CLUSTAL format seed alignment for MF_01153

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

DJLA_VIBVY        --------------------------MQIFGKILGAFFGFLFG-GVFGALFGLFIGHQFD
DJLA_VIBCH        --------------------------MHIFGKILGAFFGFLFG-GPFGAIFGIFLGHQFD
DJLA_ALIF1        --------------------------MQIFGKILGGFFGFLFG-GFFGAALGIFIGHQFD
DJLA_PHOPR        ----------------------------MWGKILGAFFGFLLG-GPFGLLLGLFLGHKFD
DJLA_YERPE        --------------------------MRYWGKLLGLVLGVMYAPGVVGALLGLLVGHMVD
DJLA_PHOLL        --------------------------MHYWGKLLGLIFGVVSGAGFWGIVIGLFIGHMLD
DJLA_SALTY        --------------------------MQYWGKIIGVAVALMMGGGFWGVVLGLLVGHMFD
DJLA_ECOLI        --------------------------MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFD
A4W6G1_ENT38      --------------------------MQYWGKIIGVAFALLMGAGFWGVLLGLIIGHMFD
DJLA_PECAS        --------------------------MRYWGKLLGLALGIVSSTGIWGMIMGLLMGHWID
M1SCH6_MORMO      --------------------------MHYLGKIIGILLGMASGAGFWGIFLGFLIGHAID
DJLA_MANSM        --------------------------MNFIGKILGFIIGYRFG-GLFGGIAGLILGHIAD
DJLA_HAEIN        --------------------------MEFIGKIIGVFLGWKVG-GFFGAIAGLILGSIAD
DJLA_PASMU        --------------------------MNFIGKFLGLIIGWKLG-GFFGAICGVILGHLGD
Q15QB7_PSEA6      ----------------------------MIGKILGTIFGFMFG-RIPGAILGFIVGHMFD
Q5QVM9_IDILO      ---------------------------MVWGKVVGALAGFAFM-KWPGAILGALIGHWFD
DJLA_SHEON        --------------------------MRFWGKFFGFVIGFMFG-RFFGALLGLWLGHLYD
H2FZ15_OCESG      ------------------------MPAHIKGKIIGFLFGLLIG-NLPGALLGLWLGHLVD
C5BI20_TERTT      ----------------------------MLGKIIAGLIG-FLTLGPFGAILGVLIGHFFD
Q21JG2_SACD2      MRVTVCKLFRSNCWGPSKTVKVEYVSYMYIGTVIGALIG-FFTLGPPGALFGGVAGHFFD
B3PLJ2_CELJU      ----------------------------MIGKILGFLFGTLLSRNLLGGLLGALFGHFFW
E1V4D1_HALED      ---------------------------MLAMVLIGGVLG-FLIGGPLGLLIGGGLGYWLV
Q1R1E4_CHRSD      ---------------------------MLIAILIGAGLG-FMFGKLPGLIIGAVLGFWVA
A1U2G7_MARHV      ---------------------------MLFAIIFGGLIG-YAFGRFPGFLVGAAIGAFLF
C7R7T5_KANKD      --------------------------MSWFGKLLGGVIGFSFG-GPIGAILGGVVGHQID
Q60CQ6_METCA      --------------------------MSWLGKLLGGTFGFLLG-GPLGALLGAAIVHK-L
Q3J6W5_NITOC      --------------------------MNWWGKTLGGTFGFLLG-GPLGGLLGTALGHQ-I
D3HPS4_LEGLN      -----------------MTFRDFFIITTWWGKIIGACFGYLIA-GPTGTLFGLLIGNF-F
DJLA_LEGPH        -----------------MNLRDFFVITTWWGKILGAFFGYLTA-GPVGALFGILVGNF-F
DJLA_COXBU        --------------------------MNWIGKLIGMMLGFILA-GPIGLIIGLFIGHVVF
                                                   ..   .        *   *        

DJLA_VIBVY        KARRLSQAGFKTAGFGQGPSQAQ-RQEEFFKSAFAVMGHVAKAKGQVTKEEIQLASAMMD
DJLA_VIBCH        KARRLNQAGFQSGTFGAGPSQAE-RQEEFFKSAFSVMGHVAKAKGQVTKEEIQLATIMMD
DJLA_ALIF1        KAKRMANSGFTFQTGGA--SQTQ-RQAEFFHAAYAVMGHVAKAKGQVTREEIQLASMMMD
DJLA_PHOPR        KARRNVYRGGGFGGFGTNRANSEERQAEFFYAGFAVMGHMAKAKGHVTEEEIRVASAIMD
DJLA_YERPE        R---ALGAK-----RRGFFADQQTRQSLFFRTTFQVMGHLTKAKGRVTEVDIQLASQLMD
DJLA_PHOLL        R---ASVRG-----NQGFFANNQSRQLLFFSSTFQVMGHITKSKGRVTETDIRLASQLME
DJLA_SALTY        K---ARSR------KMAWFANQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMD
DJLA_ECOLI        K---ARSR------KMAWFANQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMD
A4W6G1_ENT38      K---ARSR------KIAMFANQRERQALFFATTFEVMGHLTKSKGRVTEADIQIASVFMD
DJLA_PECAS        R---ARASR-----RRDYFSAQSTRQSLFFLTTFQAMGHLTKSKGRVTEADINIATKMMD
M1SCH6_MORMO      K---VRSQQ-----LGGSFSNNQSRQALFFSTTFQILGHLTKSKGRVTESDIYLATALMD
DJLA_MANSM        KKLYELGSV-----NSSFFSKKITRQSLFMQTTFAVLGHLSKAKGRVTEEDIQLANNLMS
DJLA_HAEIN        KKLYELGSV-----SSSFFKKKTTRQDLFMQTSFAVLGHLSKSKGRVTEEDIQLANQLMI
DJLA_PASMU        KKLYELGTV-----NSSFFKSKITRQSLFMQTTFAVLGHLSKAKGRVTEDDIQLASHLMQ
Q15QB7_PSEA6      KGYSQDFNQMGGFSGFFTSQDDFKKQAIFFHALFSVMGHIAKADGKVSDVEIKMASALMD
Q5QVM9_IDILO      RGMAQDFSQKGAWGRFLYGAEQAAGDANFIYTLFAVMGHVAKAKGKVTTNDISQAQELMR
DJLA_SHEON        KRPGGG----ASFSQILGQAK--NRQGIFFNTTFAVMGHVAKASGRVTETDIRIATLLMD
H2FZ15_OCESG      KK------------LAGAWGFVKDARQEFLYATFATMGHLAKSSGRVTSEEIRLAEQLMV
C5BI20_TERTT      HGRQQFA-------RRFDPEQRAKVETAFFNAVFPLLGHLAKADGRVSEEEVSGTEQLMA
Q21JG2_SACD2      KGRMKVA-------ASFTPEARKAVEQAFFNTVFPLMGVIAKADGRVCEDEIGNTEQLIA
B3PLJ2_CELJU      DKKRNAK-------PPLSDEQRQKIQRNFFETTFTLMGHLAKADGRVSETEIALTESLMT
E1V4D1_HALED      RRL-----------RRSMLGRLAGVQAQFLESTFAVMGCMCKADGRVTEAELDASRQLWD
Q1R1E4_CHRSD      RRLV----------RRVVVSKLSKMQDQFLDSTFAVMGCICKADGDVSGDELRVVETLFQ
A1U2G7_MARHV      QRM-----------KSRLLGKLQGLQAGFIESVFAVMGALCKADGVVSRDEIQMAEAMFV
C7R7T5_KANKD      KKG-----------EDLEPGSQERVQAAFFTATFSVMGHIAKADGRVTDVEIRHAEEVMR
Q60CQ6_METCA      DGG-KDKYAQIE--SDPSPDAQHRIQMAFFTATFSVMGHVARADGRVSEAEITVARTVMN
Q3J6W5_NITOC      DNG-LKKIASL----GLSSEERKQVQSVFFTTTFSVMGHLAKADGWVSPNEIRMAEIIMT
D3HPS4_LEGLN      DRGLSQYYSNPH--WYYYSEKRKNVQKTFFEATFSIMGHLAKADGRVTEAELDIARQFMD
DJLA_LEGPH        DRGLVSYYSNPH--WLYHAEKQRIVQKAFFEATFSIMGHVAKSDGRVSEQEISMAKSIMN
DJLA_COXBU        DQGRFRQWFQTT--ASARSQPSK-IQEVFFNTTFRVMGFVAKADGRVSENEIRQARQVMQ
                                              *: : :  :* : ::.* *   ::     .  

DJLA_VIBVY        RMSLHGEQRRAAQDAFREGKERDFPLEQLLERVKIATSGRFDLLQFFLELQISAAFADGD
DJLA_VIBCH        RMNLTLEQKRAAQDAFRDGKESDFPLEQVLERVKIATGGRFDLLQFFLELQVSSAFADGD
DJLA_ALIF1        RMNLSDEQKREAQEAFREGKESDFPLRETLRNIRSITGGRYDLLQFFLELQIAAAIADGD
DJLA_PHOPR        RMNLHGEARRQAQNAFREGKEDGFPLEETLAKVRQNCAGRADLLQFFLELQIQAAFADGS
DJLA_YERPE        RMQLHGAARTAAQQAFREGKESHFPLRKALQEFRRVCFGRFDLIRIFLEIQLQAAFADGS
DJLA_PHOLL        RMQLHGQARIAAQQAFREGKEPNFPLRETLRQLRRACFGRSDLIRMFLEIQLQAAFSDGQ
DJLA_SALTY        RMNLHGDSRTAAQNAFRVGKADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGS
DJLA_ECOLI        RMNLHGASRTAAQNAFRVGKSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGS
A4W6G1_ENT38      RMSLHGESRVAAQNAFRIGKADNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGS
DJLA_PECAS        RLELFGDARAAAQRAFREGKAGQFPLRIKLRKLRDACLGRFDLIKMFLEIQLQVAFVDGV
M1SCH6_MORMO      RMQLHGSARTQAQNAFREGKAAGFPLRDALRQLRRACYGRADLLRMFLEIQIQAAFGDGE
DJLA_MANSM        QMQLDVANRQLAQNAFNRGKEADFPVREVIREFRIGCGQRADLLRMFLHIQVQAAFADSN
DJLA_HAEIN        QLKLDDAGRKLAQDAFRRGKESDFPIRQVIREFRIGCGQRADLLRMFLQVQVQAAFADSE
DJLA_PASMU        QMQLDDANRRLAQEAFTRGKAADFPLRQVIREFRLGCGQRADLLRMFLHVQVQAAFADAQ
Q15QB7_PSEA6      QMGLEGDTRKEAQQAFREGKEADFALKDIIVELKESCHGRRDILQVFLEILIQAAYVDGK
Q5QVM9_IDILO      RLNLNTDATREAQEAFREGKEPTFPLQQVMKDFSASFYGNRDVLQLFMEQLIGLALNDGI
DJLA_SHEON        QMRLTGDARKEAQQAFREGKEPDFDLCSSLQAFRAVTQGRQELVQMFIEIQIQTALSDGE
H2FZ15_OCESG      QMRLRPEQKAEAQQAFRDGKESDFPLTDTLRRFRTQVRDSRNLLRFFMEVQLQLVFADGE
C5BI20_TERTT      KMGLGVEARKKAIALFQQGAQSDFNPHALLDDFNLVCGKYPDLKQMILVYLISLAYADNH
Q21JG2_SACD2      AMRLDSDARSQAIRLFQSGSKGEQSVDAILDAFLVDCGQYRDLKQLLLVYLITLAYADGT
B3PLJ2_CELJU      KMGLTAEHRRDAIQLFKQGTSADFVIAQTLAQFQQVCGASPNLSQMLLVYLVNLAMADGQ
E1V4D1_HALED      RLRLSEEQRAKARADFTRGKSEDFDLEAELAKIRQIVGSQPALRQVFLQVQLAAIAADGQ
Q1R1E4_CHRSD      RLRLSEAQRERANAAFERGKADDFDLDAELATVRRVTGGQRALLQMFLQVQLSAIAADGQ
A1U2G7_MARHV      RFRLNESQKAMAKEAFNRGKASDFDLDAELQRFMQASGRQPVLLQMFLQVQVSAVAADGQ
C7R7T5_KANKD      RMGLDQTARKLAVDLFNQGKNQDFDLDGVLEQFKRECHRRRNLMQMFMEVQISMAMADGI
Q60CQ6_METCA      RMSLSEGMRRTAIELFSRGKQPDFPLREAVEQFRKECHRRYALLRIFLEIQLEAAFADGP
Q3J6W5_NITOC      RMKLSPERRRVAIGLFNQGKQPDFPLNEVLDQFYRNCRYQRVLVRVFLQIQLQAAMADGP
D3HPS4_LEGLN      EMRLSREQKNLAKHLFNEGKQPGFNLNEILEKLKKSCKDNRDLLRLFLDIQYRAALTDG-
DJLA_LEGPH        EMKLSKGQKDLAKRLFNEGKQADFNVSLALIQLQRICKDNRDLLKLFVDIQYRAAQVDG-
DJLA_COXBU        QMNLDDSMKREAIRLFTEGKQPNFNLDESLNELRQACVFQPALLRVFLEIQIQMASADGQ
                   : *       *   *  *          :  .         : :.::         *  

DJLA_VIBVY        -VHPSERNVLHKIARGLGFSS--------EQLERRLQMQEAAF-------RFQRQGGFGG
DJLA_VIBCH        -VHPSERQVLHRIARGLGFSS--------EQLERRLRMQEAAF-------RFQQGGGFGG
DJLA_ALIF1        -IHPSERDVLHIVAEELGFSA--------EQLEKRLRMQEAAF-------RFQQGGGFSG
DJLA_PHOPR        -LHQNERQLLHVIARSLGFSE--------RQLEQRLHMQEAAF-------RFQQ-GGFNQ
DJLA_YERPE        -LHPNERQVLYVIAEELGISR--------GQFDQFLRMFDGGR-------QFGGHGGWQG
DJLA_PHOLL        -LHPNERTVLFIIADELGISR--------NQFEQFLAMMEGGR-------NFGDGGEWQQ
DJLA_SALTY        -LHPNEREVLYVIAEELGISR--------VQFDQFLRMMQGGA-------QFG--GGYHQ
DJLA_ECOLI        -LHPNERAVLYVIAEELGISR--------AQFDQFLRMMQGGA-------QFG--GGYQQ
A4W6G1_ENT38      -LHPNERDVLYVIAEELGISR--------MQFDQFLRMMQGGA-------QFG--GGYQQ
DJLA_PECAS        -LHPNERRVLYVIADELGVTR--------EQFEFFLRNMESPTGQQSRQNQSRQNGKSQQ
M1SCH6_MORMO      -LHPNERQVLLVIAEELGIPR--------HQFENVLAMMQAQM------HGGAQSGNWQQ
DJLA_MANSM        -LHNNEKELLFVIAEELGLSR--------FQFDQMLAMEMAAR-------QFTQGGFYRQ
DJLA_HAEIN        -LHENEKEVLYVIAEELGLSR--------MQFEQMIAMEMAAR-------AFTQGGFY--
DJLA_PASMU        -LDQSEKDVLYIVGEELGLSR--------FQFEQMLAMEFAAR-------QFSRAGYQQQ
Q15QB7_PSEA6      -LDKAEQKVLETAALHLGFKQ--------NELLYLLSVYEAEI-------RFRQRGGQRD
Q5QVM9_IDILO      -LEKSEHEVLVNVAKHLGFTR--------FQLDQWLMMEKAAF-------RFHQHRRQQ-
DJLA_SHEON        -LDAAEHAILMTVAQELGYGR--------QQLDELLKRWQAEF-------RFHQ------
H2FZ15_OCESG      -LHPAERRLLRTIAVELGFSE--------QELEQLLAFAEAQL-------HMYRQGRAGG
C5BI20_TERTT      -LHEQEEKVLADIASTLGYSS--------FAFNHLLGMVKAQA-------HFYRNQQGRQ
Q21JG2_SACD2      -LDQAEENILASIATRLGYSS--------FAFNHLLGMVKAQF-------HFDNRQRSGS
B3PLJ2_CELJU      -LDEQEARVLRHVAGQLGFSG--------FAFEQLLRMLNAQH-------AFRSGYRDQG
E1V4D1_HALED      -LHPAERDMLMRVVRGLGCSE--------AEIAQIEAMLRGAA-------EG-GGAPHET
Q1R1E4_CHRSD      -LHPAEHDMLLRVARGLGCSE--------AEIAQIEAMLRGEQ-------QQPGGAPSQQ
A1U2G7_MARHV      -VHPAEHEMLVRIARGLGLPE--------SQVDQLEAMLRGAH-------AGQAGGTRNY
C7R7T5_KANKD      -VHERERAVLHDVGKSLGFPV--------FMIDQLIKMVQAQQ-------RFYQHSQQQG
Q60CQ6_METCA      -VNQAEERVLLDICDRLRIS------------RFEYHAMKGRLDAALRFARAYQNSSYGG
Q3J6W5_NITOC      -INRAKQHLLWHIFARLGIS------------QREFKVL-------LSLLQGKWEQKATG
D3HPS4_LEGLN      -FSTKKIQILDIIFSKLDFAPLHRQYRFYEDFGTSYSYEQPREDE-PQSREYSSSESYSS
DJLA_LEGPH        -LSSQKIHALDNIFTHLGFAPLHKQYRFYEDFGSYFQQEQSKQHY-HNQQEYKHTSSSQG
DJLA_COXBU        GLSGQKRQVLQTICRRL------------EVFGFDYNQFEQR---------FRAEQNYQR
                   .   :   *      *                                           

DJLA_VIBVY        QQHQ-SHHSSSHGGWQQAS------QTDRLADAYKILGIDANADGKEVKRAYRKLMNEHH
DJLA_VIBCH        SQQQ-SHSGQQ---WQQPS------SRHQLADAYEVLGVSESASAQEVKRAYRKLMNEHH
DJLA_ALIF1        HQSGGSHQQGQ---WQQAS------SASQLKDAYNLLGISEDADPKTIKRAHRKLMNEHH
DJLA_PHOPR        QHGG---------GFNQAP------TRDQLADAYEVLGVTESATSQEVKRAYRKQMNEHH
DJLA_YERPE        QQGG-----YSQSGYQRAS------QGPTLEDACKVLGVNSSDDSVAIKRAYRKLMGEHH
DJLA_PHOLL        RQ---------YGGYQKAA------QGPTLADACKVLGVREKDDATTIKRAYRRLMSEHH
DJLA_SALTY        Q--------SGGG-WQQAQ------RGPTLEDACNVLGVKTTDDATTIKRAYRKLMSEHH
DJLA_ECOLI        Q--------TGGGNWQQAQ------RGPTLEDACNVLGVKPTDDATTIKRAYRKLMSEHH
A4W6G1_ENT38      QQQ------SAGGGWQQAQ------RGPTLEDACNVLGVKPTDDATTIKRAYRKQMSEHH
DJLA_PECAS        RRNNGYSNGHSYGGQRPPSP----LRGPTVESACRTLGVRSSDDAVTIKRAYRKLMSEHH
M1SCH6_MORMO      Q---------SQQGYYRDQ-------TADLAAAYRVLGVKESDDSTVIKRAYRKLMSEHH
DJLA_MANSM        QQYQQQSHQQYNQENYQNS--YRTSSGPTVEDAYKVLGVNAGDNQQTVKRAYRRLMNEHH
DJLA_HAEIN        QKYQQGAYQGGYQYQQQNSGGYQHASGPTLNDAYKVLGVTESDEQSTVKRAYRRLMNEHH
DJLA_PASMU        NRYQR---DYGYQQHQQQYGGYQQQSGPTVDDAYKVLGVSATDDQQTVKRAYRRLMNENH
Q15QB7_PSEA6      GRSS----HRAHQGSQSTYS-----TQQSLNDAYQILGVSESDDDKAVKKAYRKLMSENH
Q5QVM9_IDILO      -----------HQ-QQRKTS-----SQDEIQNAYEVLGVTAQNSNAEIKKAYRKLMARHH
DJLA_SHEON        ----------------TSSG-----NKTSITDAYHLLGITAEATDQEVKRAYRKLMNEHH
H2FZ15_OCESG      Q---------GAGGFATPP-------KDRLRDAYRILEVEEGADDATVKRAYRRQMSKHH
C5BI20_TERTT      SPPQP--------------------REDELILAYRALGVDASISDAQLKSAYRKLMSEYH
Q21JG2_SACD2      GGRAS--------------------SQSDLSTAYTALGVEPSVSDSELKRAYRKLMSEYH
B3PLJ2_CELJU      HYQKP--------------------AIDELQLAYQALGVEPGVSDAELKKAYRKLMSEYH
E1V4D1_HALED      S----------------------------LEDAYQVLGVSSEASDAEIKRQYRRLMSENH
Q1R1E4_CHRSD      S----------------------------LTDAYRVLGVESDASDAELKRAYRRLMSQNH
A1U2G7_MARHV      SSSQ------------------------QIDDAYKVLGVSPEASDAEIKRAYRKLMSENH
C7R7T5_KANKD      GEHGG-------PGYQAAS-------GPSVEQAYQVLGVKASDDQQTVKRAYRRLMSQHH
Q60CQ6_METCA      HRNTP-----------------ARRREDTLEDAYAMLGIEASAGADEVKRAYRKLISRHH
Q3J6W5_NITOC      RGETQ-----------------QRR---HLKRAYTILEINESASNAEVKHAYRRLMSQHH
D3HPS4_LEGLN      YSRYN-----------------YQSTKTNLDYAYALLEISPNASKQEVKRAYRRLLSRNH
DJLA_LEGPH        QQGYK-----------------PQSPPNTLAHAFALLEVSPNANKQEVRRAYRRLLSRNH
DJLA_COXBU        YQQRA-----------------TQDPRAYLNDAYKVLGLTSAATDSEIKKSYRRLMSQHH
                                               :  *   * :        ::  :*: : . *

DJLA_VIBVY        PDKLMAKGLPPEMMNMAKEKSQEIQSAYDLIKKEKGFK--
DJLA_VIBCH        PDKLMAKGLPPEMMNVAKEKSQQIQHAYELIRKEKGIK--
DJLA_ALIF1        PDKLVAKGLPPEMMNMAKEKAQEIQAAYDLIKKEKGIK--
DJLA_PHOPR        PDKLAAKGLPPEMMEIANQKAQELQAAYDMIRKEKGFK--
DJLA_YERPE        PDKLVAKGLPPEMMEMAKQKAQEIQAAYDLIKREKGFK--
DJLA_PHOLL        PDKLVAKGLPPEMMEIAKQKAQSIQAAYDLIKKEKGFK--
DJLA_SALTY        PDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK--
DJLA_ECOLI        PDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK--
A4W6G1_ENT38      PDKLVAKGLPPEMMEMAKQKAQEIQKAYELIKEQKGFK--
DJLA_PECAS        PDKLVAKKLSPRMMEMAKRKAQDIQAAYELLKSANQTK--
M1SCH6_MORMO      PDKLVAKGLPPEMMELAKEKAQSIQAAYDLIKKEKGFK--
DJLA_MANSM        PDKLVAKGLPKEMMEMAKEKAQQIQAAYDLICKVKGWK--
DJLA_HAEIN        PDKLVAKGLPPEMMEMAKEKTQQIQAAYDLICKAKGWK--
DJLA_PASMU        PDKLVAKGLPKEMLEMAKEKTQQIQSAYDLICKTKGWK--
Q15QB7_PSEA6      PDKLVSKGLPKQALELAKNKAQDIQAAYEMIKEKRGMR--
Q5QVM9_IDILO      PDKLASKGLPEEVMKQAQQRAQDIQAAYEKIKEKRDIR--
DJLA_SHEON        PDKLVAKGLPPEMMEIANRKAQDIQAAYDRVKSERGMR--
H2FZ15_OCESG      PDKLVAQGLPKEMMEMAKEKAQDIQQAWETIKAARNLR--
C5BI20_TERTT      PDKLAGRGVPEDMLKVATERAQEIQAAYDLIKKHRRG---
Q21JG2_SACD2      PDKLAGQGVPEHVIKVATEKSQEIQSAYEMIKKQRKSQS-
B3PLJ2_CELJU      PDKLIGQGLPDDMVKAATERAQEIQAAYDLIKKSRR----
E1V4D1_HALED      PDKLAAKGLPENMREVAKERTSEIGNAYERIRKARSADAA
Q1R1E4_CHRSD      PDKLAGKGLPESMRDMAEARTQEISHAYDLIKKAREANA-
A1U2G7_MARHV      PDKLAGRGLPESMREMAEERTREISHAYDVIKEARNKAS-
C7R7T5_KANKD      PDKLVAKGLPEQMIKMATEKTQEIKAAYELVKRHKSW---
Q60CQ6_METCA      PDKLVARGMPEEMVRIANEKTQQIRKAYEVIAAARNL---
Q3J6W5_NITOC      PDKLAAKGLPEDLMTLATEKAKTIGAAYEQIRKIRGF---
D3HPS4_LEGLN      PDKLIAQGLPQEMIKIANEKTQKIVKAYEIICSSKGW---
DJLA_LEGPH        PDKLIAQGLPEEMIKLANDKTHQIMKAYELICETKGW---
DJLA_COXBU        PDKLMAKGLPPEMMKMATQKTQQIKKAYEQIRKVRSMV--
                  **** .: :.      *  ::  :  *:: :   .