AK
DNAJ_BACC1       ----RRRDPN-----APRQGADLQYQVTLDFEEAIFGKELNVEIPVEDPCDTCKGSG-AK
DNAJ_BACCR       ----RRRDPN-----APRQGADLQYQVTLDFEEAIFGKELNVEIPVEDPCDTCKGSG-AK
DNAJ_OCEIH       ----RSRDPN-----APQQGNDLQYTMILDFEEAVFGKETDIEIPKEESCDTCNGSG-AK
DNAJ_BACHD       ----GRRNPN-----APRQGADLQYTMTLEFKEAVFGKETTIEIPREETCHTCSGSG-AK
DNAJ_BACSK       ----GRRNPN-----APRQGDDLQYTMTLEFKEAVFGKETEIEIPREETCGTCHGSG-AK
DNAJ_BACLD       ----RRRDPN-----APRQGADLQYTMTLSFEEAAFGKETTIEIPREETCETCSGSG-AK
DNAJ_BACSU       ----RRRDPN-----APRQGADLQYTMTLSFEDAAFGKETTIEIPREETCETCKGSG-AK
DNAJ_LISIN       ----RQQDPN-----APRQGSDLQYTMRLKFKEAIFGKDAEIEIPREENCDTCHGSG-AK
DNAJ_LISMF       ----RQQDPN-----APRQGSDLQYTMRLKFKEAIFGKDAEIEIPREENCDTCHGSG-AK
DNAJ_LISMO       ----RQQDPN-----APRQGSDLQYTMRLKFKEAIFGKDAEIEIPREENCDTCHGSG-AK
DNAJ_GEOKA       -----RRRAS-----GPRKGADVEYMMTLTFEEAAFGKETEIEIPREETCDTCQGSG-AK
DNAJ_STAAC       ----RQRDPN-----APQKGDDLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDG-AK
DNAJ_STAAM       ----RQRDPN-----APQKGDDLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDG-AK
DNAJ_STAAN       ----RQRDPN-----APQKGDDLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDG-AK
DNAJ_STAAS       ----RQRDPN-----APQKGDDLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDG-AK
DNAJ_STAAW       ----RQRDPN-----APQKGDDLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDG-AK
DNAJ_STAAR       ----RQRDPN-----APQKGDDLQYTMTLTFEEAVFGTTKEISIRKDVTCETCHGDG-AK
DNAJ_STAES       ----RQRDPN-----APRKGDDLQYTMTITFEEAVFGTKKEISIKKDVTCHTCNGDG-AK
DNAJ_STAEQ       ----RQRDPN-----APRKGDDLQYTMTITFEEAVFGTKKEISIKKDVTCHTCNGDG-AK
DNAJ_STRA3       ------RNPN-----APRQGDDLQYRVNLSFEEAIFGAEKEVSYNRESSCHTCSGSG-AK
DNAJ_STRA5       ------RNPN-----APRQGDDLQYRVNLSFEEAIFGAEKEVSYNRESSCHTCSGSG-AK
DNAJ_STRP3       ------RNPN-----APRQGDDLQYRVNLSFEEAVFGVEKEVSYNREATCGTCLGSG-AK
DNAJ_STRP1       ------RNPN-----APRQGDDLQYRVNLSFEEAVFGVEKEVSYNREATCGTCLGSG-AK
DNAJ_STRP6       ------RNPN-----APRQGDDLQYRVNLSFEEAVFGVEKEVSYNREATCGTCLGSG-AK
DNAJ_STRP8       ------RNPN-----APRQGDDLQYRVNLSFEEAVFGVEKEVSYNREATCGTCLGSG-AK
DNAJ_STRMU       ------RNPN-----APRQGDDLQYRVNLQFEEAVFGTEKEVHYNREASCHTCNGSG-AK
DNAJ_STRT1       ------RNPN-----APRQGDDLQYRVNLSFEEAVFGAEKEIHYNREVTCKTCSGSG-AK
DNAJ_STRT2       ------RNPN-----APRQGDDLQYRVNLSFEEAVFGAEKEIHYNREVTCKTCSGSG-AK
DNAJ_STRPN       ------RNPN-----APRQGDDLQYRVNLTFEEAIFGTEKEVKYHREAGCRTCNGSG-AK
DNAJ_STRR6       ------RNPN-----APRQGDDLQYRVNLTFEEAIFGTEKEVKYHREAGCRTCNGSG-AK
DNAJ_LACLA       ------VNPN-----APRQGDDLQYRINLKFEEAIFGVEKQVKYNREELCHTCGGSG-AK
DNAJ_ENTFA       ---S--VDPN-----APRQGADLQYTIQLKFEEAIFGVEKEIKYNREDTCATCGGNG-AK
DNAJ_LACPL       ---SRRSNPT-----APQQGRDLQYEMTLKFEDAIFGKKTTITYNREEQCETCGGSG-AK
DNAJ_LACJO       ---R--VDPT-----APQKGQDLDYTMTIDFMDAIKGKKTDITYTRSEVCPTCDGSG-AE
DNAJ_CLOAB       ---SSRARKD-----APQRGNDMEYSISLTFEEAVFGVEKSINITRSENCETCGGTG-AK
DNAJ_CLOTE       ---GSSRRRN-----GPQKGPDVQYSINLTFNEAVFGVEKEVSITKSETCETCTGTG-AK
DNAJ_CLOPE       ---GSSRRRN-----APQRGADLEYRLNITFEEAVFGCEKEISITRTENCETCHGTG-AK
DNAJ_CALS4       ------KAEK-----GPKKGADIRYDLTLTFEEAAFGTEKEIEVERFEVCDVCHGTG-VK
DNAJ_METAC       ------GGPM-----GPRRGSDLQYDLYITFEEAAFGVRKDIDIPRTERCSTCSGTG-AK
DNAJ_METMA       ------GGPM-----GPRRGSDLQYDLYVTFEEAAFGVRKDIDIPRTERCSTCSGTG-AK
DNAJ_BACFR       GGFGGFGGGG--SQQRKFRGSDLRVKVKLNLKEISTGVEKKFKLKKYIPCSHCHGTG-AE
DNAJ_BACTN       GGFSGFGGGGGGSQQRRYRGSDLRVKVKMTLKEISTGVEKKFKLKKYVPCNHCHGTG-AE
DNAJ_PORGI       GGFSDMGGGS---RRRVRRGSDLRVRVKLSLADISKGVEKKVKVKKQVVCSKCRGDG-TE
DNAJ_CHLTE       GGFSGSGSGR--RRSAGIQGTDLKIRLKLTLEEIAKGVEKTIKIKKLVTCRECNGTG-SK
DNAJ_THEAC       --FSGFGRGQ--RE--EQYDLDLYTNLDITLEDAYYGTEKRIKYRRNAMCPDCNGTG-AK
DNAJ_THEVO       --FSGFGNRQ--ST--RNIDLDMYTNLDISLEEAYYGTEKRIKFRRNAICPDCKGTG-AK
DNAJ_PICTO       --FGGYTN---------QPDLDIYLRVNISLEDAYYGASKNVKYRRNAMCEHCSGTG-AE
DNAJ_FUSNN       -GFSGFGGSS--RRSYVEPGNDLRYNLEITLEEAAKGVEKTIKYKRTGKCENCHGTG-GE
DNAJ_MESFL       ----SGRSSRR----GPSKGQDIGLEATLTFKELVFGVNKKTILNLVKTCTKCDGVGAEN
DNAJ_MYCMS       ----SNKSDYQ----RSTKGQSVSVDIYLTFKELLFGVDKIIELDLLTNCSVCFGSGAES
DNAJ_MYCGE       ----K-RQQQI----VVPYNLDIALVIEINFFEMTNGCNKTIKYERKVSCHSCNGFGAEG
DNAJ_MYCPN       ----KSRQNRV----VLPYDLEIAVGVDISFFEMTNGCTRTIEYTKRVTCSACDGFGAEG
DNAJ_MYCGA       ----GFHNQEY----IEEVDVNLVHEIKINFLEAANGCIKNVKYTRQVTCPDCNGSGSAD
DNAJ_MYCPE       ----GGRRGAS----SQQREANLVVSIVLTFVESVVGVKKTIEYKIEKDCESCHGSGADN
DNAJ_UREPA       ----SHNSSN------QYETYDIHLRLHLDFMEAVNGISKNINYDRKITCHKCQGTGAKD
DNAJ_MYCH2       ---GSQEQKYS----RPLKGENFQAKIYISFIESILGKEISQKLTKYDQCDNCKGSGANS
DNAJ_MYCMO       ----SQRANPN----RAQRGEDRHAVIKISFIDSVLGKEIVEPLEKFETCNTCNGSGAKS
DNAJ_MYCPU       ----HSKQNSN----YPYPGESYSTQVKISFLDSVHGRVISQKLDKYKDCESCNGTGARS
DNAJ_NOSS1       -GGMGGPTQQRRR-GGPARGDDLRLDLKLDFREAVFGGEKEIRISHLETCETCSGSG-AK
DNAJ_SYNP6       -GGMGGQQASARR-RGPTRGEDLRLDLKLDFRDAIFGGEKEIRVTHEETCGTCQGSG-AK
DNAJ1_SYNY3      -GGMGGQQRGRRRANGPTRGDDLRLDLQLTFQEAIFGGEKEIRIPHLESCQVCEGTG-AK
DNAJ_THEEB       -------TTSSRRQQGPTRGEDLRYDLKLEFREAVFGGEKEIRINHLETCKTCQGTG-AK
DNAJ_PROMM       -GGAGGSGGARPRRRGPQQGDDLRYDLKIDFEQAVFGQEREIKIPHLETCDTCNGTG-AK
DNAJ_SYNPX       -GGPGGAAAGRSGRRGPQQGDDLRYDLTIDFEQAVFGQEQEIKIPHLETCDTCGGSG-AK
DNAJ_PROMA       -GGPG-SSGARTQRRGPQQGDDLRYDLTIDFNQAVFGQEREIKIPHLETCDVCRGTG-AK
DNAJ_PROMP       -GGQS-SQGGRSQRRGPQQGDDLRYDLNIDFKDAIFGQQREINIPHLETCEVCRGTG-AK
DNAJ_GLOVI       -AGAGTGGRRATRPGGPTRGDDLRYDMVLEFQEAIFGGEKEITINHLITCETCRGSG-SK
DNAJ1_COREF      -----GAG-SRGPRSRVQPGSDTLWRTSITLEEAFTGVKKDLTLDTAVLCSKCHGSG-SA
DNAJ1_CORGL      -----GAGGSRGPRSRVQPGSDTLWRTSITLEEAYKGAKKDLTLDTAVLCTKCHGSG-SA
DNAJ1_CORDI      -----GGG-SRGPRSRVQPGSDALLRTTLTLEEAYLGTKKPITIDTAILCDRCEGTG-SK
DNAJ2_MYCBO      --FG-GGAASRGPIGRVRPGSDSLLRMRLDLEECATGVTKQVTVDTAVLCDRCQGKG-TN
DNAJ2_MYCTU      --FG-GGAASRGPIGRVRPGSDSLLRMRLDLEECATGVTKQVTVDTAVLCDRCQGKG-TN
DNAJ1_MYCPA      --FG-GGTTSRGPIGRVRPGSDSLLRMRLDLEECATGVTKQVTVDTAVLCDRCHGKG-TN
DNAJ2_MYCLE      ------SSASRGPIGRVRPGSDSLLPMWLDLEECATGVTKQVTVDTAVLCDRCQGKG-TN
DNAJ1_NOCFA      --SG-AGGGQRKPRGRVQPGADSLLRTRLSLAECAVGVTKHLTVDTAVLCDACHGSG-TH
DNAJ2_STRAW      --S------QRGPRSRTRRGQDAMIRVEIELDEAAFGTTKDIQVETAVVCTTCSGEG-AA
DNAJ2_STRCO      --S------QRGPRSRTRRGQDAMIRIEVELDEAAFGTTKDIQVDTAVVCNTCNGEG-AA
DNAJ1_CUTAK      --SPFGSGGGRGPRSRTRRGQDALVRMRLSLAEAVFGVTKSLEVDTAVVCPKCQGKG-AQ
DNAJ_LEIXX       --G-----ASRGPRSRRERGQDALLRVEVDLDEVVFGAHRDLEVDTAIVCETCDGSC-CQ
DNAJ_BIFLO       --FG---GGSQGPVPRTQPGRDALASASIDLKTAVFGGTAHVKINTFSLCQECGGSG-AQ
DNAJ_TROW8       -------------SAEFQRGSDLLVNIDIDLKTAIYGGSQVVKIDSLVVCDVCNGTR-SE
DNAJ_TROWT       -------------SAEFQRGSDLLVNIDIDLKTAIYGGSQVVKIDSLVVCDVCNGTR-SE
DNAJ_THET2       ------FGV--RGHRRPPRGEDLEAEVEVELQDLLHGAEKEVRYTRLVPCEACGGE----
DNAJ1_THET8      ------FGV--RGHRRPPRGEDLEAEVEVELQDLLHGAEKEVRYTRLVPCEACGGE----
DNAJ_DEIRA       ------AGMGGRGRRGPARGDDLETEVRITLEQARAGEEVEVTVDRLTECEHCHGTRTEP
DNAJ_SYMTH       -------AGRQRNPRGPVRGADLEYELELTLKEAAFGCTKELRVPRVEDCDTCHGSG-AR
DNAJ_METTH       -------GGRR---HGPQRGADISYTLDISLEDAYNGLETDIRVPHTKKCPVCHGSR-AE
DNAJ_HALMA       ------GGRGGRGGSRRRQGQDLQTRLEIDLEEAYNGATKQLNVTRPEACDDCDGAG-HP
DNAJ_HALSA       ------GGGGGRGRSGPEQGRDLRTDLTVTLSEAYRGVSKQVTVRRPESCADCGGSG-YP
DNAJ1_AROAE      ---------------APPRGADRREDLVLTMEEAFAGGEKAFTIADEIPCGACGGSG-EE
                                      .      : :     *            *  * *     

DNAJ2_COREF      SG-QPSKCGQCNGSGFTSENKG-----AFGFSAPCTNCGGTGEVITDPCVDCRGRGTVRR
DNAJ2_CORGL      SG-HPAKCGTCDGTGFTSENKG-----AFGFSAPCATCGGTGEIITDPCDNCHGRGTVRK
DNAJ2_CORDI      SG-APTTCTECNGTGFTSENKG-----AFGFSAPCTQCGGTGKMISDPCPDCSGTGTQRR
DNAJ1_MYCBO      PGTSPKVCPTCNGSGVINRNQG-----AFGFSEPCTDCRGSGSIIEHPCEECKGTGVTTR
DNAJ1_MYCTU      PGTSPKVCPTCNGSGVINRNQG-----AFGFSEPCTDCRGSGSIIEHPCEECKGTGVTTR
DNAJ2_MYCPA      PGTSPKVCPTCNGSGVISRNQG-----AFGFSEPCTDCRGSGSIIEHPCDECKGTGVTTR
DNAJ1_MYCLE      PGISPKVCSTCNGSGVINRNQG-----AFGFSEPCTECRGSGSIIEHPCEECKGTGVTTR
DNAJ2_NOCFA      PGTSPRVCPICNGTGVVSRNQG-----AFGFSEPCDGCRGTGSIIDDPCVDCHGSGIQNR
DNAJ1_STRAW      NGT-PRVCPTCVGTGQVARGSGG----GFSLTDPCPDCKGRGLIAENPCEICKGSGRAKS
DNAJ1_STRCO      NGT-PRVCPTCVGTGQVARGSGG----GFSLTDPCPDCKGRGLIAEDPCEVCKGSGRAKS
DNAJ2_CUTAK      AGTVPRVCSTCQGSGMHASSAGG----VFEMTEPCPDCHGRGMIVEDPCQVCHGSGRAKS
DNAJ1_AQUAE      -EAETVVCHACNGEGRRVSG-------IFNFPRPCSVCKGKGFIVKNPCPTCYGRGRVSA
DNAJ2_AQUAE      -ESKSRTCPTCGGRGETVQGNW-----FFQVRQTCPTCGGEGVIYEN-CHACTGRGYGLV
DNAJ_THEMA       -NAGYMDCPSCGGTGRIREERRSF-FGYFVSERTCERCGGTGKIPREYCHECGGSGRVLR
DNAJ_BORBU       KGTSPSICNMCNGSGRVVQGG-----GFFRVTTTCSKCYGEGKIISNPCKSCKGKGSLTK
DNAJ_BORBP       KGTSPSICNMCNGSGRVVQGG-----GFFRVTTTCSKCYGEGKTISNPCKSCKGKGRITN
DNAJ_CAMJE       -DGKLQTCPKCQGRGQVGVSQ-----GFITFAQTCPDCQGIGEKASEKCSDCKGLGYNES
DNAJ_CAMJR       -DGKLQTCPKCQGRGQVGVSQ-----GFITFAQTCPDCQGIGEKASEKCSDCKGLGYNES
DNAJ_HELHP       -GGKLNTCKDCGGKGQVYMRQ-----GFMTFAQTCPTCKGEGQSASEKCSKCKGSGFEIS
DNAJ_WOLSU       -EGKIETCPDCGGRGQVFIRQ-----GFMTFAQTCPKCGGSGERIKEKCPKCNGKGHENK
DNAJ_HELPJ       -DKALENCKQCNGQGQVFMRQ-----GFMSFAQTCGACQGKGKIIKTPCQACKGKTYILK
DNAJ_HELPY       -DKALETCKQCNGQGQVFMRQ-----GFMSFAQTCGACQGKGKIVKTPCQACKGKTYILK
DNAJ_ECO57       PGTQPQTCPTCHGSGQVQMRQ-----GFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVER
DNAJ_ECOL6       PGTQPQTCPTCHGSGQVQMRQ-----GFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVER
DNAJ_ECOLI       PGTQPQTCPTCHGSGQVQMRQ-----GFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVER
DNAJ_SHIFL       PGTQPQTCPTCHGSGQVQMRQ-----GFFAVQQTCPHCQGRGTLIKDPCNKCHGHGRVER
DNAJ_SALTI       AGTQPQTCPTCHGSGQVQMRQ-----GFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEK
DNAJ_SALTY       AGTQPQTCPTCHGSGQVQMRQ-----GFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEK
DNAJ_SALPA       AGTQPQTCPTCHGSGQVQMRQ-----GFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEK
DNAJ_YERPE       PGSSPVTCPTCHGAGQVQMRQ-----GFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEK
DNAJ_YERPS       PGSSPVTCPTCHGAGQVQMRQ-----GFFTVQQACPHCHGRGQIIKDPCNKCHGHGRVEK
DNAJ_PECAS       PGSSPITCPTCHGNGQVQMRQ-----GFFTVQQACPHCHGRGKIIKDPCIKCHGHGRVEK
DNAJ_PHOLL       AGTSPVTCSTCQGAGQVHMRQ-----GFFTVQQPCPHCHGRGQIIKDSCHKCHGHGRVER
DNAJ_BLOFL       SSASIVSCVTCHGHGQIQMRQ-----GFFSVQQSCPSCNGHGKIIKEICNKCRGSGRIER
DNAJ_WIGBR       PGTSAQNCSTCNGQGQIQMRQ-----GFFSVQQTCPSCRGKCKIIRFPCRNCSGQGRVER
DNAJ_BUCAI       TGTKPRSCSTCHGKGQIHIRK-----GFFTVQQSCPTCHGKGTIITDPCNLCHGQGRVET
DNAJ_BUCAP       TGTKPNGCSTCHGKGQIHIRK-----GFFTVQQSCPTCNGIGTVIKNPCRMCRGQGRIKT
DNAJ_BUCBP       TGTKPQFCPTCRGNGQIQMRK-----GFFTVQQTCPQCHGEGNFIRDPCRRCHGNGRIEI
DNAJ_VIBVU       KGTSAETCGTCHGHGQVQMRQ-----GFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQK
DNAJ_VIBVY       KGTSAETCGTCHGHGQVQMRQ-----GFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQK
DNAJ_VIBPA       KGSSAETCGTCHGHGQVQMRQ-----GFFAVQQTCPTCHGKGKIIKDPCNECHGQGRKQK
DNAJ_VIBCH       KGTSAQTCGTCHGHGQVQMRQ-----GFFAVQQTCPTCHGKGKIIKDPCNVCHGQGRKQK
DNAJ_PHOPR       RGSSATTCGTCHGQGQVQMRQ-----GFFAVQQACPHCHGRGKIIKDPCNSCHGQGRVEK
DNAJ_SHEON       KGTSATTCTTCHGQGQVQMRQ-----GFFTVQQPCPTCHGRGKIIKDPCAKCHGDGRVEK
DNAJ_IDILO       KGSKPQTCGHCHGSGQIQMRQ-----GFFAVQQTCPQCRGTGTIIKDPCRTCHGHGRKEE
DNAJ_MANSM       KGSKVETCPTCHGHGRVRRQQ-----GFFMTETTCPTCQGSGKKIEKPCKHCHGDGRVHK
DNAJ_PASMU       KGSKVETCSTCHGAGRVRRQQ-----GFFVTEQVCPSCHGSGKKIEKPCKSCHGDGRVHK
DNAJ_HAEIN       KGSKVETCPHCHGSGRIRRQQ-----GFFVSESICPTCHGSGKKIEKPCRNCHGEGRVHK
DNAJ_HAEDU       AGTKVENCPHCHGAGRIRRQQ-----GFFVTEAVCPSCHGTGKKIEKPCHSCHGDGRVQK
DNAJ_XANAC       D-GKVETCGTCHGRGQVRIQR-----GIFAMQQSCPHCDGRGTLIQNPCKTCHGAGRVEE
DNAJ_XANCP       D-GKVEVCATCHGRGQVRIQR-----GIFAMQQSCPHCDGRGTLIQNPCKTCHGAGRVEE
DNAJ_XYLFA       D-GHVETCGTCRGSGQVRIQR-----GIFAMQQTCPHCGGRGVIIRNPCKVCNGAGRVED
DNAJ_XYLFT       D-GHVETCGTCRGSGQVRIQR-----GIFAMQQTCPHCGGRGVIIRNPCKVCNGAGRVED
DNAJ_ACIAD       NPNDVETCRTCHGTGQVRMQQ-----GFFSVQQTCGTCRGQGKIIKNPCQSCHGSGVADR
DNAJ2_AROAE      PGTQPKPCPTCGGAGQVRIQQ-----GFFSIQQTCPKCHGTGRIIPDPCRDCGGAGRVKR
DNAJ_CHRVO       PGTQPKTCATCGGHGQVRMSQ-----GFFSIQQTCPTCHGTGKQITDPCGSCHGAGQKKT
DNAJ_NITEU       PGTSPKTCPTCNGHGQIRMQQ-----GFFSIQQTCSHCQGSGKVVSDPCGDCHGAGWVKR
DNAJ_BORPA       AGTSPKTCRTCGGSGAVRMQQ-----GFFSVQQTCPTCHGTGKEITDPCPSCDGVGRTRR
DNAJ_BORPE       AGTSPKTCRTCGGSGAVRMQQ-----GFFSVQQTCPTCHGTGKEITDPCPSCDGVGRTRR
DNAJ_BORBR       AGTSPKTCRTCGGSGAVRMQQ-----GFFSVQQTCPTCHGTGKEITDPCPSCDGVGRTRR
DNAJ_BURMA       PGTKPETCPTCHGQGTVRMSQ-----GFFSIQQTCPKCHGTGTYIPEPCAHCHGSGKVKE
DNAJ_BURPS       PGTKPETCPTCHGQGTVRMSQ-----GFFSIQQTCPKCHGTGTYIPEPCVHCHGSGKVKE
DNAJ_RALSO       PGSSVETCPTCHGAGQVRVSQ-----GFFTMQQTCPKCHGNGKYIPKPCSKCHGQGKVKS
DNAJ_LEGPA       KGTSPKTCETCQGMGQVRIQQ-----GFFSIQQTCPTCHGEGKIISDPCASCHGQGRVRE
DNAJ_LEGPH       KGTSPKTCETCQGMGQVRIQQ-----GFFSIQQTCPTCHGEGKIISDPCASCHGQGRVRE
DNAJ_LEGPL       KGTSPKTCETCQGMGQVRIQQ-----GFFSIQQTCPTCHGEGKIISDPCASCHGQGRVRE
DNAJ_PSEPK       KGSTPSTCPTCGGIGQVRMQQ-----GFFSVQQTCPRCHGQGKIITDPCTSCHGEGRVEE
DNAJ_PSESM       KGSSPVTCPTCGGIGQVRMQQ-----GFFSVQQTCPRCHGHGKIISDPCDSCHGEGRVEE
DNAJ_PSEAE       PGTTPVTCTTCGGIGQVRMQQ-----GFFSVQQTCPRCHGTGKMISDPCGSCHGQGRVEE
DNAJ_METCA       KGSAPVTCPTCHGQGAVRMQQ-----GFFSVQQTCPTCRGTGQHISDPCRVCYGQGRVQE
DNAJ_COXBU       -GSSPATCPRCNGSGQMRMQH-----GFLQVQQTCSVCRGRGQVIKDPCTDCHGQGRQQQ
DNAJ_NEIMA       PGTSPETCPTCKGSGTVHIQQ-----AIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKA
DNAJ_NEIMB       PGTSPETCPTCKGSGTVHIQQ-----AIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKA
DNAJ_FRATT       S-RSKTTCHACHGQGTIRRQQ-----GFFAFEQTCPVCNGTGYSITDPCDACYGNGKVKK
DNAJ_AGRFC       PGTQPKTCATCQGSGRVRAAQ-----GFFSVERTCPTCHGRGQTISDPCGKCHGQGRVTE
DNAJ_RHIME       PGTSPKTCGTCQGTGRVRAAQ-----GFFSIERTCPTCGGRGQTIADPCTKCHGQGRVVE
DNAJ_BRUME       PGSQPTTCTMCSGSGRVRAAQ-----GFFSVERTCPGCNGRGQIIKDPCEKCHGQGRVTQ
DNAJ_BRUSU       PGSQPTTCTMCSGSGRVRAAQ-----GFFSVERTCPGCNGRGQIIKDPCEKCHGQGRVTQ
DNAJ_RHILO       PGTQPVTCSMCHGHGKVRATQ-----GFFSIERTCPQCQGRGQTIKDPCPKCAGQGRVTE
DNAJ_BARHE       KGSKPQTCGTCHGAGRVRAAQ-----GFFSIERTCPVCHGRGETIKDPCPKCQGTRRVEK
DNAJ_BARQU       KGSKPQICGTCHGAGRVRAAQ-----GFFSIERTCHACNGRGEVITDPCPKCQGTRRVEK
DNAJ_BRADU       AGTKPKTCSTCGGAGRVRQSQ-----GFFTLERTCPGCQGRGQMIEDACPSCSGQGRVTR
DNAJ_RHOPA       AGTKPKTCSTCGGAGRVRQAQ-----GFFTLERTCPSCQGRGQTIEDPCPSCTGSGRVTK
DNAJ_CAUVC       PGTSPSVCGTCGGAGRVRATQ-----GFFAVERGCPRCGGSGRLVLDPCSNCHGHGQVRR
DNAJ_GLUOX       PKAGSSTCPTCHGAGKVRAQQ-----GFFLVERPCPTCHGSGRTVANPCKVCHGTGTEAK
DNAJ_ZYMMO       AGSGRKTCDTCHGSGRIRVQQ-----GFFVVEQSCPVCQGKGEVISDPCPECHGEGRCEK
DNAJ_RICPR       KGETITTCDACGGVGATRIQQ-----GFFTLEQTCHKCQGNGQIIKNPCKKCHGMGRYHK
DNAJ_RICTY       KGETVTTCDSCGGVGVTRIQQ-----GFFTLEQTCHKCQGNGQIIKNPCKKCHGMGRYHK
DNAJ_RICCN       KGETVTTCDACSGVGATRMQQ-----GFFTIEQACHKCQGNGHIIKNPCKKCHGMGRYHK
DNAJ_RUEPO       GGVEPTTCPTCSGMGKVRAQQ-----GFFTVERTCPTCSGLGQIIKNPCKSCRGQGRVEK
DNAJ_ANAMM       GAVNSVKCGNCNGAGSVRTRK-----GFLTIEEVCNVCNGEGEVIKNKCRRCGGSGRVRN
DNAJ_EHRRW       GSVKSVQCNTCHGAGNIRTQQ-----GFFTIERTCHVCNGEGEIIKNKCKKCSGSGRVRD
DNAJ_WOLPM       GAIKPVQCHTCQGSGRIRTQQ-----GFFTIERTCTTCYGEGEIIQNKCKKCGGSGRRRD
DNAJ_BDEBA       KGSQVSTCGTCGGSGQVVRQQ-----GFFAMASTCPTCHGQGTVIKNPCKPCKGKGRVAE
DNAJ_DESPS       PGYQPQTCPTCNGRGQVLRSQ-----GFFQVSTTCPECEGEGQVIKEPCNDCHGEGLVKK
DNAJ_DESVH       PGTRPETCRHCGGAGQIRQSQ-----GFFQIAMPCPVCRGEGTVITSPCPKCKGSGQTQQ
DNAJ_RHOBA       AGSEPVTCTMCGGQGQVIQSA-----GILRVQTTCPTCKGAGKQIGEPCGKCRGTGTQNE
DNAJ_CHLCV       SEQGIKCCDRCKGSGQIVQSR-----GFFSMASTCPECGGEGRVITDPCSNCRGQGRIKD
DNAJ_CHLPN       NPQGIKSCERCKGSGQVVQSR-----GFFSMASTCPECGGEGRIITDPCSSCRGQGRVKD
DNAJ_CHLMU       TSKGVKVCDRCKGSGQVVQSR-----GFFSMASTCPDCSGEGRVITDPCSECRGQGRIKD
DNAJ_CHLTR       TAKGVKVCDRCKGSGQVVQSR-----GFFSMASTCPDCSGEGRVITDPCSVCRGQGRIKD
DNAJ_PARUW       SSQGIKTCSECKGRGQVFEQR-----GFFSMTMACPKCHGEGKVITDPCKNCKGQGAVKE
DNAJ_TREDE       SGSSKRMCPDCKGTGQVRQST-----GFFSISRPCPTCGGEGSIIEKPCKKCGGNGLERK
DNAJ_LEPIC       KGSSPATCPDCGGSGQIRRTQ-----GFFSVATTCPTCRGKGTIISNPCRSCGGQGLQEK
DNAJ_LEPIN       KGSSPATCPDCGGSGQIRRTQ-----GFFSVATTCPTCRGKGTIISNPCRSCGGQGLQEK
DNAJ_GEOSL       PGTEPKVCPTCRGAGQVRFQQ-----GFFSVSKTCNHCNGEGRVVENPCTSCRGSGMIRD
DNAJ_BACAN       PGTSKETCKHCSGSGQVSVEQNTP-FGRIVNRQACSHCSGTGQMIKEKCTTCHGSGKVRK
DNAJ_BACHK       PGTSKETCKHCSGSGQVSVEQNTP-FGRIVNRQACSHCSGTGQMIKEKCTTCHGSGKVRK
DNAJ_BACCZ       PGTSKETCKHCSGSGQVSVEQNTP-FGRIVNRQACSHCSGTGQMIKEKCTTCHGSGKVRK
DNAJ_BACC1       PGTSKETCKHCSGSGQVSVEQNTP-FGRIVNRQACGHCSGTGQIIKEKCTTCHGSGKVRK
DNAJ_BACCR       PGTSKETCKHCSGSGQVSVEQNTP-FGRIVNRQACGHCSGTGQIIKEKCTTCHGSSKVRK
DNAJ_OCEIH       PGTKPETCSHCHGSGQLNQEQNTP-FGRVVNRRVCNYCQGTGKIIPDKCNTCGGSGTVQK
DNAJ_BACHD       PGTKPESCPHCGGSGQLNIEQNTP-FGRVVNRRVCHHCEGTGKYIKHKCATCGGKGKVRK
DNAJ_BACSK       PGTKPDTCSHCGGSGQLNVEQNTP-FGRVVNRRVCNYCEGTGKIIKQKCATCSGKGKVRK
DNAJ_BACLD       PGTKPETCSHCGGSGQLNMEQSTP-FGKVVNRRVCHYCNGTGKQIKHKCSTCGGTGKVKK
DNAJ_BACSU       PGTNPETCSHCGGSGQLNVEQNTP-FGKVVNRRVCHHCEGTGKIIKNKCADCGGKGKIKK
DNAJ_LISIN       PGTTPEKCSHCGGKGSINVEQNTP-FGRVVNKRTCQYCNGTGKEIKEKCPTCHGKGRVTK
DNAJ_LISMF       PGTTPEKCSHCGGKGSINVEQNTP-FGRVVNKRTCQYCNGTGKEIKEKCPTCHGKGRVTK
DNAJ_LISMO       PGTTPEKCSHCGGKGSINVEQNTP-FGRVVNKRTCQYCNGTGKEIKEKCPTCHGKGRVTK
DNAJ_GEOKA       PGTSPTSCPHCHGSGQVTSEQATP-FGRIVNRRTCPVCGGTGRYIPEKCPTCGGTGRVKR
DNAJ_STAAC       PGTSKKTCSYCNGAGHVAVEQNTI-LGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENK
DNAJ_STAAM       PGTSKKTCSYCNGAGHVAVEQNTI-LGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENK
DNAJ_STAAN       PGTSKKTCSYCNGAGHVAVEQNTI-LGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENK
DNAJ_STAAS       PGTSKKTCSYCNGAGHVAVEQNTI-LGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENK
DNAJ_STAAW       PGTSKKTCSYCNGAGHVAVEQNTI-LGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENK
DNAJ_STAAR       PGTSKKTCSYCNGAGHVAVEQNTI-LGRVRTEQVCPKCNGSGQEFEEACPTCHGKGTENK
DNAJ_STAES       PGTSKKTCSYCNGAGRVSVEQNTI-LGRVRTEQVCPKCEGSGQEFEEPCPTCKGKGTENK
DNAJ_STAEQ       PGTSKKTCSYCNGAGRVSVEQNTI-LGRVRTEQVCPKCEGSGQEFEEPCPTCKGKGTENK
DNAJ_STRA3       PGTSPVTCQKCHGSGVINVDTQTP-LGTMRRQVTCDVCQGSGQEIKEKCPTCHGTGHEKK
DNAJ_STRA5       PGTSPVTCQKCHGSGVINVDTQTP-LGTMRRQVTCDVCQGSGQEIKEKCPTCHGTGHEKK
DNAJ_STRP3       PGTAPVTCRKCHGSGVMTIDTQTP-LGMMRRQVTCDICHGSGKEIKEPCQTCHGTGHEKQ
DNAJ_STRP1       PGTAPVTCRKCHGSGVMTIDTQTP-LGMMRRQVTCDICHGSGKEIKEPCQTCHGTGHEKQ
DNAJ_STRP6       PGTAPVTCRKCHGSGVMTIDTQTP-LGMMRRQVTCDICHGSGKEIKEPCQTCHGTGHEKQ
DNAJ_STRP8       PGTAPVTCRKCHGSGVMTIDTQTP-LGMMRRQVTCDICHGSGKEIKEPCQTCHGTGHEKQ
DNAJ_STRMU       PGTSPVTCSKCHGSGVINMDTQTP-LGMMRRQVTCDVCHGTGQEIKEPCPTCHGTGHEKQ
DNAJ_STRT1       PGTSPVTCGRCHGHGVINVDTQTP-LGMMRRQVTCDVCHGTGQEIKDPCQTCHGTGREKQ
DNAJ_STRT2       PGTSPVTCGRCHGHGVINVDTQTP-LGMMRRQVTCDVCHGTGQEIKDPCQTCHGTGREKQ
DNAJ_STRPN       PGTSPVTCGRCHGAGVINVDTQTP-LGMMRRQVTCDVCHGRGKEIKYPCTTCHGTGHEKQ
DNAJ_STRR6       PGTSPVTCGRCHGAGVINVDTQTP-LGMMRRQVTCDVCHGRGKEIKYPCTTCHGTGHEKQ
DNAJ_LACLA       AGTHPETCHKCGGRGQINVVRDTP-LGRMQTQVTCDVCNGTGKEIKEKCETCHGSGHEKV
DNAJ_ENTFA       PGTHPETCHKCHGSGTINVERQTP-LGRMMSRQTCDVCHGTGKEIKEPCPTCHGTGHEKK
DNAJ_LACPL       PGTSPVTCSKCHGAGYIQVQTNTP-LGRMMSQQVCDVCHGTGKEIKDKCATCGGSGHTEQ
DNAJ_LACJO       KGTHPITCDKCHGSGVMTVTRQTP-LGVIQQQTTCDKCGGRGTIIEHPCQTCHGQGTVDK
DNAJ_CLOAB       KGTSPKTCDKCGGTGTIRVQRNTP-LGSFVTQSSCDKCGGRGTIISDPCHECHGAGHVRK
DNAJ_CLOTE       PGTNSKTCPKCNGSGQIKVQRNTA-LGSFVSVNTCDMCGGKGTIISDPCSDCKGKGTVRK
DNAJ_CLOPE       AGTSPKTCPKCNGSGQIRVQRQTP-LGSFVSTTTCDQCGGTGKVIEDPCPDCKGKGTVRK
DNAJ_CALS4       PGSRPETCPVCHGTGEIRQTQNTP-FGRIVNIRTCPRCHGEGKIITDPCQKCGGTGKIRK
DNAJ_METAC       PGTSPKRCPTCGGTGQVRTTRSTL-GMQFISTTTCSTCHGRGQIIESPCPVCGGAGRVRN
DNAJ_METMA       PGTSPKRCPNCGGTGQVRTTRSTL-GMQFVSTTTCSACHGRGQVVESPCPTCSGAGRVRS
DNAJ_BACFR       GNSGSETCPTCKGSGSVIRNQQTI-LGTMQTRTTCPTCNGEGKIIKDKCKVCGGEGIEYG
DNAJ_BACTN       GDGGSETCPTCKGSGSVIRNQQTI-LGTMQTRTTCPTCNGEGKIIKNKCKECGGDGIVYG
DNAJ_PORGI       EANGKTTCQTCHGTGVVTRVSNTF-LGAMQTQSTCPTCHGEGEIITKPCSKCKGEGVEIG
DNAJ_CHLTE       -SGKTEICPTCHGSGEVRQATKTM-FGQFMNISVCPTCGGEGRVVKDRCPSCYGEGIKQG
DNAJ_THEAC       -NGKLITCPTCNGTGQQRIVRGQG-FFRMVTVTTCQTCGGRGRIPEEKCPRCNGTGTVVV
DNAJ_THEVO       -NGKLITCPTCHGTGQQRVVRGQG-FFRMVTVTTCNTCGGKGRIPEEKCPRCNGTGTIVV
DNAJ_PICTO       -NKVLITCPTCHGSGQERITRGQG-FFRMVTVTECRTCHGRGKIPQKPCTVCHGTGTVSK
DNAJ_FUSNN       -DDKMKTCPTCNGQGTIRTQQRTI-LGVMQSQSVCPDCHGTGKVPEKKCKHCHGTGTAKE
DNAJ_MESFL       PS-DVHICTKCNGAGQIIVNKQMG-PFQVQNQVTCDKCNGVGKEFKSKCKNCHGKGVESK
DNAJ_MYCMS       NS-DISICNNCHGTGEVLIQKNMG-FFQFQQSAKCNVCNGAGKIIKNKCKNCKGKGKYLE
DNAJ_MYCGE       GESGLDLCKDCNGNGFVIKNQRSI-FGTIQSQVLCSTCNGQGKQIKVKCKTCRSNKYTVT
DNAJ_MYCPN       GETGMVSCNSCEGNGFILKNQRSI-FGTVQSQMLCQSCGGQGKQAKHKCKTCKGSKYKKV
DNAJ_MYCGA       GD--VITCSDCNGEGFLVEQRRTL-LGMFQTKKTCPSCKGEGQTIKNKCKKCKSRRMVDE
DNAJ_MYCPE       SEGSISTCSNCNGSGVEITQKRTI-MGIIQSQNICSRCNGEGKEIHKKCNSCKGRKVHEE
DNAJ_UREPA       PK-DVKICTKCHGRGTSIENVHSL-FGTIQQEVECHECEGTGKVASSKCEQCYGKKVINE
DNAJ_MYCH2       SS-DITTCYNCQGRGMQTEVLNIPGFGRVQNKTTCSVCLGSGKNITKNCKKCRGKTIVET
DNAJ_MYCMO       QS-DIITCTQCSGMGEQIKITKTF-LGQMQQNVICSKCNGIGKEIVEKCLICKGKTHTKT
DNAJ_MYCPU       KS-DIKTCSTCNGRGSVEKLVNSL-FGKIKQSVTCSTCNGLGQEITHKCPSCKGAKKIKE
DNAJ_NOSS1       PGTRPRTCSTCSGSGQVRRVTRTP-FGSFTQVSTCPTCNGTGMVIEDKCDTCDGKGTNQV
DNAJ_SYNP6       AGTRPQTCTTCGGAGQVRRATRTP-FGSFTQVSVCPTCEGSGQMIVDKCDDCGGAGRLRR
DNAJ1_SYNY3      PGTGVKTCGTCNGAGQVRRATRTP-FGSFAQVSACPTCNGSGEVIEQKCEACNGVGRKQE
DNAJ_THEEB       PGTRPVTCSTCGGVGQVRRSARTP-FGSFTQLTTCPTCGGSGVVIEDRCESCGGQGHIQV
DNAJ_PROMM       VGSGPTTCSTCGGVGQVRRATRTP-FGSFTQVAECPSCEGTGQVIADPCPACAGQGVRQV
DNAJ_SYNPX       AGSGPTTCGTCGGAGQVRRATRTP-FGSFTQVAECPNCGGTGQVIADPCNACGGQGVRQV
DNAJ_PROMA       PGTGPTTCSTCGGAGQVRRATRTP-FGSFTQVSDCPTCSGSGQVISDSCQSCGGQGVKQV
DNAJ_PROMP       KGTGPTTCTTCGGSGQVRRATRTP-FGNFTQVAECPTCNGVGQIISDPCTSCGGNGVKQV
DNAJ_GLOVI       PGSGPMTCRNCGGQGQIRQARRTP-FGLFTQVAACPNCQGTGEVIESPCPTCSGRGRNQK
DNAJ1_COREF      SNAKPKTCGTCHGSGEIQEVQRSF-LGNVMTSRPCHTCNGTGEVIPDPCDECAGDGRVRA
DNAJ1_CORGL      SDKKPVTCGTCNGAGEIQEVQRSF-LGNVMTSRPCHTCDGTGEIIPDPCTECAGDGRVRA
DNAJ1_CORDI      SKSKPNVCSTCNGSGEIQQMQRSF-LGNVMTSSPCPTCRGTGEVIPDPCDKCGGDGRVRT
DNAJ2_MYCBO      GDSVPIPCDTCGGRGEVQTVQRSL-LGQMLTSRPCPTCRGVGVVIPDPCQQCMGDGRIRA
DNAJ2_MYCTU      GDSVPIPCDTCGGRGEVQTVQRSL-LGQMLTSRPCPTCRGVGVVIPDPCQQCMGDGRIRA
DNAJ1_MYCPA      GDSAPVPCDTCGGRGEVQTVQRSL-LGQVMTSRPCPTCRGVGVVIPDPCHQCMGDGRVRA
DNAJ2_MYCLE      GDSAPIPCDTCGGRGEVQTVQRSL-LGQMVTARPCPTCRGVGVVIPDPCCQCVGDGRVRA
DNAJ1_NOCFA      GNSKPVRCETCGGAGEVQSVQRSF-LGQVLTSRPCPTCRGAGETIPDPCHKCGGDGRVRA
DNAJ2_STRAW      PGTSAQTCDMCRGRGEVSQVTRSF-LGQVMTSRPCPQCQGFGTVVPTPCPECAGDGRVRS
DNAJ2_STRCO      PGTSAQTCDMCRGRGEVSQVTRSF-LGQVMTSRPCPQCQGFGTVVPTPCPECAGDGRVRS
DNAJ1_CUTAK      SGSEPVTCDTCQGRGEVITVQRSF-LGDIRTSQPCPTCHGYGTVIPDPCQECSGEGRVRT
DNAJ_LEIXX       PGTAPVPCDICHGTGSIQRSVRSL-LGNVMTSSPCGSCRGYGTVIATPCVTCQGQGRVRA
DNAJ_BIFLO       GGAQPVTCPDCHGQGFMQKVVRTM-LGQMMTSAPCERCEGHGTIIQNPCPSCMGHGRVRT
DNAJ_TROW8       PGYKAEVCFDCNGSGVVRGEVRTT-LGNLITQNTCSKCRGNGERIDHPCRRCYGNGSRSA
DNAJ_TROWT       PGYKAEVCFDCNGSGVVRGEVRTT-LGNLITQNTCSKCRGNGERIDHPCRRCYGNGSRSA
DNAJ_THET2       GGRR-TPCPTCRGQGVVESYRQSF-FGTVVTRTACPHCKGRGYLLAETCPACRGRGRVPR
DNAJ1_THET8      GGRR-TPCPTCRGQGVVESYRQSF-FGTVVTRTACPHCKGRGYLLAETCPACRGRGRVPR
DNAJ_DEIRA       GGKPPVTCSTCNGSGAVRGQARTI-FGVVETQQVCPTCKGDGKMVVDPCTVCHGRGRTLK
DNAJ_SYMTH       PGTQPVTCPKCGGTGQVQMTQHTV-FGRFVNVMTCDRCRGEGKIVESPCPTCRGRGRVQK
DNAJ_METTH       PGTGTRTCQTCGGSGQVRQVRNTI-LGQMMNITTCPDCQGEGTVVEKPCSNCNGKGVVRK
DNAJ_HALMA       PGADSETCPECNGQGQTTQVQQTP-MGRVQQRTTCRRCDGEGTLYDETCSTCRGNGVVQN
DNAJ_HALSA       EDADVRTCPQCDGQGVVTQVRQTP-LGRVQQRQECSRCGGEGELHSETCSTCGGQGQTRE
DNAJ1_AROAE      VLRHTRLCATCHGSGRVRDGR---------SLTACADCAGRGYLSRQACGACHGSGQARA
                        *  * * *                   *  * *        *  * .      

DNAJ2_COREF      TRSITVRIPAGVEDGQKVRLAGQGEAGPN-GKPAGDLFVRVHVKEDPVFEREGN--NIHV
DNAJ2_CORGL      SRSITVRIPTGVEDGQKVRLAGQGEAGPN-GKPAGDLFVKVHVKKDDVFTRDGS--NILI
DNAJ2_CORDI      TRSITVRIPAGVVDGQKVRLAGQGEAGPN-GLPAGDLYVTVHVKNDRVFTRSGD--DLEV
DNAJ1_MYCBO      TRTINVRIPPGVEDGQRIRLAGQGEAGLR-GAPSGDLYVTVHVRPDKIFGRDGD--DLTV
DNAJ1_MYCTU      TRTINVRIPPGVEDGQRIRLAGQGEAGLR-GAPSGDLYVTVHVRPDKIFGRDGD--DLTV
DNAJ2_MYCPA      TRTINVRIPPGVEDGQRIRLPGQGEAGLR-GAPSGDLYVTVHVRPHKVFGRDGD--DLTV
DNAJ1_MYCLE      TRTINVRIPSGVEDGQRIRLAGQGEAGLR-GAPSGDLYVTVHVRPDKIFGRNGD--DLTV
DNAJ2_NOCFA      TRTITVRIPPGVSDGQRIRLAGQGEAGLR-GAPSGDLYVTVHVSQDKVFGRNGD--DLTL
DNAJ1_STRAW      SRTMQVRIPAGVSDSQRIRLRGKGAPGER-GGPAGDLYVVVHVDAHPVFGRKGD--NLTV
DNAJ1_STRCO      SRTMQVRIPAGVSDGQRIRLRGKGTPGER-GGPAGDLYVVVHVKEHPVFGRRGD--NLTV
DNAJ2_CUTAK      TKSMQTRIPAGVEDGQRIRIKGKGSPGEN-GGKAGDLYVKVTVRPHEIFGRDGH--NLTV
DNAJ1_AQUAE      QHKIKVHIPPGTEEGEVLKVPEKGHLGYF-GGKPGDLYLKVVLKEHPIFKKVGK--DLHM
DNAJ2_AQUAE      KETIKVKIPPGVRDGSKLVVEGKGHAGRY-GGPPGDLYIIVKVKPHKIFERKGD--DLYV
DNAJ_THEMA       KVRRTVKIPPNVEDGTHLRITGGGNAGYY-GGPYGDLIIIVRVKPDPRFKKSGS--DLVY
DNAJ_BORBU       QETIQLNIPPGIDNNQQIKMKGKGNVNPD-NQEYGDLYVKILIRSHKVFKRNGK--DLYA
DNAJ_BORBP       QETIQLNIPSGIDNNQQIKMKGKGNVNPD-NQEYGDLYVKILIRSHKIFKRNGK--DLYA
DNAJ_CAMJE       KDSVELNIPEGVDTGMKLRVNAKGNIL-K-NGTRGDMYVKIIAAEDDTFIRDDD--DIYI
DNAJ_CAMJR       KNSVELNIPEGVDTGMKLRVNAKGNIL-K-NGTRGDMYVKIIAAEDDTFIRDDD--DIYI
DNAJ_HELHP       EESFEVSIPEGIDDGNRIRIGGRGNAD-K-NGSRGDLYIAVSVAEDENFVRDGE--NVYI
DNAJ_WOLSU       EENLEVSIPEGVDTDNRIRVSRKGHVG-K-NGERGDLYLVVRVEEDEHFMRHGN--DIYL
DNAJ_HELPJ       DEEIDAIIPEGIDDQNRMVLKNKGNEY-E-KGKRGDLYLEARVKEDEHFKREGC--DLFI
DNAJ_HELPY       DEEIDAIIPEGIDDQNRMVLKNKGNEY-E-KGKRGDLYLEAQVKEDEHFKREGC--DLFI
DNAJ_ECO57       SKTLSVKIPAGVDTGDRIRLAGEGEAGEH-GAPAGDLYVQVQVKQHPIFEREGN--NLYC
DNAJ_ECOL6       SKTLSVKIPAGVDTGDRIRLAGEGEAGEH-GAPAGDLYVQVQVKQHPIFEREGN--NLYC
DNAJ_ECOLI       SKTLSVKIPAGVDTGDRIRLAGEGEAGEH-GAPAGDLYVQVQVKQHPIFEREGN--NLYC
DNAJ_SHIFL       SKTLSVKIPAGVDTGDRIRLAGEGEAGEH-GAPAGDLYVQVQVKQHPIFEREGN--NLYC
DNAJ_SALTI       SKTLSVKIPAGVDTGDRIRLAGEGEAGEH-GAPAGDLYVQVQVKQHPIFEREGN--NLYC
DNAJ_SALTY       SKTLSVKIPAGVDTGDRIRLAGEGEAGEH-GAPAGDLYVQVQVKQHPIFEREGN--NLYC
DNAJ_SALPA       SKTLSVKIPAGVDTGDRIRLAGEGEAGEH-GAPAGDLYVQVQVKQHPIFEREGN--NLYC
DNAJ_YERPE       SKTLSVKIPAGVDTGDRIRLSGEGEAGEH-GAPSGDLYVQVQVKAHPIFEREGN--NLYC
DNAJ_YERPS       SKTLSVKIPAGVDTGDRIRLSGEGEAGEH-GAPSGDLYVQVQVKAHPIFEREGN--NLYC
DNAJ_PECAS       SKTLSVKIPAGVDTGDRIRLSGEGEAGDH-GAPSGDLYVQVQVKAHPIFQREEN--NLYC
DNAJ_PHOLL       YKTLSVKIPAGVDTGDRVRLSGEGEAGAK-GAPAGDLYVQVQVKSHHIFERQES--NLYC
DNAJ_BLOFL       TKTLSVKIPAGVSTGDRIRLSGEGESGKN-GAPAGDLYVQVQIKKHPIFDREEK--NLYC
DNAJ_WIGBR       SKNISIRIPAGVDNGDKIRLSGEGEAGKL-GGSSGDLYVKISVKEHPIFKREEH--NLYC
DNAJ_BUCAI       YKILSVKIPPGLDTNDRIRLNNEGEAGAN-GAQSGDLYVQITVKKHPIFEREGN--NLYC
DNAJ_BUCAP       NKTLSVKIPPGIDTNDKIRLSKEGEAGTN-GAQPGDLYVQMKVNKHPIFEREEN--NLYC
DNAJ_BUCBP       SKTLSVKVPPGVDTNDKIRLNNEGEAGEN-GAMAGNLYVQINVKKHPIFEREEN--NLYC
DNAJ_VIBVU       TKTLNVKIPAGVDTGDRIRLSGEGEAGER-GAPAGDLYVQVHVREHHIFEREGN--NLYC
DNAJ_VIBVY       TKTLNVKIPAGVDTGDRIRLSGEGEAGER-GAPAGDLYVQVHVREHHIFEREGN--NLYC
DNAJ_VIBPA       TKTLNVKIPAGVDTGDRIRLSGEGEAGEM-GAPSGDLYVQVHVKEHHIFERDGN--NLYC
DNAJ_VIBCH       TKTLNVKIPAGVDTGDRIRLSGEGEAGEM-GAPAGDLYVQVHVKEHHIFERDGN--NLYC
DNAJ_PHOPR       TKTLSVKIPAGVDTGDRIRLSGEGEAGEF-GAPAGDLYVQVHVAEHSIFERDGN--NLYC
DNAJ_SHEON       TKTLSVKIPAGVDTGDRIRLAGEGEAGEF-GAPAGDLYVQVSVREHAIFVRDGN--NLYC
DNAJ_IDILO       TKTLSVKIPAGVDTGDRIRLANEGEAGEH-GAPAGDLYVQVHVREHPIFARDGN--NLFC
DNAJ_MANSM       KKNLSVKIPAGVDTGNQLRLSGEGAAGEN-GAPAGDLYVVIHVKDHHIFERDGS--NLYC
DNAJ_PASMU       KKNLSVKIPAGVDTGNQLRLSGEGAAGEN-GAPNGDLYVVIHVRDHHIFERDGS--NLYC
DNAJ_HAEIN       KENLSVKIPAGVDTGNQLRLAGKGAAGEN-GAPAGDLYVVIHVREHNIFERDGS--NLYC
DNAJ_HAEDU       AKNLSVTIPAGVDTGNQLRLSGEGEAGEN-GAPAGDLYVVIHVREHNIFTRDGA--NLYC
DNAJ_XANAC       DKVLSIKVPAGVDTGDRIRLAGEGEAGPA-GTPPGDLYVEVRVREHAIFQRDGD--DLHC
DNAJ_XANCP       DKVLSIKVPAGVDTGDRIRLAGEGEAGPA-GTPPGDLYVEVRVREHAIFQRDGD--DLHC
DNAJ_XYLFA       HKTLSVKIPAGVDNGDRIRLSGEGEQGPE-GVPPGDLYVEVRVREHPIFQRDGD--DLHC
DNAJ_XYLFT       HKTLSVKIPAGVDNGDRIRLSGEGEQGPD-GVPPGDLYVEVRVREHPIFQRDGD--DLHC
DNAJ_ACIAD       QQTLEVTIPAGVDNGDRVRLSGKGEAVRD-GQ-AGDLYVEVVVREHEIFQRDGA--DLYM
DNAJ2_AROAE      QKTLEVKIPAGIDEGMRLRHAGHGEPGVN-GGPPGDLYVEIHIRAHPVFQRDHD--DLHC
DNAJ_CHRVO       TKTLNVKIPAGVDEGDRIRLGGEGEPGQN-GGPAGDLYVVTHIKQHAVFQRDGM--DLHC
DNAJ_NITEU       QKTLSVRIPAGVDEGDSIRLTGEGEAGAN-GGQAGDLYIVIHLASHPVFQREGN--HLHC
DNAJ_BORPA       NKTLQVKIPAGIDDGMRIRSSGNGEPGIN-GGPPGDLYVEIHIKQHKIFQRDGD--DLHC
DNAJ_BORPE       NKTLQVKIPAGIDDGMRIRSSGNGEPGIN-GGPPGDLYVEIHIKQHKIFQRDGD--DLHC
DNAJ_BORBR       NKTLQVKIPAGIDDGMRIRSSGNGEPGIN-GGPPGDLYVEIHIKQHKIFQRDGD--DLHC
DNAJ_BURMA       TKTLEVKIPAGIDDGMRIRSAGNGEPGIN-GGPSGDLYVEIHIKPHAVFERDGD--DLHC
DNAJ_BURPS       TKTLEVKIPAGIDDGMRIRSAGNGEPGIN-GGPSGDLYVEIHIKPHAVFERDGD--DLHC
DNAJ_RALSO       QKTLEVKIPAGIDEGMRIRSSGNGEPGIN-GGPPGDLYVEIHIKAHSVFERDGD--DLHC
DNAJ_LEGPA       SKKINVKIPAGVDNGDRVRLSGEGEAGVH-GGGSGDLYVQISLKKHAIFERHEN--DLHC
DNAJ_LEGPH       SKKINVKIPAGVDNGDRVRLSGEGEAGVH-GGGSGDLYVQISLKKHAIFERHEN--DLHC
DNAJ_LEGPL       SKKINVKIPAGVDNGDRVRLSGEGEAGVH-GGGSGDLYVQISLKKHAIFERHEN--DLHC
DNAJ_PSEPK       YKTLSVKVPAGVDTGDRIRLSGEGEAGTH-GGPTGDLYVVISVREHEIFQRDGK--HLYC
DNAJ_PSESM       SKTLSVKVPPGVDTGDRIRLSGEGEAGAQ-GGPTGDLYVVINVREHAIFQRDGK--HLFC
DNAJ_PSEAE       QKTLSVKVPAGVDTGDRIRLTGEGEAGSM-GGPAGDLYVVVNVREHPIFQRDGK--HLYC
DNAJ_METCA       TKTLSVKIPPGVDTGDRIRLSGEGEAGEG-GGPPGDLYVHIGVKQHPIFTRDGA--DLYC
DNAJ_COXBU       TKTLSVKIPPGIDTGDRIRLAGEGEAGLF-GAPPGDLYVQVRVKPHPLFHREGN--DLHS
DNAJ_NEIMA       VKTVEVNIPAGIDDGQRIRLSGEGGPGMH-GAPAGDLYVTVRIRAHKIFQRDGL--DLHC
DNAJ_NEIMB       VKTVEVNIPAGIDDGQRIRLSGEGGPGMH-GAPAGDLYVTVRIRAHKIFQRDGL--DLHC
DNAJ_FRATT       QKTLKVKIPEGVDNGDRIRLQGEGDSGSN-GAMNGDLYVQIIIKEHKIFERRDI--NLYC
DNAJ_AGRFC       ERSLSVNIPSGIEDGTRIRLQGEGEAGMR-GGPAGDLYIFLSVRPHEFFQRDGA--DLYC
DNAJ_RHIME       ERTLSVNIPAGIEDGTRIRLSGEGEAGLR-GGPAGDLYIFLSVKPHEFYQRDGA--DLYC
DNAJ_BRUME       ERSLSVNIPAGIEDGTRIRLAGEGEAGLR-GGPAGDLYIFLSVKPHEFFQRDGA--DLYC
DNAJ_BRUSU       ERSLSVNIPAGIEDGTRIRLAGEGEAGLR-GGPAGDLYIFLSVKPHEFFQRDGA--DLYC
DNAJ_RHILO       ERSLSVNIPAGIEDGTRIRLANEGEAGLR-GGPSGDLYIFLAVKPHEFFQRDGA--DLYC
DNAJ_BARHE       NRSLSVNIPAGIEDSTRIRLSGEGDAGIR-GGPSGDLYIFLSVKPHEFFQREGA--DLHC
DNAJ_BARQU       NRSLSVNIPAGIEDGTRIRLSGEGDAGIR-GGPNGDLYIFLSVKPHEFFQREGA--DLHC
DNAJ_BRADU       ERTLSVNIPQGVEDGTRIRLAGEGEAGVR-GGPPGDLYIFLSLAQHQFFQRDGA--DLHC
DNAJ_RHOPA       ERTLSVNIPQGVEDGTRIRLAGEGEAGLR-GGPPGDLYIFLSLANHAIFQRDGA--DLHC
DNAJ_CAUVC       ERILSVRIPAGVDDGARIRLAGEGDAGAR-GGPRGDLYIFLSVTPHELFERDGL--DLLC
DNAJ_GLUOX       TETISIDIPAGVEDGTRIRMAGKGEAGGE-GVQPGDLYVHISVLSHDIFQRDGA--NIYC
DNAJ_ZYMMO       HKTLSVNIPAGVDDGTRIRLSGEGEAGVH-GGPAGDLYIFIHVTPHQVFQRESY--NLFA
DNAJ_RICPR       QRNLSINIPAGVENGTRIRHTGEGEAGIR-GGNNGDLYVDIAIKPHDIYKVDGA--NLHC
DNAJ_RICTY       QRNLSINIPAGVENGTRIRHSGEGEAGIR-GGNNGDLYVDIAIKPHDIYKIDGA--NLHC
DNAJ_RICCN       QRNLSVNIPAGVENGTRIRHTGEGEAGIR-GGNSGDLYVDITIKPHDIYKVDGA--NLHC
DNAJ_RUEPO       DRALSVNIPAGVETGTRIRLAGEGEAGMR-GGPPGDLYIFVEVAKHELFERDGV--NLYC
DNAJ_ANAMM       EVSLLVTVPKGIETGNKVRVNGKGEAGFR-GAQEGDLYVYIRVKEHKFFTRRSS--DLHC
DNAJ_EHRRW       EVNLLVTVPKGIESGDKIRLNGKGEAGYR-GAQSGDLYVYPNIKKHKFFTRNGA--DLYC
DNAJ_WOLPM       EVNISVSIPKGIEEGAKVRISGKGEAGTK-GGKSGDLYVYVKIIFHKIFARNKA--DLHC
DNAJ_BDEBA       HRKIRLNIPAGVDTGTRLRVATEGEGGYM-GGPPGDLYVEIRVKQHNNFERRNE--DLFA
DNAJ_DESPS       TKTVAIKIPAGVDTGARMRLRGEGEGGRR-GGPSGDLFVIVHVSSHEFFERDGD--TIYC
DNAJ_DESVH       VKELSVRIPAGVDTGNRLRLRGEGEPGIH-GGPAGDLYVVISVEDDKTFRRQGQ--DLVV
DNAJ_RHOBA       KAEMNVEIPAGVDDGMRVRLQGEGEPSPD-GGPNGDCYCFISVKEHNLFKREGQ--HLIL
DNAJ_CHLCV       KRNVHVQIPAGVDSGMRLKMEGYGDAGQN-GAPSGDLYVFIDVEAHPVFERRGD--DLIL
DNAJ_CHLPN       KRSVHVHIPAGVDSGMRLKMEGYGDAGQN-GAPSGDLYVFIDVESHPVFERRGD--DLIL
DNAJ_CHLMU       KRSVHVNIPSGVDSGMRLKMEGYGDAGQN-GAPAGDLYIFIDVEPHPVFERHGD--DLVL
DNAJ_CHLTR       KRSVHVNIPAGVDSGMRLKMEGYGDAGQN-GAPAGDLYVFIDVEPHPVFERHGD--DLVL
DNAJ_PARUW       KQHIKVHIPAGVDSGMRLKMSGYGDVGQH-GGPAGDLYVFINVEPHEIFEREGN--DILL
DNAJ_TREDE       KQRIIVTIPAGVENGKRITIPSQGNAGQA-GGDYGDLFVFIFVQAHPYFERNGI--DLYC
DNAJ_LEPIC       RRTINIKIPPGVETGSRLKVSGEGEAGPN-GGPHGDLYVVTHIKKHELFERQGN--DLIL
DNAJ_LEPIN       RRTINIKIPPGVETGSRLKVSGEGEAGPN-GGPHGDLYVVTHIKKHELFERQGN--DLIL
DNAJ_GEOSL       TKTLSVKVPAGVETGTRLKLSGEGGQGIK-GGGNGDLYVAIAVREHPIFTREDN--DVLC
DNAJ_BACAN       RKKINVKIPAGIDNGQQIRVSGKGEAGVN-GGPAGDLYVVVHVRSHEFFEREGD--HIIC
DNAJ_BACHK       RKKINVKIPAGIDNGQQIRVSGKGEAGVN-GGPAGDLYVVVHVRSHEFFEREGD--HIIC
DNAJ_BACCZ       RKKINVKIPAGIDNGQQIRVSGKGEAGVN-GGPAGDLYVVVHVRSHEFFEREGD--HIIC
DNAJ_BACC1       RKKINVKIPAGIDNGQQIRVSGKGEAGVN-GGPAGDLYVVVHVRNHEFFEREGD--HIIC
DNAJ_BACCR       RKKINVKIPAGIDNGQQIRVSGKGEAGVN-GGPARDLYVVVHVRNHEFFEREGD--HIIC
DNAJ_OCEIH       NKKIHISIPAGIDEGQQIRVAGKGESGKN-GGPAGDLFVVIKVRPHDFFVREGD--HIFC
DNAJ_BACHD       RKKINVKVPAGIDHGQQIRLSGQGEAGVN-GGPAGDLYIVFNVKPHEFFERDGD--DIYC
DNAJ_BACSK       RKKINIQVPAGIDNGQQLRVAGQGEAGAN-GGPPGDLYVVFQVKPHEFFERDGE--DIYC
DNAJ_BACLD       RKKINVTIPAGVDDGQQLRVAGQGEPGIN-GGPSGDLFVVFRVQEHEFFERDGD--DIYC
DNAJ_BACSU       RKKINVTIPAGVDDGQQLRLSGQGEPGIN-GGPAGDLFVVFHVRAHEFFERDGD--DIYC
DNAJ_LISIN       TKKIKVKVPAGVNDGQQMRVSGEGEAGIN-GGPNGDLYVVFVVIPDEFFEREAD--DIYV
DNAJ_LISMF       TKKIKVKVPAGVNDGQQMRVSGEGEAGIN-GGPNGDLYVVFVVIPDEFFEREAD--DIYV
DNAJ_LISMO       TKKIKVKVPAGVNDGQQMRVSGEGEAGIN-GGPNGDLYVVFVVIPDEFFEREAD--DIYV
DNAJ_GEOKA       RKKIHVKIPAGVDDGQQLRVAGQGEPGVN-GGPPGDLYIIFRVEPHEFFKRDGD--DIYC
DNAJ_STAAC       TVKLEVKVPEGVDNEQQIRLAGEGSPGVN-GGPAGDLYVVFRVKPSETFKRDGD--DIYY
DNAJ_STAAM       TVKLEVKVPEGVDNEQQIRLAGEGSPGVN-GGPAGDLYVVFRVKPSETFKRDGD--DIYY
DNAJ_STAAN       TVKLEVKVPEGVDNEQQIRLAGEGSPGVN-GGPAGDLYVVFRVKPSETFKRDGD--DIYY
DNAJ_STAAS       TVKLEVKVPEGVDNEQQIRLAGEGSPGVN-GGPAGDLYVVFRVKPSETFKRDGD--DIYY
DNAJ_STAAW       TVKLEVKVPEGVDNEQQIRLAGEGSPGVN-GGPAGDLYVVFRVKPSETFKRDGD--DIYY
DNAJ_STAAR       TVKLEVKVPEGVDNEQQIRLAGEGSPGVN-GGPAGDLYVVFRVKPSETFKRDGD--DIYY
DNAJ_STAES       TVKLEVTVPEGVDNEQQVRLAGEGSPGVN-GGPHGDLYVVFRVKPSNTFERDGD--DIYY
DNAJ_STAEQ       TVKLEVTVPEGVDNEQQVRLAGEGSPGVN-GGPHGDLYVVFRVKPSNTFERDGD--DIYY
DNAJ_STRA3       THKVSVKIPAGVETGQQIRLTGQGEAGFN-GGPYGDLFVIINVLPSQQFERNGS--TIYY
DNAJ_STRA5       THKVSVKIPAGVETGQQIRLTGQGEAGFN-GGPYGDLFVIINVLPSQQFERNGS--TIYY
DNAJ_STRP3       AHKVSVKIPAGVETGQQIRLQGQGEAGFN-GGPYGDLFVILNVLPSKQFERNGS--TIYY
DNAJ_STRP1       AHKVSVKIPAGVETGQQIRLQGQGEAGFN-GGPYGDLFVILNVLPSKQFERNGS--TIYY
DNAJ_STRP6       AHKVSVKIPAGVETGQQIRLQGQGEAGFN-GGPYGDLFVILNVLPSKQFERNGS--TIYY
DNAJ_STRP8       AHKVSVKIPAGVETGQQIRLQGQGEAGFN-GGPYGDLFVILNVLPSKQFERNGS--TIYY
DNAJ_STRMU       SHKVSVKIPAGVETGQQIRLAGQGEAGFN-GGPYGDLFVIINVLKSDKFERDGS--TIYY
DNAJ_STRT1       SHTVSVKIPAGVETGQQIRLAGQGEAGFN-GGPYGDLFVVINVNPSDKFTRDGS--TIYY
DNAJ_STRT2       SHTVSVKIPAGVETGQQIRLAGQGEAGFN-GGPYGDLFVVINVNPSDKFTRDGS--TIYY
DNAJ_STRPN       AHSVHVKIPAGVETGQQIRLAGQGEAGFN-GGPYGDLYVVVSVEASDKFEREGT--TIFY
DNAJ_STRR6       AHSVHVKIPAGVETGQQIRLAGQGEAGFN-GGPYGDLYVVVSVEASDKFEREGT--TIFY
DNAJ_LACLA       AHTVKVTVPAGVETGQKMRLQGQGDAGVN-GGPYGDLYVVFQVEASDKFERDGA--EIYY
DNAJ_ENTFA       AHTVKVNVPAGVEDGQQMRLANQGEAGTN-GGPYGDLYVVFRVEDSDIFDRDGA--EIYY
DNAJ_LACPL       SHSIKVTVPAGVEEGQQMRLQNQGEAGTN-GGPYGDLFIIFRVEPSKDFERDGA--TIYF
DNAJ_LACJO       KQTLQVTVPAGIDNGQQIRLSGQGEAGKN-GGPYGDLYIVFRVKPSKEFRRNGT--TIYT
DNAJ_CLOAB       KRKISVKIPAGVDTGNVIPLRGQGEHGKN-GGPAGDLYISIKVTPHKKFKREGF--DIYI
DNAJ_CLOTE       QKKIKVNIPAGVDTGNVIPIRGQGEAGVN-GGPPGDLYISVRVMPDPFFKRRGD--DIYI
DNAJ_CLOPE       NRKITVKIPAGVDTGNIIPLRGQGEQGAN-NGPAGDLYIRVNVAPSKIFRREGS--DIYY
DNAJ_CALS4       RRKIKVTIPAGIDEGQMLTLRGEGEPGLR-GGPNGDLYIVIHVKPHEIFKREGY--DVYV
DNAJ_METAC       KRTITVNVPAGADSGMSLRLSGEGDSGEP-GAPSGDLYIIIHVMEHRHFKRVDY--DVIS
DNAJ_METMA       RRKMSVNVPAGADSGMTLRLSGEGDAGEP-GAPSGDLYIIVHVMEHKYFKRVDY--DVIS
DNAJ_BACFR       EEVVTVKIPAGVAEGMQLSMGGKGNAGKH-NGIPGDLLILVEEEPHPELIRDEN--DLVY
DNAJ_BACTN       EEVVTVKIPAGVAEGMQLSMGGKGNAGKH-NGVPGDLLILVEEEPHPDLIRDEN--DLIY
DNAJ_PORGI       EEVISFHIPAGVAEGMQMSVNGKGNAAPR-GGVNGDLIVVIAEEPDPNLIRNGN--DLIY
DNAJ_CHLTE       EATVKITVPAGVQDGNYLTLQGQGNAGPR-GGAPGDLIVVIEEKPHELFKRNGD--DIIY
DNAJ_THEAC       NEDISVKIPKGATDNLRLRVQGKGQS--Y-NGRTGDLYVVLRVRNDRNVQRIND--DLMI
DNAJ_THEVO       DEDITVKIPRGATDNLRLRVSGKGQS--Y-DGRTGDLYVILRIKQDKNLQRIND--DLLL
DNAJ_PICTO       NEDISVNIPKGADTNLKLRLKNMGNS--Y-GGVTGDLYIVLIVNNPPGIRRSGQ--DIYV
DNAJ_FUSNN       TVEKKVNVPAGIDDGQKLKYAGLGEASQN-GGPNGDLYVVIRIKSHDIFVRDGE--NLYC
DNAJ_MESFL       REEVEIPLPKGLWPGQQFVMRGKGHASLE-GGIPGDLYITIGIVKSDVFELIPNSNDLIM
DNAJ_MYCMS       RKKIEVNIPKGIRPNQQIKLSQKGHASIN-NGVNGDLIIDIYLKESKVFEIVNN-NDILM
DNAJ_MYCGE       NQIKEINIPAGMYSGEALVDESG--GNEF-KGHYGKLIIQVNVLASKIFKRSDN--NVIA
DNAJ_MYCPN       PTTKEIQIPAGIYHGDALVDDHG--GNEF-GGHVGKLVVHVGVLPSKIFKRVDH--NVVA
DNAJ_MYCGA       VVERKVSIDSNVFYQDVVIVRGE--GHIY-KNLVGDLFLRVKIEPSRVFELRDN--HVVV
DNAJ_MYCPE       RVEIDVEIPGGVSNDEHLKVSGK--GSVV-GGKTGDLYINIQIKPSKIFSRKGN--DIYV
DNAJ_UREPA       RVNLTVEIPAGTREGEKLLVSKK--GNIV-NNQEFDLYLHISVKPSKYFALDGL--DIYS
DNAJ_MYCH2       KEEVTIKIPAGIQDGMFIRVAGFGGPGHK-GGPSGDLHLEINVRQHKHFTRSGN--DIHV
DNAJ_MYCMO       TKNITIKIPAGIQNGQTLRVENYGNAGLN-GGSNGNLILSIKVSPHKHFVRKNN--DIIL
DNAJ_MYCPU       SISQKISIPAGVISGQEVLLRGFGGPGFN-GGPNGDLYIRVYVTEHPYYQRIND--DIYV
DNAJ_NOSS1       TKKLKITIPAGVDNGTRLRIKDEGDAGQR-GGPPGDLYVYLFVNEDEEFQRDGI--NVIS
DNAJ_SYNP6       PKKLKINIPAGVDSGTRLRVANEGDAGLR-GGPPGDLYVYLFVSEDTQFRREGI--NLFS
DNAJ1_SYNY3      TKKLKITIPAGVDDGTRLRVGKEGDAGLR-GGPAGDLYVFLMVETDKHFVREGM--NIRS
DNAJ_THEEB       SKKLKITIPAGVDNGTRLRVSGEGDAGLR-GGPPGDLYVYLFVQPDPEFQREGN--NILS
DNAJ_PROMM       RKKLRINIPAGVDTGTRLRVAGEGNAGLR-GGPSGDLYVFLTVKSHPQLRRDGI--TVLS
DNAJ_SYNPX       RKKLRINIPAGVDTGTRLRVSGEGNAGQR-GGPSGDLYVFLTVKSHPRLRRDGL--NILS
DNAJ_PROMA       RKKLRINIPAGVDTGTRLRVSGEGNAGPR-GGPSGDLYVFLKVKSHARLKRDGL--NIHS
DNAJ_PROMP       RKKLRINIPAGVDSGTKLRVSGEGNVGLK-GGPPGDLYVFIKVKNDSNLKREGI--NIYS
DNAJ_GLOVI       QTTIKITIPAGVDAGSRLRVQGEGDAGMR-GGPPGDLFIYVSVRNHPVFRREGQ--DIYS
DNAJ1_COREF      RRDIVADIPAGIQSGMRIRMAGQGEVGAG-GGPAGDLYVEVMVRPHAVFTRDGD--DLHA
DNAJ1_CORGL      RRDIVANIPAGIQSGMRIRMAGQGEVGAG-GGPAGDLYIEVMVRPHAIFTRDGD--DLHA
DNAJ1_CORDI      QRDLIVNVPAGIADGMRIRMAGQGEVGPG-GGPAGDLYIEVMMQQHPVFQREGN--DLHM
DNAJ2_MYCBO      RREISVKIPAGVGDGMRVRLAAQGEVGPG-GGPAGDLYVEVHEQAHDVFVREGD--HLHC
DNAJ2_MYCTU      RREISVKIPAGVGDGMRVRLAAQGEVGPG-GGPAGDLYVEVHEQAHDVFVREGD--HLHC
DNAJ1_MYCPA      RREISVKIPAGVGDGMRVRLAAQGEVGPG-GGPAGDLYVEVHEQPHDVFVREGD--DLHC
DNAJ2_MYCLE      RREITVKIPSGVGDGMRVRLAAQGEVGPG-GGPAGDLYVEVHEQAHDIFVRDGD--DLHC
DNAJ1_NOCFA      RREIAAPIPAGVANGMRVRLAAQGEVGPG-GGPPGDLYVEIVEQPHDVFVRDGD--DLHC
DNAJ2_STRAW      RRTLTVKIPAGVDNGTRIQLAGEGEVGPG-GGPAGDLYVEIHELPHQTFQRRGD--DLHC
DNAJ2_STRCO      RRTLTVKIPAGVDNGTRIQLAGEGEVGPG-GGPAGDLYVEIHELPHSTFQRRGD--DLHC
DNAJ1_CUTAK      TRTINVKIPAGVADGNRIHLDSRGEVGPG-GGPAGDLYIEMTVSPHDVFTRHGD--DLEM
DNAJ_LEIXX       RRTVPVDIPAGVDTGLRLQMPGSGEAGPA-GGPNGDLYLEIKVKHHDVFSRDGD--DLLC
DNAJ_BIFLO       TRTVGVTVPAGINDNARLRLANQGEVGEG-GGAAGDLYIDIRIKADKQFTRDGD--DLHC
DNAJ_TROW8       PRDITINIPPGVETGMRIKIPNMGNAG---GAMPGDLYVDCKVKEHPYFLRDGQ--DLYC
DNAJ_TROWT       PRDITINIPPGVETGMRIKIPNMGNAG---GAMPGDLYVDCKVKEHPYFLRDGQ--DLYC
DNAJ_THET2       EERVRVQVPPGMDEGHLLRVPGYGNLGPG-G--PGDLYLRIRVRPHPHLERQGP--DLVY
DNAJ1_THET8      EERVRVQVPPGMDEGHLLRVPGYGNLGPG-G--PGDLYLRIRVRPHPHLERQGP--DLVY
DNAJ_DEIRA       SEPVKVKLPKGIDEGYRIRVAGQGNEGPG-G--NGDLYVHIEMEPHPELHRQDE--NLIF
DNAJ_SYMTH       TQRVEVKVPGGVETGTRLRMPGYGEAGER-GGPPGDLFIVMRVRPDRRFRREGD--DLFT
DNAJ_METTH       TSTIHVKVPAGVETGSRLRVPGEGEMGLR-GGEPGDLYVVIKVKPHSIFRREGA--NLYT
DNAJ_HALMA       DASLEVEIPSGIADGQTLRMEREGAPGEN-GGPNGDLLIEVQVRDHPDFERDGD--SLQH
DNAJ_HALSA       RATLTVDIPEGIRTGQTLRMDGEGAPGEP-GAPNGDLLVDVTVEEHPDFERDGD--DLHH
DNAJ1_AROAE      ARKLHVRIPAGVLDGDELRVAGADEDCDRSGGEPGDLILRVVLAPHALYRLDGR--DLIL
                        :  .      .                 .                     :  

DNAJ2_COREF      TVPVSFSELALGGAISVPTLDKP----------VKLKLAPGTPDGRTLRVRGRGVETRT-
DNAJ2_CORGL      TIPVSFSELALGGAISVPTLNKP----------VKLKLPAGTPDGRTLRVRGRGIEARD-
DNAJ2_CORDI      TVPVSYAELALGDTISVPTLDLP----------VRVRIPSGTPNGRVLRVRGKGVPKRGG
DNAJ1_MYCBO      TVPVSFTELALGSTLSVPTLDGT----------VGVRVPKGTADGRILRVRGRGVPKRSG
DNAJ1_MYCTU      TVPVSFTELALGSTLSVPTLDGT----------VGVRVPKGTADGRILRVRGRGVPKRSG
DNAJ2_MYCPA      TVPVSFTELALGSTISVPTLDGK----------VGVRVPKGTADGRILRVRGRGVPKRSG
DNAJ1_MYCLE      TIPVSFTELALGSTLSVPTLDGT----------VGVRVPKGTSDGRILRVRGRGVPKRSG
DNAJ2_NOCFA      VLPVSYAELVLGTTVSVPTLDGR----------VGVKVPPGTADGRTLRVRGRGVPKRGG
DNAJ1_STRAW      TVPVTFAEAALGGEVKVPTLGGPA---------VTLKLPPGTPNGRTMRARGKGAVRKDG
DNAJ1_STRCO      TVPVTYAEAALGGEVRVPTLGGPS---------VTLKLPAGTPNGRTMRARGKGAVRKDG
DNAJ2_CUTAK      TVPVTFPEATLGAEVEVPTLAGTT---------VRLRIPAGTPNGRTFRVRGRGVPRSDG
DNAJ1_AQUAE      EKVVSFPLAVLGGTVKVPTLEGE---------EIDVFIQPGTECGATKVVKEKGYPYE--
DNAJ2_AQUAE      DVNITYPEAVLGTEVEVPTLDGE---------KVKVKIPPGTKEGELIKVPGKGMPRLKG
DNAJ_THEMA       DVTIDYLQAILGTTVEVPLPEGG---------TTMLKIPPGTQPETVFRLKGKGLPNRY-
DNAJ_BORBU       MLPISFTQAALGKEVKIKTIASK---------EIKIHIPKGINNEEQILIKNAGMPILQT
DNAJ_BORBP       MLPISFTQAALGKEVRIKTIASK---------EIKIQIPKGIENEEQIIVKGAGMPILQT
DNAJ_CAMJE       EFPVFFTQAILGESIKVPTIRG----------EATLNLPKGAKDGQRFVLEKEGVKDVHS
DNAJ_CAMJR       EFPVFFTQAILGESIKVPTIRG----------EATLNLPKGAKDGQRFVLEKEGVKDVHS
DNAJ_HELHP       EVPVFFTSIVLGTTLKIPSLRG----------ELELKIPPNTRDKEQFVFDNEGIKDVNS
DNAJ_WOLSU       HVPLFFSTVPLGTTLKIPSLRG----------ELELKIPPNTKDKEQFVFKNEGVKDVHS
DNAJ_HELPJ       KAPVFFTTIALGHTIKVPSLRGD---------ELELKIPRNAKDRQAFAFRNEGVKHPES
DNAJ_HELPY       KAPVFFTTIALGHTIKVPSLKGD---------ELELKIPRNARDKQTFAFRNEGVKHPES
DNAJ_ECO57       EVPINFAMAALGGEIEVPTLDGR----------VKLKVPGETQTGKLFRMRGKGVKSVRG
DNAJ_ECOL6       EVPINFAMAALGGEIEVPTLDGR----------VKLKVPGETQTGKLFRMRGKGVKSVRG
DNAJ_ECOLI       EVPINFAMAALGGEIEVPTLDGR----------VKLKVPGETQTGKLFRMRGKGVKSVRG
DNAJ_SHIFL       EVPINFAMAALGGEIEVPTLDGR----------VKLKVPGETQTGKLFRMRGKGVKSVRG
DNAJ_SALTI       EVPINFAMAALGGEIEVPTLDGR----------VMLKVPSETQTGKLFRMRGKGVKSVRG
DNAJ_SALTY       EVPINFAMAALGGEIEVPTLDGR----------VMLKVPSETQTGKLFRMRGKGVKSVRG
DNAJ_SALPA       EVPINFAMAALGGEIEVPTLDGR----------VMLKVPSETQTGKLFRMRGKGVKSVRG
DNAJ_YERPE       EVPINFAMAALGGEIEVPTLDGR----------VKLKIPAETQTGKMFRMRGKGVKSVRG
DNAJ_YERPS       EVPINFAMAALGGEIEVPTLDGR----------VKLKIPAETQTGKMFRMRGKGVKSVRG
DNAJ_PECAS       EVPINFAMAALGGEIEVPTLDGR----------VKLKVPAETQTGKLFRMRGKGVKSVRG
DNAJ_PHOLL       EVPVNFAMAALGGEIEVPTLDGR----------VKLKIPAETQTGKMFRMKGKGVKSVRG
DNAJ_BLOFL       EVPISFSMAALGGEIEVPTLDGR----------VKLKIPPETQTGKLFRMRGKGVKSVRG
DNAJ_WIGBR       EVPINFAMAALGGDIEVPALDGR----------VKLRIPAETQTGRLFRMRGKGVKSIRS
DNAJ_BUCAI       EVPINFTMAALGGEIEVPTLDGR----------VKLKIPYETQSGKLFRIRGRGVKSVQN
DNAJ_BUCAP       EVPINFTMAALGGEIEVPTLDGR----------VNLKIPSETQSGKLFRIRGKGVKSVQS
DNAJ_BUCBP       EVPISFSMAALGGEIEVPTLDGK----------VKLKIPCETQSGKLLRIRGRGVKSIRN
DNAJ_VIBVU       EVPVSFAMAALGGEVEVPTLDGR----------VNLKVPSETQTGRMFRMRGKGVKGVRG
DNAJ_VIBVY       EVPVSFAMAALGGEVEVPTLDGR----------VNLKVPSETQTGRMFRMRGKGVKGVRG
DNAJ_VIBPA       EVPVSFAMAALGGEVEVPTLDGR----------VSLKVPSETQTGRMFRMRGKGVKGVRG
DNAJ_VIBCH       EVPVSFAMAALGGEVEVPTLDGR----------VSLKVPAETQTGRMFRMRGKGVKGVRS
DNAJ_PHOPR       EVPVSFTMAAVGGEVEVPTLNGR----------VNLKVPSETQTGRMFRMRGKGVKSVRG
DNAJ_SHEON       EVPISFSKAALGGEIEVPTLDGK----------VSLKIPAETQTGRMFRLRGKGVKSVRS
DNAJ_IDILO       EVPVSFTKAALGGDIEVPTLEGK----------VKLKVPKETQTGKHFRLRGKGVKSVRT
DNAJ_MANSM       EVPISFTMAALGGEIEVPTLDGR----------VKLKIPAETQTGKLFRMRGKGVTSTRA
DNAJ_PASMU       EVPISFTMAALGGEIEVPTLDGR----------VKLKIPAETQTGKLFRMRGKGVTSARS
DNAJ_HAEIN       EVPISFATAALGGEIEVPTLDGR----------VKLKIPAETQTGKLFRMRGKGVASTRS
DNAJ_HAEDU       EVPISFSMAALGGEIEVPTLDGK----------LKLKIPTETQTGKLFRVRGKGVVSPRG
DNAJ_XANAC       EVPIRISQAALGDTVRVATLGGE----------AEIRIPAETQTGKLFRLRGKGVRSVRS
DNAJ_XANCP       EVPIRISQAALGDTVRVATLGGE----------AEIRIPAETQTGKLFRLRGKGVRSVRS
DNAJ_XYLFA       EVPVRISQAALGDIVRVATLDGE----------AEIRIPAETQSGKLFRLRGKGVRSVRS
DNAJ_XYLFT       EVPVRISQAALGDIVRVATLDGE----------AEIRIPAETQSGKLFRLRGKGVRSVRS
DNAJ_ACIAD       DVPVSIADAALGKEIEIPTLEGR----------VSLKIPEGTQTGKLFRLRGKGVRPVRS
DNAJ2_AROAE      EMPISITTAALGGEIEIPTLEGM----------ARLKIPAETQSGKVFRLRGKGIRNVRS
DNAJ_CHRVO       EMPISFSTAALGGEVEIPTLDGM----------AKVKISPETQSGRVYRLRGKGVKAVRG
DNAJ_NITEU       EIPISFTVAALGGEIEVPTLDGH----------ARIKVPAGTQTGKIFRLRSKGITGVRN
DNAJ_BORPA       ELTIPFTTAALGGELQVPTLGGK----------AEISIPEGTQSGKTFRLRAKGIRGVRG
DNAJ_BORPE       ELTIPFTTAALGGELQVPTLGGK----------AEISIPEGTQSGKTFRLRAKGIRGVRG
DNAJ_BORBR       ELTIPFTTAALGGELQVPTLGGK----------AEISIPEGTQSGKTFRLRAKGIRGVRG
DNAJ_BURMA       QMPIPFTTAALGGEIEVPTLAGR----------ASFTVPEGTQSGKTFRLRGKGIKGLHS
DNAJ_BURPS       QMPIPFTTAALGGEIEVPTLAGR----------ASFTVPEGTQSGKTFRLRGKGIKGLRS
DNAJ_RALSO       QMPISFAVAAMGGDIEVPTLGGR----------VTFNVPEGTQAGKTFRLRGKGIKGVRS
DNAJ_LEGPA       EVPISFATAALGGSIEVPTLEGR----------VTLKIPAETQTGKVFRLRSKGMKSVRG
DNAJ_LEGPH       EVPISFATAALGGSIEVPTLEGR----------VTLKIPAETQTGKVFRLRSKGMKSVRG
DNAJ_LEGPL       EVPISFATAALGGSIEVPTLEGR----------VTLKIPAETQTGKVFRLRSKGMKSVRG
DNAJ_PSEPK       EVPISYTDAALGGELEVPTLDGR----------VKLKIPEGTQTGKQFRLRGKGVAPVRG
DNAJ_PSESM       EVPISFTDAALGGELEVPTLDGR----------VKLKIPEGTQTGKQFRLRGKGVAPVRG
DNAJ_PSEAE       EVPISFADAALGGELEVPTLDGR----------VKLKIPESTQTGKLFRLRGKGVAPVRG
DNAJ_METCA       EVPIGFPTACLGGELEVPTLDGK----------VVLKIPAETQTGRLFRVRGKGVKPVRG
DNAJ_COXBU       EVPIDFTTAALGGEMEIPTLDGS----------VRLTIPPETQGGKQFRLRGKGVKALRS
DNAJ_NEIMA       ELPISFATAALGGELEVPTLDGK----------VKLTVPKETQTGRRMRVKGKGVKSLRS
DNAJ_NEIMB       ELPISFATAALGGELEVPTLDGK----------VKLTVPKETQTGRRMRVKGKGVKSLRS
DNAJ_FRATT       EMPISFTKACLGGDIKVPTLDGE----------VVLKVVPETQTGKVFRLREKGMKSLRG
DNAJ_AGRFC       TVPISMTTAALGGTFDVTTLDGT---------KSRVTVPEGTQPGKQFRLKGKGMPVLR-
DNAJ_RHIME       AVPISMTTAALGGKFDVTTLDGT---------KSRVTVPEGTQAGKQFRLKGKGMPVLR-
DNAJ_BRUME       KVPISMTTAALGGQFEVSTLDGT---------QTRVKVPEGTQNGKQFRLKGKGMPVLR-
DNAJ_BRUSU       KVPISMTTAALGGQFEVSTLDGT---------QTRVKVPEGTQNGKQFRLKGKGMPVLR-
DNAJ_RHILO       KVPISMTTAALGGSFEVTTLDGT---------QTKVKVPEGTQNGRQFRLKGKGMPVLR-
DNAJ_BARHE       RVPISMVTAALGGEFEVSDLDGI---------KARVKIPEGTQNGRQFRLKGKGMPMLRR
DNAJ_BARQU       RIPLSMVTAALGGEFEVSDLDGI---------KARVKIPEGTQNGRQFRLKGKGMPMLRR
DNAJ_BRADU       RVPISMVTAALGGEFEVPTIEKG---------KAKVKVPAGTQSNRRFRIASKGMPVLR-
DNAJ_RHOPA       RVPISMVTAALGGEFEVPTIDRG---------KTKVKVPSGTQTGRRFRIAGKGMPVLR-
DNAJ_CAUVC       TVPVPMTTAALGGEIDAPCLLGGESCDG--ECKVKVHVPEGAQTGKTVRLKGKGMPSLR-
DNAJ_GLUOX       RVPLRMTQAALGTEVEVPVVDGG---------RSKVRIPAGTQTGETFRLRGKGFSVLR-
DNAJ_ZYMMO       HVPISFTKAALGGSIHVPSLDGE---------QYEISIPAGIQSGKQLKRRGAGMPVLN-
DNAJ_RICPR       KLPISFVHAALGGEIEVPVIEGG---------KVKLTIPAGTQNGDQLRLRSKGMSKVR-
DNAJ_RICTY       KLPISFVHAALGGEIEVPVIEGG---------KVKLTIPAGTQNGDQLRLRSKGMSKIR-
DNAJ_RICCN       KLPISFVNAALGGEIEVPVIEGG---------KVNLTIPAGTQNGDQLRLRSKGMSKMR-
DNAJ_RUEPO       RVPVSMAKAALGGAIEVPTIDGG---------RGRVQVPAGSQSGRQMRLRSKGMPALR-
DNAJ_ANAMM       SVPIKMTIAALGGEIEMPSIDGS---------WTKLKIPEGTQSGDQIRMRGKGMPEVNS
DNAJ_EHRRW       NVPIKMILATLGGHIEMPSIDGT---------WTKVKVPEGSQNGDKLRLKEKGMPVINS
DNAJ_WOLPM       KVPIRMTLAVLGGEIDIQSIDGA---------KIKVKVPEGTQTGTKLRCREKGMPYMNS
DNAJ_BDEBA       ELSLPYVQMLLGAEIEVPTVTG----------KAKLEVPKGTHHGDNVKLVGEGLPSLRG
DNAJ_DESPS       RLPVSMTTAALGDTVDVPTVHG----------KKNLKIPAGSQSGERFTLRGEGVPSLRG
DNAJ_DESVH       TREISFVQASLGDRIDVPTLDD----------DITLDIPAGTQSGEVFRLVDKGLPYLGH
DNAJ_RHOBA       QMPISYAQAALGATINVPTLDG----------PHELTVPAGTQTGHVFTVRGQGIVDPRS
DNAJ_CHLCV       ELPIGFVDAALGMKKEIPTLLK--------EGMCRLTVPEGIQSGTILKVKNQGFPNVHG
DNAJ_CHLPN       ELPIGFVDAALGMKKEIPTLLKT-------EGSCRLTVPEGIQSGTILKVRNQGFPNVHG
DNAJ_CHLMU       ELPIGFVDAALGIKKEIPTLLK--------EGTCRLNIPEGIQSGTVLKVRGQGFPNVHG
DNAJ_CHLTR       ELPIGFVDAALGIKKEIPTLLK--------EGTCRLSIPEGIQSGTVLKVRGQGFPNVHG
DNAJ_PARUW       DLPISFAEAALGCKKEVPSLTN---------RACRITIPEGTQNGKIFRVKGEGFPNVHG
DNAJ_TREDE       AVPISMTQAALGGEINIKSLDE---------KTLRLKIPAGTQNGKLLRIRGEGVPTGIG
DNAJ_LEPIC       VRKISLAQAILGAEIEVPTIDG---------KKAKMKIPEGTESGQVFRLKGHGMPYLGA
DNAJ_LEPIN       VRKISLAQAILGAEIEVPTIDG---------KKAKMKIPEGTESGQVFRLKGHGMPYLGA
DNAJ_GEOSL       EIPVSFVQAALGCEIEVPTLDG---------K-VSMKIPEGTQSGRIFRLRGKGVPQLQG
DNAJ_BACAN       EMPLTFAQMALGAEVEVPTVHGK----------VKLKIPAGTQTGTEFRLKGKGAPNVRG
DNAJ_BACHK       EMPLTFAQMALGAEVEVPTVHGK----------VKLKIPAGTQTGTEFRLKGKGAPNVRG
DNAJ_BACCZ       EMPLTFAQMALGAEVEVPTVHGK----------VKLKIPAGTQTGTEFRLKGKGAPNVRG
DNAJ_BACC1       EMPLTFAQMALGDEVEVPTVHGK----------VKLKIPAGTQTGTEFRLKGKGAPNVRG
DNAJ_BACCR       EMPLTFAQMALGDEVEVPTVHGK----------VKLKIPAGTQTGTEFRLKGKGAPNVRG
DNAJ_OCEIH       ELPLTYAQAALGDELEVPTVHGK----------VKVKVPAGTQTGKTFRIKGKGAPNVRG
DNAJ_BACHD       EMPLTFVQVALGDEIEVPTLNGK----------VKLKIPAGTQTGTSFRLRGKGVPNVHG
DNAJ_BACSK       EVPLTFPQVALGDEIEVPTLTGK----------VKLKIPAGTQTGTSFRLRGKGVPNVHG
DNAJ_BACLD       EMPLTFAQAALGDEIEVPTLHGK----------VKLKVPAGTQTGTKFRLKGKGVANVRG
DNAJ_BACSU       EMPLTFAQAALGDEVEVPTLHGK----------VKLKIPAGTQTGTKFRLRGKGVQNVRG
DNAJ_LISIN       EVPITFVQATLGDEIDVPTVHGK----------VRLKIPSGTQTGTTFRLRGKGVPHLRG
DNAJ_LISMF       EVPITFVQATLGDEIDVPTVHGK----------VRLKIPSGTQTGTTFRLRGKGVPHLRG
DNAJ_LISMO       EVPITFVQATLGDEIDVPTVHGK----------VRLKIPSGTQTGTTFRLRGKGVPHLRG
DNAJ_GEOKA       EVPLSFAQAALGDEIEVPTLHGH----------VKLKIPAGTQTGTRFRLKGKGVPNVRG
DNAJ_STAAC       KLNVSFPQAALGDEIKIPTLNNE----------VMLTIPAGTQTGKQFRLKEKGIKNVHG
DNAJ_STAAM       KLNVSFPQAALGDEIKIPTLNNE----------VMLTIPAGTQTGKQFRLKEKGIKNVHG
DNAJ_STAAN       KLNVSFPQAALGDEIKIPTLNNE----------VMLTIPAGTQTGKQFRLKEKGIKNVHG
DNAJ_STAAS       KLNVSFPQAALGDEIKIPTLNNE----------VMLTIPAGTQTGKQFRLKEKGIKNVHG
DNAJ_STAAW       KLNVSFPQAALGDEIKIPTLNNE----------VMLTIPAGTQTGKQFRLKEKGIKNVHG
DNAJ_STAAR       KLNVSFPQAALGDEIKIPTLNNE----------VMLTIPAGTQTGKQFRLKEKGIKNVHG
DNAJ_STAES       NLDISFSQAALGDEIKIPTLKSN----------VVLTIPAGTQTGKQFRLKDKGVKNVHG
DNAJ_STAEQ       NLDISFSQAALGDEIKIPTLKSN----------VVLTIPAGTQTGKQFRLKDKGVKNVHG
DNAJ_STRA3       TLKISFVQAALGDTIDIPTVHGA----------VEMSIPAGTQTGKTFRLRGKGAPKLRG
DNAJ_STRA5       TLNISFVQAALGDTIDIPTVHGA----------VEMSIPAGTQTGKTFRLRGKGAPKLRG
DNAJ_STRP3       NLDISFTQAALGDTVEIPTVHGD----------VEMAIPAGTQTGKTFRLKGKGAPKLRG
DNAJ_STRP1       NLDISFTQAALGDTVEIPTVHGD----------VEMAIPAGTQTGKTFRLKGKGAPKLRG
DNAJ_STRP6       SLDISFTQAALGDTVEIPTVHGD----------VEMAIPAGTQTGKTFRLKGKGAPKLRG
DNAJ_STRP8       SLDISFTQAALGDTVEIPTVHGD----------VEMAIPAGTQTGKTFRLKGKGAPKLRG
DNAJ_STRMU       SMDINFVQAALGDTVEVPTVHGN----------VELAIPAGTQTGKTFRLKGKGAPRLRG
DNAJ_STRT1       TLNISFVQAALGDTVEVPTVHGN----------VEMVIPAGTQTGKTFRLKGKGAPRLRG
DNAJ_STRT2       TLNISFVQAALGDTVEVPTVHGN----------VEMVIPAGTQTGKTFRLKGKGAPRLRG
DNAJ_STRPN       NLNLNFVQAALGDTVDIPTVHGD----------VELVIPEGTQTGKKFRLRSKGAPSLRG
DNAJ_STRR6       NLNLNFVQAALGDTVDIPTVHGD----------VELVIPEGTQTGKKFRLRSKGAPSLRG
DNAJ_LACLA       KMPMDFVQAALGDEIEVPTVHGN----------VKLKIPAGTQTGANFRLKGKGAPKLRG
DNAJ_ENTFA       DLPVSFVQAALGDEVTVPTVHGD----------VKLKIPAGTQTGTNFRLRGKGAPRLRG
DNAJ_LACPL       KLPIDFVQAALGDEVQVKTVHGD----------VKLKIPAGTQTGTTFRLRGKGAPRLRG
DNAJ_LACJO       EAPISFAQAALGDKIRVNTVHGP----------VDLTIPAGTQPNTNFKLRGQGVPKING
DNAJ_CLOAB       DTHISFPKAALGTDMTVPTIDGD----------VKYTIPAGTQSGTVFRLKGKGVQRVNG
DNAJ_CLOTE       DQHISFAKASLGTELKVKTIDGE----------VKYDIPSGTQPGTVFRLKGKGVPHVNG
DNAJ_CLOPE       DYKISMAKAALGAEITVPTVDGN----------VKYKVPAGTQPGTKFRLKGKGVPHVNG
DNAJ_CALS4       KIPISFADAALGGEIKIPTLDGM----------VSFTIPEGTQTGTKFKLRGKGIPHIGG
DNAJ_METAC       ELSITFTQAALGADVMVDTLYGK----------VKMNIPAGTQTHSVFRLRDKGIQRLHG
DNAJ_METMA       ELPISFTQAALGADIMVDTLYGK----------VKMNIPSGTQTHSVFRLKDKGIQRLQG
DNAJ_BACFR       NLLLSFPTAAIGGAVEIPTIDGK----------VKVKIEAGTQPGKVLRLRGKGLPSVNG
DNAJ_BACTN       NLLLSFPTAALGGAVEIPTIDGK----------VKVKIDSGTQPGKVLRLRGKGLPNVNG
DNAJ_PORGI       NLLISVPLAIKGGSVEVPTIDGR----------AKIRIEAGTQPGKMLRLRNKGLPSVNG
DNAJ_CHLTE       DLSVGFPDLVMGTKIEVPTLDGH----------VKLTIPAGTQPNTMLRIGGKGIGHLRG
DNAJ_THEAC       DQKINFAQAALGDTIEVNLFREK----------YSLKIPEGTQPGEVLRIKGAGMPHLNG
DNAJ_THEVO       DQKINFGQAALGADIPIQIFNEK----------YNLKIPEGTQPGDVIKIKGAGMPHLNG
DNAJ_PICTO       EHTIDFPEAALGGEEEIKLFRES----------YNLKIPAGTQPGEILKIKGAGMPRING
DNAJ_FUSNN       EVPISYSTAVLGGEVEIPTLNGK----------KMIKVPEGTESGKLLKVKGEGIKSLRG
DNAJ_MESFL       NYNISYLDAILGNEVIIKTLDGP----------VRLKIPKGVYSGQLIKVHDKGLYKNQT
DNAJ_MYCMS       TYNISYLDAILGNEIIIKTLDGD----------IKYKLPKSINSNEFIIINNKGLYKSIN
DNAJ_MYCGE       NVLVDPMVAIVGGVIELPTLEGI----------KEFNIRPGTKSGEQIVIPNGGIKFSKS
DNAJ_MYCPN       NVLVDPMIAITGGKIELPTLEGI----------KEFNLRAGTKSGEQIVIPGGGIKFTKN
DNAJ_MYCGA       NVLVDPLVAITGGTILIPTLKEI----------KEINLKAGTKNGDIITIANGGINLKLD
DNAJ_MYCPE       ILKVDPILAIVGGEANIPTPFGI----------KSIKMKPGTRNGEIITVPSHGVKSTKR
DNAJ_UREPA       ETYIDPIKAIVGGIIEVVTINGI----------KTIEIPSNTPEGKKFRISGSGIVNKKS
DNAJ_MYCH2       NMPVSIIDVINQNTVEVPSPTGL----------KKVRLYDYYKSGQIVNVLRAGAPDPKN
DNAJ_MYCMO       RLPVSIKSVIGSEKVEVPTPYGF----------EIIKIDPNIKTGDELIIKNKGIITKYE
DNAJ_MYCPU       DFPISIVNLILEKPVVVPTPYGD----------EKIKIKSTFKNDQIITFKGKGFKRKNR
DNAJ_NOSS1       EIKVSYLQAILGCRLEVNTVDGPVEL----------IIPAGTQPNTVMKLENRGVPRLGN
DNAJ_SYNP6       TVTISYLQAILGCSLEVATVDGPTEL----------IIPPGTQPNAVLTVEGKGVPRLGN
DNAJ1_SYNY3      NLEVSYLQAILGCRLEVDTVDGKAEL----------TIPAGTQPNTVLTLENKGVPKLGN
DNAJ_THEEB       RIKISYLQAILGCRISVSTVDGEAEL----------KIPAGTQPGTVLVLEGRGVPRVGN
DNAJ_PROMM       EVNVSYLQAILGDIIEVDTVDGNTSL----------EIPAGTQPNAVLTLENKGIPKLGN
DNAJ_SYNPX       TVNVSYLQAILGDTIEVETVDGDTVL----------EIPPGTQPGTVLTLANKGIPKLGN
DNAJ_PROMA       EVNVSYLQAILGDTIEVDTVDGPTTL----------QIPSGTQPSAVLILDNKGIPKLGN
DNAJ_PROMP       EISVSYLQAILGDTVDIITVDGKVNL----------KIPSGTQPNSTLSLENKGVPRLGN
DNAJ_GLOVI       IAEISYLQAILGSQMSVETVDGPQTV----------VVPPGTQPETVLTLDGKGVPRIGN
DNAJ1_COREF      SIRVPMIDAALGSELEVESLTGEEIT---------VVIPAGTQPNQVITLEGEGMPRLRA
DNAJ1_CORGL      SIKVPMFDAALGTELDVESLTGEEVK---------ITIPAGTQPNDVITLDGEGMPKLRA
DNAJ1_CORDI      SVHVPMVDAALGATTSVESLSGDAID---------FEIPAGVQPAETIVIEGKGMPQLRG
DNAJ2_MYCBO      TVSVPMVDAALGVTVTVDAILDGLSE---------ITIPPGTQPGSVITLRGRGMPHLRS
DNAJ2_MYCTU      TVSVPMVDAALGVTVTVDAILDGLSE---------ITIPPGTQPGSVITLRGRGMPHLRS
DNAJ1_MYCPA      TVSVPMVDAALGATVTVDAILDGVSE---------ITIPPGTQPGSVITLRGHGMPHLRS
DNAJ2_MYCLE      TVSVPMVDAALGTTITVDAILDGMSE---------IDISPGTQPGSVIELRGQGMPHLRS
DNAJ1_NOCFA      TIRVPMVDAALGTTVVIDTILDGPTE---------LTIPPGTQPGEVSVLRGHGMPKLRS
DNAJ2_STRAW      TVTIPMTAAALGTKVPLETLDGMEE----------VDIRPGTQSGQSIPLHGRGITHLRG
DNAJ2_STRCO      TVTIPMTAAALGTKVPLETLDGMEE----------VDIRPGTQSGQSIPKHGRGVTHLRG
DNAJ1_CUTAK      VVTIPMTAAALGTKVPMHTLEADREDFAEDTKTVTVEVPAGTQSGTRIVVSERGVPRLRR
DNAJ_LEIXX       TLEVSMADAILGAAATIKALDGDIR----------LELKPGTQSADIVSVKDRGITHLRC
DNAJ_BIFLO       WIQVPMSWAVLGHDLSIDTFDGEKT----------VSIPAGCQTEDTVTLKGLGVTNIRN
DNAJ_TROW8       RLDISLVDALLGTKVKIDSLDGELAV----------VIPALSQNRDVIRIANKGAVTLRG
DNAJ_TROWT       RLDISLVDALLGTKVKIDSLDGELAV----------VIPALSQNRDVIRIANKGAVTLRG
DNAJ_THET2       RLRLGLAQAALGARVVVPGLEGP----------IPLDIPPGTGHGEVFALEGGGLPLPGG
DNAJ1_THET8      RLRLGLAQAALGARVEVPGLEGP----------IPLDIPPGTGHGEVFALEGGGLPLPGG
DNAJ_DEIRA       PARIGFATAALGGRIQVPTLDGP----------QEVEVKPGTQHGELHRLRGQGMPRLQG
DNAJ_SYMTH       TTEISFIQAALGTEIEVETLDGP----------ELIKIPEGTQPGDTIRLKGKGTHRLRG
DNAJ_METTH       EKPISFVQAALGDTVEVPTLDRP----------VKLRIPAGTQSGTTFRVKGHGMPHLKW
DNAJ_HALMA       QQAISFPQAVFGDTITVPTLDGE----------VEVDVPSGTQSGEVFRLEGKGMPRLRR
DNAJ_HALSA       RHAVSFPQAVFGAEIEVPTLDGA----------ATFDLDAGTQSGETFRLKGKGMPRLRR
DNAJ1_AROAE      SRPVSAFRMLLGGELPIPLPDGV----------RHLKLESGRATTRELRVKGAGFPGRGK
                    :                                 :               *      

DNAJ2_COREF      ---------AKGDLMVTVQVTV--PPTLSDEAAEALRTYAEAE-----------------
DNAJ2_CORGL      ---------STGDLLVTVQVSV--PKNLDDNAAEALRAYAEAE-----------------
DNAJ2_CORDI      ---------SAGDLLVKVEVTV--PSSLDAASASALRAYVQAE-----------------
DNAJ1_MYCBO      ---------GSGDLLVTVKVAV--PPNLAGAAQEALEAYAAAE-----------------
DNAJ1_MYCTU      ---------GSGDLLVTVKVAV--PPNLAGAAQEALEAYAAAE-----------------
DNAJ2_MYCPA      ---------GHGDLLVTVKVAV--PPNLDGAAQEALEAYAAAE-----------------
DNAJ1_MYCLE      ---------GHGDLLVTVKVAV--PLNLEGAAQKALEAYAAAE-----------------
DNAJ2_NOCFA      ---------GAGDLLVTVKVAV--PQKLDDDALEALERYREAE-----------------
DNAJ1_STRAW      ---------TRGDLLVTVEVTV--PKDVSGKARDALEAYREAT-----------------
DNAJ1_STRCO      ---------TRGDLLVTVEVSV--PKDLTGKARDALQAYREAT-----------------
DNAJ2_CUTAK      ---------SRGDLLATVEIAV--PESLDDDARHVVERLRDSL-----------------
DNAJ1_AQUAE      --------NGRGDLIIHIRIGV--PKNLSKSERKLLEKLAESIKEEGEEVYREGGS----
DNAJ2_AQUAE      --------SGRGDLYVRVHIDV--PKIGVLSKLLGDGKKVEELLKQLQEVLPKPER----
DNAJ_THEMA       --------GRRGDLIVNVHVEI--PKSLSREER----KVLEELAKKRGVTIG--------
DNAJ_BORBU       --------EKFGNLILITKIKT--PKNLNSNAIKLFENLGKELK--DGDE----------
DNAJ_BORBP       --------EKFGNLILITKIKT--PKNLNSNAIKLFENLSKELR--DGDE----------
DNAJ_CAMJE       --------SRMGNQIVQISIKF--PTSLNDEQKELLEKLSESFG--IKDGMHQEQ-----
DNAJ_CAMJR       --------SRIGNQIVQISIKF--PTSLNDEQKELLEKLSESFG--IKDGMHQEQ-----
DNAJ_HELHP       --------AYRGKFVAQIKITY--PPKLNAEQRALTEKLQESFG--IESEPYKNVF----
DNAJ_WOLSU       --------AKKGNLIAQVKIVY--PAKINDEQRELLEKLSRSFG--VEGTPHEKGF----
DNAJ_HELPJ       --------SYRGSLIVELQVIY--PKSLNKEQQGLLEKLHASFG--YEGEPHKSVL----
DNAJ_HELPY       --------SYRGSLIVELQVIY--PKSLNKEQQELLEKLHASFG--YEGEPHKSVL----
DNAJ_ECO57       --------GAQGDLLCRVVVET--PVGLNEKQKQLLQELQESFG-GPTGEHNSPRS----
DNAJ_ECOL6       --------GAQGDLLCRVVVET--PVGLNEKQKQLLQELQESFG-GPTGEHNSPRS----
DNAJ_ECOLI       --------GAQGDLLCRVVVET--PVGLNERQKQLLQELQESFG-GPTGEHNSPRS----
DNAJ_SHIFL       --------GAQGDLLCRVVVET--QIGLDEKDKQLLHELHESYG-GPTGEHNSPRS----
DNAJ_SALTI       --------GAQGDLLCRVVVET--PVGLSEKQKQLLKDLQESFG-GPTGEKNSPRS----
DNAJ_SALTY       --------GAQGDLLCRVVVET--PVGLSEKQKQLLKDLQESFG-GPTGEKNSPRS----
DNAJ_SALPA       --------GAQGDLLCRVVVET--PVGLSEKQKQLLKDLQESFG-GPTGEKNSPRS----
DNAJ_YERPE       --------GSQGDLLCRVVVET--PVSLSEKQKQLLRELEESFV-GAAGEKNSPRA----
DNAJ_YERPS       --------GSQGDLLCRVVVET--PVSLSEKQKQLLRELEESFV-GAAGEKNSPRA----
DNAJ_PECAS       --------GAQGDLLCRVVVET--PVNLNERQRQLLQELDESFG-GPSGERNSPRS----
DNAJ_PHOLL       --------GVQGDLLCRVVVET--PVKLNERQKELLRELGESFG-GAGEETNSPRS----
DNAJ_BLOFL       I-------GGHGDLLCRVVVET--PVRLSDRQKQLLQDLSDSFG-GPYGHKNSPKS----
DNAJ_WIGBR       --------GHQGDLLCRVVVET--PVRLSEKQKSLLKELGISFV-GRTGMYNSPRS----
DNAJ_BUCAI       R-------NQ-GDLLCRVVVET--PVNLNEQQKNLLHELGNSFH-GFRGEKNSPRS----
DNAJ_BUCAP       R-------SR-GDLLCRVVVET--PVNLNEKQKYLLSELGNSFN-GFRGDKNSPRS----
DNAJ_BUCBP       N-------NRQGDLLCRIIVET--PVNLNDLQKDLLYKLGESFN-GFKGEKNSPKS----
DNAJ_VIBVU       --------GAIGDLIVKLVVET--PVNLSSRQKELLKEFEESCC-GEAATKHKPKS----
DNAJ_VIBVY       --------GAIGDLIVKLVVET--PVNLSSRQKELLKEFEESCC-GEAATKHKPKS----
DNAJ_VIBPA       --------GGIGDLIVKLVVET--PVNLSSRQKELLKEFEESCG-GEAATKHKPKS----
DNAJ_VIBCH       --------AALGDLIVKLVVET--PVNLSARQKELLKEFEESCG-GEAATKHKPKA----
DNAJ_PHOPR       --------GAVGDLICKLVVET--PVNLSSHQKELLKELEESFG-GKAAGKHKPKS----
DNAJ_SHEON       --------HAVGDLLCKVVMET--PVNLNERQKELLREFEATLT-GES-KKHSPKA----
DNAJ_IDILO       --------GEVGDLICKVMIET--PVNLSSKQRDMLEELEDSMGTGDEAAKFRPKE----
DNAJ_MANSM       --------GYAGDLICKIIVET--PVKLNEEQKELLRKFEESLE-G--QSKQRPKS----
DNAJ_PASMU       --------AYAGDLICKIIVET--PVKLNEEQKALLRQLEESLE-G--SSN-KPKS----
DNAJ_HAEIN       --------GYAGDLICRIVVET--PVNLTSEQKELLHKLEESLQ-GKDLSKHAPKS----
DNAJ_HAEDU       --------GYAGDLICKVVVET--PVQLNEEQKELLRQLEISLD-G--KANHRPQQ----
DNAJ_XANAC       --------RSEGDLYCRVVVET--PVNLTADQRELLQQFEATFTGE-DARKHSPKS----
DNAJ_XANCP       --------RSEGDLYCRVVVET--PVNLTTDQRELLKQFEATFTGE-DARKHSPKS----
DNAJ_XYLFA       --------RTEGDLYCRIVVET--PVNLTAEQRKLLEQFEMTFAGE-DARKHSPKS----
DNAJ_XYLFT       --------RTEGDLYCRIVVET--PVNLTAEQRKLLEQFEMTFAGE-DARKHSPKS----
DNAJ_ACIAD       --------SMVGDLLCRVVVET--PVNLTSRQRELFKELQATLDG--DEHSSSPK-----
DNAJ2_AROAE      --------QAHGDLMCHVVVET--PVNLTERQKELLREFEEVSS--SDADRHNPKA----
DNAJ_CHRVO       --------AEYGDLHCHVVVET--PVKLTERQKELLREFEAISQ--GDVATHNPRS----
DNAJ_NITEU       --------QSTGDLLCHVAVET--PVDLTARQKELLEEFESISQ--KDGSRHHPRA----
DNAJ_BORPA       --------SYPGDLYCHVVVET--PVRLSDEQKAILRQFEASLN--DGGDRHSPQS----
DNAJ_BORPE       --------SYPGDLYCHVVVET--PVRLSDEQKAILRQFEASLN--DGGDRHSPQS----
DNAJ_BORBR       --------SYPGDLYCHVVVET--PVRLSDEQKAILRQFEASLN--DGGDRHSPQS----
DNAJ_BURMA       --------SIAGDLYVHVQVET--PVKLTDQQRDLLKQFEKSLA--EGGPRHSPQS----
DNAJ_BURPS       --------SIAGDLYVHVQVET--PVKLTDQQRDLLKQFEKSLA--EGGPRHSPQS----
DNAJ_RALSO       --------GYAGDLYVHVVIET--PVRLTEHQRELLRQFDKSVH--EGGSRHSPQE----
DNAJ_LEGPA       --------YGQGDLLCKVVVET--PVNLSREQKELLNKLQDSLE--NAKGTHSPKT----
DNAJ_LEGPH       --------YGQGDLLCKVVVET--PVNLSREQKELLNKLQDSLE--NAKGTHSPKT----
DNAJ_LEGPL       --------YGQGDLLCKVVVET--PVNLSREQKELLNKLQDSLE--NAKGTHSPKT----
DNAJ_PSEPK       --------GGAGDLLCRVAVET--PVNLSRRQRELLEELRDSLE--GD-SSHSPKA----
DNAJ_PSESM       --------GGAGDLMCRVAVET--PVNLSKRQRELLEEFRTSLE--ND-ESHSPKA----
DNAJ_PSEAE       --------GGAGDLMCKVVVET--PVNLDKRQRELLEEFRKSLQ--SD-TSHSPKA----
DNAJ_METCA       --------GVAGDLLCRVRVET--PVHLNKEQIDLIRQLDESLR--GGGSHHSPQA----
DNAJ_COXBU       --------GAVGDLICHIVVET--PVKLSPEQKDYLKQFAELLK--KDEKNHSPRT----
DNAJ_NEIMA       --------SATGDLYCHIVVET--PVNLTDRQKELLEEFERIST---GLENQTPRK----
DNAJ_NEIMB       --------SATGDLYCHIVVET--PVNLTDRQKELLEEFERIST---GLENQTPRK----
DNAJ_FRATT       --------HRRGDLLCKVVVET--PVNLSAEQKELLEKFADSLG-EDYQSKHAPKS----
DNAJ_AGRFC       S-------AQTGDLYIQIQIET--PQKLSKRQRELLQEFEQLSSKENN-----PES----
DNAJ_RHIME       S-------SQTGDLYIQIQIET--PQKLTKRQRELLQEFEQISSKENN-----PES----
DNAJ_BRUME       Q-------SVTGDLYIQIDIET--PQNLSKRQRELLEEFEKLSSQENS-----PKS----
DNAJ_BRUSU       Q-------SVTGDLYIQIDIET--PQNLSKRQRELLEEFEKLSSQENS-----PKS----
DNAJ_RHILO       Q-------PNVGDLYIQTAVET--PQNLSRRQRELLEEFEQLSSQDNS-----PQS----
DNAJ_BARHE       Q-------QVRGDLYIHITIET--PQKLTQEQRELLQKFEKLSNHENS-----PQS----
DNAJ_BARQU       Q-------QVRGDLYIHITIET--PQKLTQEQRELLQKFEKLSNHENS-----PQS----
DNAJ_BRADU       S-------RQTGDMYVQVVVET--PQNLTKKQQELLAEFEKLSSGNTQ-----PES----
DNAJ_RHOPA       S-------RQVGDMYVQVVVET--PQNLTKKQQELLAEFEKLSSGETQ-----PEA----
DNAJ_CAUVC       S-------RQRGDLVVELFVET--PTHLSARQKELMRELAGLCGEKQN-----PKS----
DNAJ_GLUOX       S-------SARGDMYIQVSVET--PSHLTKRQRELLEEFEKEAGDDHAKGS--PEN----
DNAJ_ZYMMO       G-------RGRGDLIIQIDVET--PTRLTAKQRELLEQFRETETGEEC-----PKS----
DNAJ_RICPR       S-------TIRGDMLTHIHVEV--PKNLSKKQRELLEEFKKESINEKE------ND----
DNAJ_RICTY       S-------TIRGDMLTHIHVEV--PKNLSKRQRELLEEFKKESINEKE------ND----
DNAJ_RICCN       S-------TIRGDMLTHIHVEV--PKNLSKRQRELLEEFKKESINEKE------ND----
DNAJ_RUEPO       G-------GGIGDMFIELAVET--PVNLTSKQKDLLREFDELSEDNNP------ET----
DNAJ_ANAMM       K-------DRRGDMYVHVTVET--PVKLTKQQVDLLKKFEEE-SSANCS----PKY----
DNAJ_EHRRW       --------SRRGDMYIQITVET--PINLTKQQKELLKKFDEEPNTVECN----PQS----
DNAJ_WOLPM       --------HARGDLYVQVIVETLNPKNLTKKQIELLKALEEE-ENASVQ----QQS----
DNAJ_BDEBA       --------NRRGDIYFTVNVQF--PEKLHKDEEKLLREI-------------AKAR----
DNAJ_DESPS       --------RGNGDMVVELHVET--PTGLCEEQKKMLRDFHSFCE---EHGQHEKTK----
DNAJ_DESVH       --------GHTGDLLVEIRVVT--PTRLTKKQEELLREFALLDE---E--KPLEKV----
DNAJ_RHOBA       --------GRTGDLLVQIFIEV--PKKLSDKQQKLLRELAELDH---D--SVLPER----
DNAJ_CHLCV       --------RGRGDLLVRVSVET--PQNLSEEQKELLRKFATTEK---A--ENFPKK----
DNAJ_CHLPN       --------KGRGDLLVRISVET--PQNLSEEQKELLRTFASTEK---A--ENFPKK----
DNAJ_CHLMU       --------KARGDLLVRISVET--PQHLSNEQKELLRKFSETEK---A--ENFPKK----
DNAJ_CHLTR       --------KSRGDLLVRVSVET--PQHLSNEQKDLLRQFAATEK---A--ENFPKK----
DNAJ_PARUW       --------HGKGDLLVRIFVET--PTRLSERQKELLQEFSELEG---P--NNLPKR----
DNAJ_TREDE       --------R-KGDLYIQIQVQI--PSKLSSNSKKLLQEISAIEG---E--NENPN-----
DNAJ_LEPIC       --------YGKGDQHVIVKIEI--PKKITRRQRELIEEFARESG---E--NIPGSK----
DNAJ_LEPIN       --------YGKGDQHVIVKIEI--PKKITRRQRELIEEFARESG---E--NIPGSK----
DNAJ_GEOSL       --------YGRGDQLVIIKVET--PSNLNKRQRELLEEFARISG---E--DVHPMK----
DNAJ_BACAN       --------YGQGDQYVVVRVVV--PTKLTSHQKDLLREFAGQ--------EEQD------
DNAJ_BACHK       --------YGQGDQYVVVRVVV--PTKLTSHQKDLLREFAGQ--------EEQD------
DNAJ_BACCZ       --------YGQGDQYVVVRVVV--PTKLTSHQKDLLREFAGQ--------EEQD------
DNAJ_BACC1       --------YGQGDQYVVVRVVV--PTKLTSQQKDLLREFAGQ--------EEQD------
DNAJ_BACCR       --------YGQGDQYVVVRVVV--PTKLTSQQKDLLREFAGQ--------EEQD------
DNAJ_OCEIH       --------RGHGDQHIKIKVMT--PTNLSEKQKDLLREFNELGGNEST--DEQD------
DNAJ_BACHD       --------RGQGDQHVQVRVIT--PKQLSEKEKELLREFAQMSGGR-P--DEQD------
DNAJ_BACSK       --------RGQGDQHVQVRVVT--PKNLTENEKELMREFAGMSGGR-P--EEQN------
DNAJ_BACLD       --------YGQGDQHIVVRVVT--PTNLTENQKNILREFAEVSGNM-P--DEQE------
DNAJ_BACSU       --------YGQGDQHIVVRVVT--PTNLTDKQKDIIREFAEVSGNL-P--DEQE------
DNAJ_LISIN       --------NGTGDQHVIVKVIV--PKKLDDKQKEILREFASTTGDK-V--DEQT------
DNAJ_LISMF       --------NGTGDQHVIVKVIV--PKKLDDKQKEILREFASTTGDK-V--DEQT------
DNAJ_LISMO       --------NGTGDQHVIVKVIV--PKKLDDKQKEILREFASTTGDK-V--DEQT------
DNAJ_GEOKA       --------YGQGDQHVIVRVVT--PTKLTEKQKQLLREFERLGGDTMH--DGPH------
DNAJ_STAAC       --------YGYGDLYVDIKVVT--PTKLTDRQKELMKEFAQLNGEE-I--NEQP------
DNAJ_STAAM       --------YGYGDLYVDIKVVT--PTKLTDRQKELMKEFAQLNGEE-I--NEQP------
DNAJ_STAAN       --------YGYGDLYVDIKVVT--PTKLTDRQKELMKEFAQLNGEE-I--NEQP------
DNAJ_STAAS       --------YGYGDLYVDIKVVT--PTKLTDRQKELMKEFAQLNGEE-I--NEQP------
DNAJ_STAAW       --------YGYGDLYVDIKVVT--PTKLTDRQKELMKEFAQLNGEE-I--NEQP------
DNAJ_STAAR       --------YGYGDLYVDIKVVT--PTKLTDRQKELMKEFAQLNGEE-I--NDQP------
DNAJ_STAES       --------YGHGDLFVNIKVVT--PTKLNDRQKELLKEFAEINGED-I--NEQS------
DNAJ_STAEQ       --------YGYGDLFVNIKVVT--PTKLNDRQKELLKEFAEINGEN-I--NEQS------
DNAJ_STRA3       --------GGQGDQHVTVNIVT--PTKLNDAQKEALHAFAEASGDKMV--HPKK------
DNAJ_STRA5       --------GGQGDQHVTVNIVT--PTKLNDAQKEALHAFAEASGDKMV--HPKK------
DNAJ_STRP3       --------GGQGDQHVTVNIVT--PTKLNDAQREALQAFAEASGEKML--HPKK------
DNAJ_STRP1       --------GGQGDQHVTVNIVT--PTKLNDAQREALQAFAEASGEKML--HPKK------
DNAJ_STRP6       --------GGQGDQHVTVNIVT--PTKLNDAQREALQAFAEASGDKML--HPKK------
DNAJ_STRP8       --------GGQGDQHVTVNIVT--PTKLNDAQREALQAFAEASGDKML--HPKK------
DNAJ_STRMU       --------NGQGDQHVTVNVVT--PTKLNDAQKEALQDFAKASGINPV--HPKK------
DNAJ_STRT1       --------GSQGDQLVTVKIVT--PTKLNDAQKEALLAFAKASGDEKV--APQK------
DNAJ_STRT2       --------GSQGDQLVTVKIVT--PTKLNDAQKEALLAFAKASGDEKV--APQK------
DNAJ_STRPN       --------GAVGDQYVTVNVVT--PTGLNDRQKVALKEFAAA-GDLKV--NPKK------
DNAJ_STRR6       --------GAVGDQYVTVNVVT--PTGLNDRQKVALKEFAAA-GDLKV--NPKK------
DNAJ_LACLA       --------SGNGDQYVIINIVT--PKNLNQAQKEALQAFAKASGVEVS--GSGK------
DNAJ_ENTFA       --------GGNGDQHVKVKLIT--PKNLNEEQKDALRAFAKAGGQNVT--EQQE------
DNAJ_LACPL       --------NGNGDERVTVNIET--PTHLNKGQKEALKTFAKASGKSVA--GNGK------
DNAJ_LACJO       --------TGNGDQEVTVKVVI--PKKINDKQKEALVDYVKAGGGNIS---PQE------
DNAJ_CLOAB       --------GGRGNQYVKVIVDT--PKALNDKQREALKMFMEASGEAKS---EKK------
DNAJ_CLOTE       --------RGRGDQYVNIIVDI--PKSLNQKQKEALFAYMEASGEIQS---SEK------
DNAJ_CLOPE       --------GGRGNQYVHMVVEV--PKHLNKEQEEALKAFMKASGESVDDIDEKD------
DNAJ_CALS4       --------RGRGDQIVEVYVEV--PKRLSEKQKELLREFKRLEGEN----TAEH------
DNAJ_METAC       --------HGKGDQLVRVIIKT--PTKLNQEQKELLRQFENLSKGKKPQEEEKSKAEKHK
DNAJ_METMA       --------HGKGDQLVRVIIRT--PTKLTQEQKDLLHQFEYLSNGKKPEAEERSRSDKQK
DNAJ_BACFR       --------YGTGDLLVNVSVYV--PETLSKEEKSTLEKLEESKN-----FKPST------
DNAJ_BACTN       --------YGTGDLLVNISIYV--PEALNKEEKSTLEKMEASDN-----FKPST------
DNAJ_PORGI       --------YGMGDQLVNVNVYI--PESIDAKDEQAIAAMENSDS-----FKPTD------
DNAJ_CHLTE       --------GGSGDLYVRVNVFV--PKEVSGKDRDLLKELKKSTV-----ICPNHGD----
DNAJ_THEAC       --------HGSGDLLVRVNVEV--PKRLTQKQKDLIREIFDIK----------ENH----
DNAJ_THEVO       --------HGSGDLLVRINVEV--PKRLTAKQRELIRELFDIK----------ENH----
DNAJ_PICTO       --------HGSGDLNVIIKIEV--PKHLTSRQKELLEEFRN------------EKK----
DNAJ_FUSNN       --------YGQGDIIVKITIET--PKKLTDKQKELLQKFEESLN-----EKNYEQK----
DNAJ_MESFL       SD-------KRGDLLIKISISI--PTSVSKEEKKILKELEQLSNFEPK------------
DNAJ_MYCMS       KD-------KRGDLIIKVNIVV--PKNLNKKEKELIEQIYEQTSFNPE------------
DNAJ_MYCGE       FK------RKAGDLIIIISYAR--PCEYTNLELKKLREFIK-PNQEVK------------
DNAJ_MYCPN       FR------KKAGDLIIIISYAR--PSEYSAPELRKLKEFIK-PNQEVK------------
DNAJ_MYCGA       SRVYGANYNQKGDLIVVINYAR--PSEYSKQEITKLKEFIK-PNKEVN------------
DNAJ_MYCPE       FG-------SNGDLFAVVEYTS--AKRFSSAELKSLSKFAQETNDEIE------------
DNAJ_UREPA       NIFG----KKNGDFYTTIRYAK--PVELSKDEIAYLKNISTRTNQNVE------------
DNAJ_MYCH2       PRII-------GDLKVHLIFYI--PEFSPRQKDDLNQVFAQINDKTKA------------
DNAJ_MYCMO       S----------GKMIVIFEIFI--PKLTSFEKKEISTILEKNADKFYE------------
DNAJ_MYCPU       V----------GDLKIRLKFEI--PNFSSKVKKNLESLLSETNDSINE------------
DNAJ_NOSS1       P-------VSRGDHLLTVLIDI--PTKVIPEERELLEKLAKIKGDR--TGKGGL------
DNAJ_SYNP6       P-------VARGNLLVTIKVEI--PTKISAEERELLEKVVQIRGDR--AGKGGI------
DNAJ1_SYNY3      A-------TIRGDHLITVKVQI--PTRINSEERELLERLATIKGES--HGKGGL------
DNAJ_THEEB       P-------VARGDHLITVDVEI--PTHITHEERELLEKLAKIRGER--LGKGGL------
DNAJ_PROMM       P-------VARGNQRISINVKL--PIRLSDEERGLLEELAGHHSAKGRQHHHHN------
DNAJ_SYNPX       P-------VARGDQRVQVMVQL--PTRLSDPERTLLEELAGHHSARGKQHHHHN------
DNAJ_PROMA       P-------VARGNHCISVNIKI--PSRLTDDEKILLEKLAIYYSAKGPQNHHHN------
DNAJ_PROMP       P-------VARGNHQVLVKVKL--PTRITEDERNLLEDLASKYTE---QNSSSN------
DNAJ_GLOVI       P-------TRRGNHYLQLKVVI--PTKLGAEERELLTKLAKARGEK-VSKKEGL------
DNAJ1_COREF      --------EGRGDLMAHVDLFV--PTEIDDRTRELLEQIRDYR-RDNSSVHREGEEH---
DNAJ1_CORGL      --------EGHGNLMAHVDLFV--PTDLDDRTRELLEEIRNHR-SDNASVHREGGEE---
DNAJ1_CORDI      --------EGFGNMIAHVDVSI--PTQLDEKSKELLNKLRDHR-SDESSVRTADDSD---
DNAJ2_MYCBO      --------NTRGDLHVHVEVVV--PTRLDHQDIELLRELKGRRDREVAEVRSTHAAA---
DNAJ2_MYCTU      --------NTRGDLHVHVEVVV--PTRLDHQDIELLRELKGRRDREVAEVRSTHAAA---
DNAJ1_MYCPA      --------GTRGDLHVHVEVVV--PSRLDARDTELLREFKGRRGRDVPEVRSTHAG----
DNAJ2_MYCLE      --------NTRGNLHVHVEVMV--PTRLDQHDTELLRELKRRRSRDVAEVRSTHAAG---
DNAJ1_NOCFA      --------GVRGDLLAHLDIVI--PTKLDGKQTELLRKYKALRDRDRAEVMSAQSEHN--
DNAJ2_STRAW      --------GGRGDLIVHVEVTT--PTKMDPEQERLLRELAKLR-GEERPTGQFQ-PGQ--
DNAJ2_STRCO      --------GGRGDLIVHVEVTT--PGKLDPEQERLLRELAKLR-GEERPTGQFQ-PGQ--
DNAJ1_CUTAK      --------NGRGDLGVTFIVQT--PTKLDSHQKDLLRQLAEAR-EETNASASVEKSGG--
DNAJ_LEIXX       --------SGRGDLRVGIQVVT--PTKLDHREKELIKKFAESH-KASEPSLARF---Q--
DNAJ_BIFLO       K-------DERGNLIAHVNVLI--PTKLNETERGLIEQFAASHDSGATHVSQASRPQAGQ
DNAJ_TROW8       ---------GKGDLCIVLNVLL--MQKLDPEHRALLKKIMPNPPKPKLAKRTSG------
DNAJ_TROWT       ---------GKGDLCIVLNVLL--MQKLDPEHRALLKKIMPNPPKPKLAKRTSG------
DNAJ_THET2       --------RGRGTLRVVVELAV--PKKLSPKAQKLLRAYAEEVGE-----EVAPE-----
DNAJ1_THET8      --------RGRGTLRVVVELAV--PKKLSPKAQKLLRAYAEEVGE-----EVAPE-----
DNAJ_DEIRA       --------AGTGDLIVDYEIVV--PKHLNAEAKDALQAYARAVGD-----EVPEEH----
DNAJ_SYMTH       --------SGRGDLHVVISVKT--PGRLSERERELLLEVAALRGERVAGMTENKE-----
DNAJ_METTH       --------NGYGNLYVKVKVVT--PRKLSPRQKELLREFASISGD-----EIHED-----
DNAJ_HALMA       --------RGHGDLYVQVQVVT--PDSLNAEQKEALEQFAEAGGE-----EVDVD-----
DNAJ_HALSA       --------RGNGDLYVTVQVVT--PESLSDEQRDALEQFAEAGGE-----EIDVE-----
DNAJ1_AROAE      --------QRAGALIVRLVPVL--PEAPDAEILALLEIAESRLQNTLSRHLPDVASWE--
                            *                                                

DNAJ2_COREF      ------KKSGFDPRANWAGNNR--------------
DNAJ2_CORGL      ------TNSGFDPRANWAGQNR--------------
DNAJ2_CORDI      ------RDAGFDPRAGWAGK----------------
DNAJ1_MYCBO      ------RSSGFNPRAGWAGNR---------------
DNAJ1_MYCTU      ------RSSGFNPRAGWAGNR---------------
DNAJ2_MYCPA      ------RASGFDPRAGWAGNR---------------
DNAJ1_MYCLE      ------RSSGFNPRAGWGR-----------------
DNAJ2_NOCFA      ------KASGFDPRAGWAGA----------------
DNAJ1_STRAW      ------AGE--DPRAELFQAAKGA------------
DNAJ1_STRCO      ------ADE--DPRAELFQAAKGA------------
DNAJ2_CUTAK      ------PQA--TPRPWEVK-----------------
DNAJ1_AQUAE      ---------LVEKLSSLFKKNA--------------
DNAJ2_AQUAE      ---------IVER-----------------------
DNAJ_THEMA       ------------------------------------
DNAJ_BORBU       ----------IDLLKA--------------------
DNAJ_BORBP       ----------IDLLKV--------------------
DNAJ_CAMJE       -------KGLFEKITNWFKS----------------
DNAJ_CAMJR       -------KGLFEKIANWFKS----------------
DNAJ_HELHP       -------EECFTKVKQWLHKHSKNDKDTTK------
DNAJ_WOLSU       -------EGVFEKIKGWFS-----------------
DNAJ_HELPJ       -------ETCVSKIKDWFK-----------------
DNAJ_HELPY       -------ETCISKIKDWFK-----------------
DNAJ_ECO57       -------KSFFDGVKKFFDDLTR-------------
DNAJ_ECOL6       -------KSFFDGVKKFFDDLTR-------------
DNAJ_ECOLI       -------KSFFDGVKKFFDDLTR-------------
DNAJ_SHIFL       -------KSFFDGVKKFFDDLTR-------------
DNAJ_SALTI       -------KSFFDGVKKFFDDLTR-------------
DNAJ_SALTY       -------KSFFDGVKKFFDDLTR-------------
DNAJ_SALPA       -------KSFFDGVKKFFDDLTR-------------
DNAJ_YERPE       -------KSFLDGVKKFFDDLTR-------------
DNAJ_YERPS       -------KSFLDGVKKFFDDLTR-------------
DNAJ_PECAS       -------KNFFDGVKKFFDDLTR-------------
DNAJ_PHOLL       -------KSFFDGVKKFFDDLTK-------------
DNAJ_BLOFL       -------KTFFDGVKKFFDDLTR-------------
DNAJ_WIGBR       -------KSFFDGVKKFFDGLTN-------------
DNAJ_BUCAI       -------KRFFDGVKRFFDDLTR-------------
DNAJ_BUCAP       -------KRFFDGVKRFFDDLTK-------------
DNAJ_BUCBP       -------KRFFEGVKRFFDDLTR-------------
DNAJ_VIBVU       -------EGFFNGVKKFFDDLTS-------------
DNAJ_VIBVY       -------EGFFNGVKKFFDDLTS-------------
DNAJ_VIBPA       -------EGFFNGVKKFFDDLTS-------------
DNAJ_VIBCH       -------EGFFNGVKKFFDDLTS-------------
DNAJ_PHOPR       -------EGFFNGVKKFFDDLTG-------------
DNAJ_SHEON       -------EGFFDGVKKFFQDLNS-------------
DNAJ_IDILO       -------KGFFDGVKQFFDDLRS-------------
DNAJ_MANSM       -------SSFLDGVKKFFDNLGK-------------
DNAJ_PASMU       -------SSFFDGVKKFFDNLGK-------------
DNAJ_HAEIN       -------SGFLDGVKKFFDNLGKSDK----------
DNAJ_HAEDU       -------AGFLDSVKNFFTHLGK-------------
DNAJ_XANAC       -------ATFIDGVKGFWDRMTS-------------
DNAJ_XANCP       -------ATFIDGVKGFWDRMTS-------------
DNAJ_XYLFA       -------ATFLDGVKSFWDRMTS-------------
DNAJ_XYLFT       -------ATFLDGVKSFWDRMTS-------------
DNAJ_ACIAD       -------------KKSFFDRLFD-------------
DNAJ2_AROAE      -------KSWMDKVKDFFGA----------------
DNAJ_CHRVO       -------KSFMDKLRDFFE-----------------
DNAJ_NITEU       -------KSWMEKAREFFAE----------------
DNAJ_BORPA       -------KSWTDRVKEFFS-----------------
DNAJ_BORPE       -------KSWTDRVKEFFS-----------------
DNAJ_BORBR       -------KSWTDRVKEFFS-----------------
DNAJ_BURMA       -------KSWFDRVKSFFE-----------------
DNAJ_BURPS       -------KSWFDRVKSFFE-----------------
DNAJ_RALSO       -------QSWLDKVKNFFSS----------------
DNAJ_LEGPA       -------SSWFAGVKKFFEDMKF-------------
DNAJ_LEGPH       -------SSWFAGVKKFFEDMKF-------------
DNAJ_LEGPL       -------SSWFAGVKKFFEDMKF-------------
DNAJ_PSEPK       -------SGWFDGVKRFFGDL---------------
DNAJ_PSESM       -------SGWFEGVKRFFGDL---------------
DNAJ_PSEAE       -------SGWFEGMKRFFDDL---------------
DNAJ_METCA       -------HGWLDGVKQFFDRLGL-------------
DNAJ_COXBU       -------RNWFDSVKDFFTSK---------------
DNAJ_NEIMA       -------KSFLDKLRDLFD-----------------
DNAJ_NEIMB       -------KSFLDKLRDLFD-----------------
DNAJ_FRATT       -------KTWFDNVKDYAKKFFE-------------
DNAJ_AGRFC       -------TGFFARMKEFFDG----------------
DNAJ_RHIME       -------TGFFSRMKDFFDTLSE-------------
DNAJ_BRUME       -------AGFFSRMKEFFEGIGE-------------
DNAJ_BRUSU       -------AGFFSRMKEFFEGIGE-------------
DNAJ_RHILO       -------SGFFARMKDFFESFGER------------
DNAJ_BARHE       -------HGFFSRMKEFFENISGKNE----------
DNAJ_BARQU       -------HGFFSRMKEFFENISGQN-----------
DNAJ_BRADU       -------EGFFTKVKDFFGSRAN-------------
DNAJ_RHOPA       -------VGFFSKVKEFFGSRASAP-----------
DNAJ_CAUVC       -------ANFVGKAKRFWEEVTGS------------
DNAJ_GLUOX       -------SGFFAKVRDFFEGR---------------
DNAJ_ZYMMO       -------SGFFSKLKTILTGE---------------
DNAJ_RICPR       -------SSFFNKMKSMWS-----------------
DNAJ_RICTY       -------SSFFNKMKSMWS-----------------
DNAJ_RICCN       -------GSFFNKMKSLWS-----------------
DNAJ_RUEPO       -------KSFFSSVKSFWDGMKG-------------
DNAJ_ANAMM       -------QGFFQKIKDIWRDISSG------------
DNAJ_EHRRW       -------TGFFQKVKSFWNDIRSS------------
DNAJ_WOLPM       -------EGFFSKVKKK-------------------
DNAJ_BDEBA       -------GLNVTSEGGFFGKKK--------------
DNAJ_DESPS       -------GFFAKLFDEVLGKNK--------------
DNAJ_DESVH       -------KKMARKIGKAMGMD---------------
DNAJ_RHOBA       -------TSFLDKLRHFFDPEPEEAGTGSTDTEKDS
DNAJ_CHLCV       -------RGFLDKIKGFFSDFAV-------------
DNAJ_CHLPN       -------RSFLDKIKGFFSDFTV-------------
DNAJ_CHLMU       -------RSFLDKIKGFFSDFAV-------------
DNAJ_CHLTR       -------RSFLDKIKGFFSDFAV-------------
DNAJ_PARUW       -------KGFLDKIKEFFSPN---------------
DNAJ_TREDE       ----------LIPLKDLP------------------
DNAJ_LEPIC       -------GKIFTK-----------------------
DNAJ_LEPIN       -------GKIFTK-----------------------
DNAJ_GEOSL       -------KSFFDKVMDFIS-----------------
DNAJ_BACAN       -------DSLFGKLKRAFKGE---------------
DNAJ_BACHK       -------DSLFGKLKRAFKGE---------------
DNAJ_BACCZ       -------DSLFGKLKRAFKGE---------------
DNAJ_BACC1       -------DSLFGKLKRAFKGE---------------
DNAJ_BACCR       -------DSLFGKLKRAFKGE---------------
DNAJ_OCEIH       -------DNIFQRFRRAFKGE---------------
DNAJ_BACHD       -------DSFFAKVKRAFKG----------------
DNAJ_BACSK       -------DGFFDKLRRAFKGD---------------
DNAJ_BACLD       -------MSFFDKVKRAFKGD---------------
DNAJ_BACSU       -------MSFFDKVKRAFKGD---------------
DNAJ_LISIN       -------SGFFDKMKRAFKGD---------------
DNAJ_LISMF       -------SGFFDKMKRAFKGD---------------
DNAJ_LISMO       -------SGFFDKMKRAFKGD---------------
DNAJ_GEOKA       -------GRFFEKVKKAFKGEA--------------
DNAJ_STAAC       -------SNFKDRAKRFFKGE---------------
DNAJ_STAAM       -------SNFKDRAKRFFKGE---------------
DNAJ_STAAN       -------SNFKDRAKRFFKGE---------------
DNAJ_STAAS       -------SNFKDRAKRFFKGE---------------
DNAJ_STAAW       -------SNFKDRAKRFFKGE---------------
DNAJ_STAAR       -------SNFKDRAKRFFKGE---------------
DNAJ_STAES       -------SNFKDRAKRFFKGE---------------
DNAJ_STAEQ       -------SNFKDRAKRFFKGE---------------
DNAJ_STRA3       -------KGFFDKVKDALDVD---------------
DNAJ_STRA5       -------KGFFDKVKDALDVD---------------
DNAJ_STRP3       -------KGFFDKVKDALEDI---------------
DNAJ_STRP1       -------KGFFDKVKDALEDI---------------
DNAJ_STRP6       -------KGFFDKVKDALEDI---------------
DNAJ_STRP8       -------KGFFDKVKDALEDI---------------
DNAJ_STRMU       -------KGFFNKVKDAFDEM---------------
DNAJ_STRT1       -------KGFFNKVKDVLEDL---------------
DNAJ_STRT2       -------KGFFNKVKDVLEDL---------------
DNAJ_STRPN       -------KGFFDHIKDAFDGE---------------
DNAJ_STRR6       -------KGFFDHIKDAFDGE---------------
DNAJ_LACLA       -------KGFFDKFK---------------------
DNAJ_ENTFA       -------EGFFDKMKDAFGGKKKK------------
DNAJ_LACPL       -------SSLFDKLRGV-------------------
DNAJ_LACJO       -------KNFFERLKDKLNGE---------------
DNAJ_CLOAB       -------SGF----KRFFE-----------------
DNAJ_CLOTE       -------EGFFDKIKKNFK-----------------
DNAJ_CLOPE       -------EGFFSKFKKKK------------------
DNAJ_CALS4       -------KSFFQRMRDAFGGS---------------
DNAJ_METAC       -------KGIFEKVKDAFES----------------
DNAJ_METMA       SEKPRKSKGLFEKVKDAFES----------------
DNAJ_BACFR       --------SIKEKIFKKFRSLFD-------------
DNAJ_BACTN       --------SVKEKIFKKFKSFFD-------------
DNAJ_PORGI       --------AARKDIDKKYREMLD-------------
DNAJ_CHLTE       -------ENHEKSIFEKAKDIFS-------------
DNAJ_THEAC       -------RSWFH------------------------
DNAJ_THEVO       -------KSWFH------------------------
DNAJ_PICTO       -------KSWFHF-----------------------
DNAJ_FUSNN       -------SSFMKKVKKFFKDIID-------------
DNAJ_MESFL       --------NIID------------------------
DNAJ_MYCMS       --------NNIDQ-----------------------
DNAJ_MYCGE       --------QYLNTLKNEYKT----------------
DNAJ_MYCPN       --------QYLNALKNEYKS----------------
DNAJ_MYCGA       --------LYETLMKKELNNKDSQ------------
DNAJ_MYCPE       --------KYLKEARKEIN-----------------
DNAJ_UREPA       --------YYKNKVLKEISK----------------
DNAJ_MYCH2       --------K---------------------------
DNAJ_MYCMO       --------KWIKEFE---------------------
DNAJ_MYCPU       --------DFVKKVNSIK------------------
DNAJ_NOSS1       -------EGFLGNLFK--------------------
DNAJ_SYNP6       -------EGFFKGVFGG-------------------
DNAJ1_SYNY3      -------EGFLGGLFHK-------------------
DNAJ_THEEB       -------EGFLGSLFGG-------------------
DNAJ_PROMM       -------SGLFARLFGQKG-----------------
DNAJ_SYNPX       -------SGLFARLFGQK------------------
DNAJ_PROMA       -------SGLFSRLFKSNAS----------------
DNAJ_PROMP       -------SGLFSRLFGKDS-----------------
DNAJ_GLOVI       -------EGLIDSIGNLFH-----------------
DNAJ1_COREF      -------GGLFDKLKSKFRNR---------------
DNAJ1_CORGL      -------SGFFDKLRNKFRK----------------
DNAJ1_CORDI      -------DSLFGRLRNRFRR----------------
DNAJ2_MYCBO      -------GGLFSRLRETFTGR---------------
DNAJ2_MYCTU      -------GGLFSRLRETFTGR---------------
DNAJ1_MYCPA      -------GGLFSRLRETFTGR---------------
DNAJ2_MYCLE      -------GGLFSRLRETFTNR---------------
DNAJ1_NOCFA      -------SGLFARLRASFSGR---------------
DNAJ2_STRAW      -------QGLFSRLKDAFNGR---------------
DNAJ2_STRCO      -------QGLFSRLKDAFNGR---------------
DNAJ1_CUTAK      -------RGMFSRIKEAFGG----------------
DNAJ_LEIXX       -------QGLFAKLRDRFLNV---------------
DNAJ_BIFLO       K------KGFFSKLKDALS-----------------
DNAJ_TROW8       ---------FFSWLKNKFT-----------------
DNAJ_TROWT       ---------FFSWLKNKFT-----------------
DNAJ_THET2       --------GFWERLKGFFRK----------------
DNAJ1_THET8      --------GFWERLKGFFRK----------------
DNAJ_DEIRA       -------EGLFGKIGKLFGRD---------------
DNAJ_SYMTH       -------KSFLKKMKDALGGR---------------
DNAJ_METTH       -------KGFFDKVKDAIIH----------------
DNAJ_HALMA       -------EGFFEKLKNSL------------------
DNAJ_HALSA       -------QGFFEKLKNSF------------------
DNAJ1_AROAE      -------ERWLPDIPETR------------------