CLUSTAL format seed alignment for MF_01159

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YABA_STAES      -----MNRNELFERLMKLEHHVEQLTTDMSELKDLTVELVEENVALQVENENLKRLMNKT
YABA_STAAM      -----MDRNEIFEKIMRLEMNVNQLSKETSELKAHAVELVEENVALQLENDNLKKVLGND
YABA_STAAN      -----MDRNEIFEKIMRLEMNVNQLSKETSELKAHAVELVEENVALQLENDNLKKVLGND
YABA_STAAR      -----MDRNEIFEKIMRLEMNVNQLSKETSELKALAVELVEENVALQLENDNLKKVLGND
YABA_STAAS      -----MDRNEIFEKIMRLEMNVNQLSKETSELKALAVELVEENVALQLENDNLKKVLGND
YABA_STAAW      -----MDRNEIFEKIMRLEMNVNQLSKETSELKALAVELVEENVALQLENDNLKKVLGND
YABA_LACJO      -----MDP---FSQLSQLQHNLQAMTKTVAGLENDMLEVLKENTELKVENQLLREKISKL
YABA_LACLA      ----MADKYNVFDQLGELENTLNTTLTQISGIRQVLESSMTENATLRMELEKLRDRLAEF
YABA_OCEIH      -----MGNREIFDQVSDMEKQIGELYEQLGDLKVKLSDLLEENHRLAHENHHLRHHLEEY
YABA_BACHD      -----MNKKAIFTQVSQLEERIGELHRELGGLKEQLAYLIEENHFLTIENEHLRERLGEP
YABA_BACSK      -----MDKKAIFTQVSSLEERIGDLHDELRGLKEQLAYLIEENHYLHVENENLRKRLEPE
YABA_LISIN      -----MDKKAIFDSVSNMEEQIGELYQQLGDLKTNLGEMLEENNRLNLENEHLRRRLSLT
YABA_LISMF      -----MDKKAIFDSVSNMEEQIGELYQQLGDLKTNLGEMLEENNRLNLENEHLRRRLSLT
YABA_LISMO      -----MDKKAIFDSVSNMEEQIGELYQQLGDLKTNLGEMLEENNRLNLENEHLRRRLSLT
YABA_BACCR      -----MEKKDIFESVSSMEEQIGHLYKQLGELKQHLAELLEENQHIKMENNNLRHRFEEV
YABA_BACAN      -----MEKKDIFASVSSMEEQIGHLYKQLGELKQHLAELLEENQHIKMENENLRHRFEEV
YABA_BACC1      -----MEKKDIFASVSSMEEQIGHLYKQLGELKQHLAELLEENQHIKMENENLRHRFEEV
YABA_BACCZ      -----MEKKDIFASVSSMEEQIGHLYKQLGELKQHLAELLEENQHIKMENENLRHRFEEV
YABA_BACHK      -----MEKKDIFASVSSMEEQIGHLYKQLGELKQHLAELLEENQHIKMENENLRHRFEEV
YABA_BACSU      -----MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLENKHLRKRLDDT
YABA_BACLD      -----MDKKELFDTVISLEEQIGSLYRQLGDLKQHIGEMIEENNHLQLENEHLRKRLEET
YABA_STRPN      -----MDKKELFDALDDFSQQLLVTLADVEAIKKNLKSLVEENTALRLENSKLRERLGEV
YABA_STRR6      -----MDKKELFDALDDFSQQLLVTLADVEAIKKNLKSLVEENTALRLENSKLRERLGEV
YABA_STRMU      -----MDKKDLFDVFDGFSQNLMETLAEAEALKKQVQDLVEQNASLRLENDKLRDRLSHF
YABA_STRA3      -----MDKKDLFDAFDDFSQNLLVGLSEIETMKKQIQKLLEENTVLRIENGKLRERLSVI
YABA_STRA5      -----MDKKDLFDAFDDFSQNLLVGLSEIETMKKQIQKLLEENTVLRIENGKLRERLSVI
YABA_STRP3      -----MNKKELFDAFDGFSQNLMVTLAEIEAMKKQVQSLVEENTILRLENTKLRERLSHL
YABA_STRP8      -----MNKKELFDAFDGFSQNLMVTLAEIEAMKKQVQSLVEENTILRLENTKLRERLSHL
YABA_STRP6      -----MNKKELFDAFDGFSQNLMVTLAEIEAMKKQVQSLVEENTILRLENTKLRERLSHL
YABA_STRP1      -----MNKKELFDAFDGFSQNLMVTLAEIEAMKKQVQSLVEENTILRLENTKLRERLSHL
YABA_ENTFA      -----MDKRSLYDGLNSLETDLDSSVTQLREIKAALHELVEKNTTLEIENQRLREHLQEL
YABA_LACPL      -----MDKRDLYDSFGEMEQQMQQMLDKMAKLRADMTTVLEKNAELVIENEHLREHMVEI
                           :  .  :.  :         :.      : :*  :  *   *:  :   

YABA_STAES      EESVETHLDKDNYK-------------HVKTPSPSKDNLAMLYREGFHICKGELFGKHR-
YABA_STAAM      EPTTIDTANSKPAK-------------AVKKPLPSKDNLAILYGEGFHICKGELFGKHR-
YABA_STAAN      EPTTIDTANSKPAK-------------AVKKPLPSKDNLAILYGEGFHICKGELFGKHR-
YABA_STAAR      EPTTIDTANSKPAK-------------AVKKPLPSKDNLAILYGEGFHICKGELFGKHR-
YABA_STAAS      EPTTIDTANSKPAK-------------AVKKPLPSKDNLAILYGEGFHICKGELFGKHR-
YABA_STAAW      EPTTIDTANSKPAK-------------AVKKPLPSKDNLAILYGEGFHICKGELFGKHR-
YABA_LACJO      DANKEPAENK---------------------SQAGLKSLRNIYDSGYHICN-MYYGSHRE
YABA_LACLA      EKKEVKKETP---------------------KDQPNPNLIQIFNEGFHVCH-LHYAERLA
YABA_OCEIH      RQDGDTDSKQPLNE---------TKKKHHTLPGEGYDNLARLYEEGFHICN-LEFGSPRR
YABA_BACHD      ELEETEEKEQVTKE-------------RKPFVGEGYDNLARLYQEGFHICN-THYGSLRK
YABA_BACSK      AGTKNTVTPSGESS-------------RKKMVGEGHENLARLYQEGFHICN-THYGSIRP
YABA_LISIN      DEVAPEPVAEEEAVHGVMAPNRKEAMQQMIELGEGYDNLVQLYKEGFHVCN-VHFGSPRG
YABA_LISMF      DEATPEPKAEIEAEHGVMAPNRKEAMQQMIELGEGYDNLVQLYKEGFHVCN-VHFGSPRG
YABA_LISMO      DEATPEPKAETEAEHGVMAPNRKEAMQQMIELGEGYDNLVQLYKEGFHVCN-VHFGSPRG
YABA_BACCR      QNKEKQKTQKRKEV------------KPKTDIGEGYDNLARLYQEGFHICN-LHYGSVRK
YABA_BACAN      QIKEKQKTQKRKEV------------KPKTDIGEGYDNLARLYQEGFHICN-LHYGSVRK
YABA_BACC1      QIKEKQKTQKRKEV------------KPKTDIGEGYDNLARLYQEGFHICN-LHYGSVRK
YABA_BACCZ      QIKEKQKTQKRKEV------------KPKTDIGEGYDNLARLYQEGFHICN-LHYGSVRK
YABA_BACHK      QIKEKQKTQKRKEV------------KPKTDIGEGYDNLARLYQEGFHICN-LHYGSVRK
YABA_BACSU      TQQIEKFKADKKES--------KTQKTEQTDIGEGYDNLARLYQEGFHICN-VHYGSVRK
YABA_BACLD      DQRLKSVKSDEKEI--------KAEKTGHADIGEGHDNLARLYQEGFHICN-IHYGSVRK
YABA_STRPN      EADAPVKAKH------------------------VRESVRRIYRDGFHVCN-DFYGQRRE
YABA_STRR6      EADAPVKAKHV------------------------RESVRRIYRDGFHVCN-DFYGQRRE
YABA_STRMU      SQMEESDPSSKA-------------------ISSRKENLENIYEDGFHICT-FFYGQRRE
YABA_STRA3      EAETETAVKNSK---------------------QGRELLEGIYNDGFHICN-TFYGQRRE
YABA_STRA5      EAETETAVKN---------------------SKQGRELLEGIYNDGFHICN-TFYGQRRE
YABA_STRP3      EHETAAKNPS----------------------KQRKDHLEGIYDEGFHICN-FFYGQRRE
YABA_STRP8      EHETVAKNPF----------------------KQRKDHLEGIYDEGFHICN-FFYGQRRE
YABA_STRP6      EHETVAKNPS----------------------KQRKDHLEGIYDEGFHICN-FFYGQRRE
YABA_STRP1      EHETVAKNPSKQRK----------------------DHLEGIYDEGFHICN-FFYGQRRE
YABA_ENTFA      NKLAGNTTETEKQE-----------------LSKSRMNLEKLYEEGFHVCN-ILYGSRRE
YABA_LACPL      ENELPKKAAS------------------TTTLSKSRQNLEKLYDEGFHVCN-QFYGKRRD
                                                      :  :: .*:*:*    :..   

YABA_STAES      HGEDCLLCLNVLSD----------
YABA_STAAM      HGEDCLFCLEVLSD----------
YABA_STAAN      HGEDCLFCLEVLSD----------
YABA_STAAR      HGEDCLFCLEVLSD----------
YABA_STAAS      HGEDCLFCLEVLSD----------
YABA_STAAW      HGEDCLFCLEVLSD----------
YABA_LACJO      SGEDCMFCLDILDNFVNHGQKSRG
YABA_LACLA      EGESCLDCLELLYR----------
YABA_OCEIH      NE-DCIFCLDFFDKTK--------
YABA_BACHD      NGEDCLFCLSFLNQD---------
YABA_BACSK      EGDDCLFCLSFLHQK---------
YABA_LISIN      NDEDCLFCLSLLNKK---------
YABA_LISMF      NDEDCLFCLSLLNKK---------
YABA_LISMO      NDEDCLFCLSLLNKK---------
YABA_BACCR      EG-DCLFCLSFLNKK---------
YABA_BACAN      EG-DCLFCLSFLNKK---------
YABA_BACC1      EG-DCLFCLSFLNKK---------
YABA_BACCZ      EG-DCLFCLSFLNKK---------
YABA_BACHK      EG-DCLFCLSFLNKK---------
YABA_BACSU      E--DCLFCLSFLNKK---------
YABA_BACLD      EG-DCLFCLSFLNKK---------
YABA_STRPN      QDEECMFCDELLYRE---------
YABA_STRR6      QDEECMFCDELLYRE---------
YABA_STRMU      NNEDCAFCMELLYRE---------
YABA_STRA3      NDEECAFCIELLYRD---------
YABA_STRA5      NDEECAFCIELLYRD---------
YABA_STRP3      NDEECMFCRELLDRK---------
YABA_STRP8      NDEECMFCRELLDRK---------
YABA_STRP6      NDEECMFCRELLDRK---------
YABA_STRP1      NDEECMFCRELLDRK---------
YABA_ENTFA      NDEECAFCLDVIYGERTR------
YABA_LACPL      DDESCVFCLEVIYGERERA-----
                   .*  * ..: