CLUSTAL format seed alignment for MF_01169

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ODO1_BACCZ      -------MTRKNTTTNPWAKFHGPNLGYVIEQYDLYVTGAGSVDPELQELFEIFGAPSFQ
ODO1_BACHK      -------MTRKNTTTNPWAKFHGPNLGYVIEQYDLYVTGAGSVDPELQELFEIFGAPSFQ
ODO1_BACAN      -------MTRKNTTTNPWAKFHGPNLGYVIEQYDLYVTGAGSVDPELQELFEIFGAPSFQ
ODO1_BACC1      -------MTRKNTTTNPWAKFHGPNLGYVIEQYDLYVTGAGSVDPELQELFEIFGAPSFQ
ODO1_BACCR      -------MTRKNTTTNPWAKFHGPNLGYVIEQYDLYVTGAGSVDPELQELFEIFGAPSFQ
ODO1_ALKHC      ------MSSKEHTSEEPWQGFYGPNLGVAVELYEEYQKDPNAVDDELREAFEKWGPPPAT
ODO1_BACSK      ------MSSKEHSPEKPWRGFYGPNLGAVIELYDQYVEDPNSVDEQTRAHFEKWGPP---
ODO1_GEOKA      -------MAKQTNYAQPWSQFYGPNLGYVIEMYEQYLDDPNSIDPELKQLFEQWGAPVLE
ODO1_BACLD      ------MFQNSMKQRMTWEEFHGPNLGYVLELYDQYVKDPESLDADLKEMFDELGAPPGD
ODO1_BACSU      ------MFQNSMKQRMNWEDFYGPNLGYALELYDQYTQDPNSIDPDLKEMFDELGAPPSD
ODO1_OCEIH      ------MAENAESAERFWGQFHGQNTGYLEQQFELYKEDPELVESSIRTIFDTHGAPSWL
ODO1_STAAC      -------MTNERKEVSEAPVNFGANLGLMLDLYDDFLQDPSSVPEDLQVLFSTIKNDDSI
ODO1_STAAS      -------MTNERKEVSEAPVNFGANLGLMLDLYDDFLQDPSSVPEDLQVLFSTIKNDDSI
ODO1_STAAW      -------MTNERKEVSEAPVNFGANLGLMLDLYDDFLQDPSSVPEDLQVLFSIIKNDDSI
ODO1_STAAM      -------MTNERKEVSEAPVNFGANLGLMLDLYDDFLQDPSSVPEDLQVLFSTIKNDDSI
ODO1_STAAR      -------MTNERKEVSEAPVNFGANLGLMLDLYDDFLQDPSSVPEDLQVLFSTIKNDDSI
ODO1_STAAN      -------MTNERKEVSEAPVNFGANLGLMLDLYDDFLQDPSSVPEDLQVLFSTIK-----
ODO1_STAEQ      -------MTKNKKEFTEAPVNFGANLGLMLDLYDDYLQDPSSVPEDLQVLFSTIKTGEAH
ODO1_STAES      -------MTKNKKEFTEAPVNFGANLGLMLDLYDDYLQDPSSVPEDLQVLFSTIKTGEAH
ODO1_STAHJ      -------MAKDNKDVTEAPVNFGANLGLMLDLYDDYLQDPSSVPDDLQVLFSTIKNGEAH
ODO1_STAS1      -------MSNESQ-VSEAPVNFGANLGYVLDLYDIYLDNPSAVPEDLQVLFSTIKNGEAN
ODO1_BRUME      MAKQEQAPDRANDVFALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADD
ODO1_BRUSU      MAKQEQAPDRANDVFALTSFLYGGNADYIEELYAKYEDDPNSVDPQWRDFFAKLGDNADD
ODO1_LEPIC      ------------MKIEKLMALYGENGALLEELYNQYKLNPETLDKEWKSFFQEVDTNG--
ODO1_LEPIN      ------------MKIEKLMALYGENGALLEELYNQYKLNPETLDKEWKSFFQEVDTNG--
                                     .* *     : :  :  ..  :  . :  *         

ODO1_BACCZ      DDVVTGDNTATHFSPQ--------------------------------------------
ODO1_BACHK      DDVVTGDNTATHFSPQ--------------------------------------------
ODO1_BACAN      DDVVTGDNTATHFSPQ--------------------------------------------
ODO1_BACC1      DDVVTGDNTATHFSPQ--------------------------------------------
ODO1_BACCR      DDVVTGDNTATHFSPQ--------------------------------------------
ODO1_ALKHC      APERTQSTFTAASITD--------------------------------------------
ODO1_BACSK      ALEENVSSSNAKETIG--------------------------------------------
ODO1_GEOKA      EPVSPADDETAKTHQTF------------------------------------------R
ODO1_BACLD      IRAASQKNEEADFTAG--------------------------------------------
ODO1_BACSU      IKEASGTKEKGRVTAD--------------------------------------------
ODO1_OCEIH      SSTENVKSVSNASDFD--------------------------------------------
ODO1_STAAC      VPALKST---SSQNSD--------------------------------------------
ODO1_STAAS      VPALKST---SSQNSD--------------------------------------------
ODO1_STAAW      VPALKST---SSQNSD--------------------------------------------
ODO1_STAAM      VPALKST---SSQNSD--------------------------------------------
ODO1_STAAR      VPALKST---SSQNSD--------------------------------------------
ODO1_STAAN      ------------------------------------------------------------
ODO1_STAEQ      IEAKPTTDGGGSQAGD--------------------------------------------
ODO1_STAES      IEAKPTTDGGGSQAGD--------------------------------------------
ODO1_STAHJ      VAAKSTTEGSGSSAGD--------------------------------------------
ODO1_STAS1      IATNTEGQ-SNVTKGD--------------------------------------------
ODO1_BRUME      VKKNAEGPSWTRKNWPIAANGELVSALDGNWAEVEKHVTDKLKGKAAKGEAKGAAGTPLT
ODO1_BRUSU      VKKNAEGPSWTRKNWPIAANGELVSALDGNWAEVEKHVTDKLKGKAAKGEAKGAAGTPLT
ODO1_LEPIC      ---LANGSGYTNGN--------------------------------------GKSAVATS
ODO1_LEPIN      ---LANGSGYTNGN--------------------------------------GKSAVATS
                                                                            

ODO1_BACCZ      ---NTGNIEKILKVVQLVEQIRSFGHTLAHINPMEDAA-NGQSLLERAMNELSDADLKAI
ODO1_BACHK      ---NTGNIEKILKVVQLVEQIRSFGHTLAHINPMEDGA-NGQSLLEKAMNELSDADLKAI
ODO1_BACAN      ---NTGNIEKILKVVQLVEQIRSFGHTLAHINPMEDAA-NGQSLLEKAMNELSDADLKAI
ODO1_BACC1      ---NTGNIEKILKVVQLVEQIRSFGHTLAHINPMEDAA-NGQSLLEKAMNELSDADLKAI
ODO1_BACCR      ---NTGNIEKILKVVQLVEQIRSFGHTLAHINPMEDAA-NGQSLLEKAMSELSDADLKAI
ODO1_ALKHC      ----PDVIKKFVGAVKLADHIRAFGHLAADIQPILKEQ-RREDMFDLDRFGLTESDIRSV
ODO1_BACSK      ----ADMISAVVGAVRLADYIRAKGHLVSDIQPIWKTD-KNSNLLDYDRFNVTEEELKKV
ODO1_GEOKA      LPETPTIFSKLVAAVKLADSIRHYGHLVADTNPLVKKE-KKLRRLELDEYDLTEEDLKRI
ODO1_BACLD      ------SIQKIASAVKLAEDIRTYGHLNASVNPLRKTQ-EKQELFPLAEYGLTEQDVKKI
ODO1_BACSU      ------LIQKIASAVRLAEDIRTYGHLNASVNPLRKDE-KKSELFPLSDYGLTEEEIKAI
ODO1_OCEIH      -------VTKLTSAIRLVEAIRRYGHTDADIYPVGGYKGDRSKMLDLSTYNLKEQDLEKI
ODO1_STAAC      --------GTIKRVMRLIDNIRQYGHLKADIYPVNPPKRKHVPKLEIEDFDLDQQTLEGI
ODO1_STAAS      --------GTIKRVMRLIDNIRQYGHLKADIYPVNPPKRKHVPKLEIEDFDLDQQTLEGI
ODO1_STAAW      --------GTIKRVMRLIDNIRQYGHLKADIYPVNPPKRKHVPKLEIEDFDLDQQTLEGI
ODO1_STAAM      --------GTIKRVMRLIDNIRQYGHLKADIYPVNPPKRKHVPKLEIEDFDLDQQTLEGI
ODO1_STAAR      --------GTIKRVMRLIDNIRQYGHLKADIYPVNPPKRKHVPKLEIEDFDLDQQTLEGI
ODO1_STAAN      ------------RVMRLIDNIRQYGHLKADIYPVNPPKRKHVPKLEIEDFDLDQQTLEGI
ODO1_STAEQ      --------STIKRVMRLIDNIRQYGHLKADIYPVNPPERQNVPKLEIEDFDLDKETLEKI
ODO1_STAES      --------STIKRVMRLIDNIRQYGHLKADIYPVNPPERQNVPKLEIEDFDLDKETLEKI
ODO1_STAHJ      --------GTIKRIMRLIDNIRQYGHLKADIYPVNAPKRTNLPKLEIEEFNLDKETLENV
ODO1_STAS1      --------STIKRVMRLIDNIRQYGHLLADIYPVNRPQRENVPKLNMEDFNLDQETLESI
ODO1_BRUME      AEEITQAARDSVRAIMMIRAYRMRGHLHANLDPLGLAE-KPNDYNELEPENYGFTPADYN
ODO1_BRUSU      AEEITQAARDSVRAIMMIRAYRMRGHLHANLDPLGLAE-KPNDYNELEPENYGFTPADYN
ODO1_LEPIC      FTDAQAASIREMGIINLLNAYRRQGHLAAKLDPLGIQ--KPN-RTFIDSKLHNISPADID
ODO1_LEPIN      FTDAQAASIREMGIINLLNAYRRQGHLAAKLDPLGIQ--KPN-RTFIDSKLHNISPADID
                              : :    *  **  :   *:                          

ODO1_BACCZ      PAKTVWQDAPEGIHTALDVIHRLKEVYTQSLAYEFSHIQDSEERAWLHQMVESNSLRQPL
ODO1_BACHK      PAKTVWQDAPEGIHTALDVIHRLKEVYTQSLAYEFSHIQDSEERAWLHQMVESNSLRQPL
ODO1_BACAN      PAKTVWQDAPEGIHTALDVIHRLKEVYTQSLAYEFSHIQDSEERAWLHQMVESNSLRQPL
ODO1_BACC1      PAKTVWQDAPEGIHTALDVIHRLKEVYTQTLAYEFSHIQDSEERAWLHQMVESNSLRQPL
ODO1_BACCR      PAKTVWQDAPEGIHTALDVIHRLKDVYTKSLAYEFSHIQDSEERAWLHQMVESNSLRQPL
ODO1_ALKHC      PVDLLCPYAPAHVKNGLDAINHLKEVYTKTIAFEFVHVTDEEERKWLNRMIESGLYLPNL
ODO1_BACSK      PVKLICKDAPPHLKNGLEAIEHLKKVYTQTMAFEFGHVQDEEERNWLRKQVESEAYADEL
ODO1_GEOKA      PVAFLCPHAPAHVKNGWDAILHLRKIYTDKIAFEFSQVHNLEERNWLIQQIESGAYYPSL
ODO1_BACLD      PASVICKDAPKEVTNGLEAIQYLRNTYKKSISFEFDHVHIFEERNWLMKKIESGELFTPK
ODO1_BACSU      PASVICKDAPKNISNGLEAIQYLRNTYKRTISFEFDHVHDFKEREWLTRKIESGELFQKN
ODO1_OCEIH      PASWIWEKQAPGVATALDVVNQLKKYYTGTITFEYDHVNNDEERKWLFDLIEEGNARLDP
ODO1_STAAC      SAGIVSDHFADIYDNAYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIET-PYKVTL
ODO1_STAAS      SAGIVSDHFADIYDNAYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIET-PYKVTL
ODO1_STAAW      SAGIVSDHFADIYDNAYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIET-PYKVTL
ODO1_STAAM      SAGIVSDHFADIYDNAYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIET-PYKVTL
ODO1_STAAR      SAGIVSDHFADIYDNAYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIET-PYKVTL
ODO1_STAAN      SAGIVSDHFADIYDNAYEAILRMEKRYKGPIAFEYTHINNNTERGWLKRRIET-PYKVTL
ODO1_STAEQ      SSGIVSEHFKDIYDNAYDAIVRMERRYKGPIAFEYTHINNNKERVWLKRRIET-PYKASL
ODO1_STAES      SSGIVSEHFKDIYDNAYDAIVRMERRYKGPIAFEYTHINNNKERVWLKRRIET-PYKASL
ODO1_STAHJ      SAEIVSDHFKDIYDNAYEAIERMEKRYKGPIAFEYNHINNNKERTWLKRRIET-PYRANI
ODO1_STAS1      SAGIVSEHFKDIYDNAYEAIVRMEKRYKGPIAFEYTHINNNRERVWLKRRIET-PYKATL
ODO1_BRUME      RKIFIDNVLGLEYATVPEMLDILKRTYCGAIGVEFMHISDPAEKAWIQERIEGPDKKVAF
ODO1_BRUSU      RKIFIDNVLGLEYATVPEMLDILKRTYCGAIGVEFMHISDPAEKAWIQERIEGPDKKVAF
ODO1_LEPIC      TVV---DSETLGRVKLAEIVDLYEKVYCNTIGAEHFYLVNDEEREWLQKKMESPEFLAPL
ODO1_LEPIN      TVV---DSETLGRVKLAEIVDLYEKVYCNTIGAEHFYLVNDEEREWLQKKMESPEFLAPL
                              .  : :   .  *   :  *.  :    *: *:   :*        

ODO1_BACCZ      SNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVM
ODO1_BACHK      SNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVM
ODO1_BACAN      SNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVM
ODO1_BACC1      SNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVM
ODO1_BACCR      SNKKRTALLKRLTAVEGFEQFLHKTFVGQKRFSIEGVDMLVPVLDEIVLEGAKNGVEDVM
ODO1_ALKHC      STEQRKSLLKRLTDVEGFEKFLHRTFVGQKRFSIEGLDTLVPMLDEVVREAVHEGTTNVM
ODO1_BACSK      PNKEKKALLERLTSVEGFEKFIHRTFVGQKRFSIEGLDTLVPMLDKAIREVRKEKTDHVM
ODO1_GEOKA      ANKERVALLRRLTEVEGFEKFIHRTYVGQKRFSIEGLDSMVPLLDELVRQAIEHEIDAVN
ODO1_BACLD      SKEKLVEVLRRLTEVESLEQFLHKTFVGQKRFSIEGLDALVPMLDDIIAKSVSAGTTNVN
ODO1_BACSU      SAEKLSAVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDALVPVLDDIIAQSVKSGTTSVN
ODO1_OCEIH      SDDERKKILQRLADVEGFEKFLHKTFVGQKRFSIEGLESMVPMIDHIVQYSNQDSIEHVM
ODO1_STAAC      NNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQ
ODO1_STAAS      NNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQ
ODO1_STAAW      NNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQ
ODO1_STAAM      NNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQ
ODO1_STAAR      NNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQ
ODO1_STAAN      NNNEKRALFKQLAYVEGFEKYLHKNFVGAKRFSIEGVDALVPMLQRTITIAAKEGIKNIQ
ODO1_STAEQ      NDNQKKELFKKLAHVEGFEKYLHKNFVGAKRFSIEGVDTLVPMLQHTITLAGNEGIKNIQ
ODO1_STAES      NDNQKKELFKKLAHVEGFEKYLHKNFVGAKRFSIEGVDTLVPMLQHTITLAGNEGIKNIQ
ODO1_STAHJ      NNDERKKLFDTLAHVEGFEKYLHKNFVGAKRFSIEGVDTLVPMLQHTLKRAAEIEINNIQ
ODO1_STAS1      NDNQKIELFKNLAHVEGFEKYLHKNFVGAKRFSIEGVDTLVPMLQQTLRIASDEGIQNIQ
ODO1_BRUME      TPEGKKAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVV
ODO1_BRUSU      TPEGKKAILSKLIEAEGFEQFIDVKYKGTKRFGLDGGESLIPALEQIVKRGGQMGLKEVV
ODO1_LEPIC      PRGIKLRLFEKLFQADYFETFLAKKYVGKKRFSLEGGESFIPLLDTIVEEAGYHQMDGLV
ODO1_LEPIN      PRGIKLRLFEKLFQADYFETFLAKKYVGKKRFSLEGGESFIPLLDTIVEEAGYHQMDGLV
                       ::  *  .: :* ::  .: * ***.::* : ::* ::  :          : 

ODO1_BACCZ      IGMAHRGRLSVLAHVLEKPYSHMFAEFKHAKIEGAVANSG-------WTGDVKYHLGREQ
ODO1_BACHK      IGMAHRGRLSVLAHVLEKPYSHMFAEFKHAKIEGAVANSG-------WTGDVKYHLGREQ
ODO1_BACAN      IGMAHRGRLSVLAHVLEKPYSHMFAEFKHAKIEGAVANSG-------WTGDVKYHLGREQ
ODO1_BACC1      IGMAHRGRLSVLAHVLEKPYSHMFAEFKHAKIEGAVANSG-------WTGDVKYHLGREQ
ODO1_BACCR      IGMAHRGRLSVLAHVLEKPYSHMFAEFKHAKIEGAVANSG-------WTGDVKYHLGREQ
ODO1_ALKHC      IGMAHRGRLNVLAHVLNKPYEMIFAEFLHSLNKDLFPSEGSIGINYGWTGDVKYHLGADR
ODO1_BACSK      IGMAHRGRLNVLAHTLGKPYKAIFSEFLQAPNKLNAPSEGLGETYTGWTGDVKYHLGADR
ODO1_GEOKA      IGMAHRGRLNVLAHVLGKPYEMIFAEFQHAESKNFIPSEGSVAITYGWTGDVKYHLGAAR
ODO1_BACLD      IGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSTGINYGWTGDVKYHLGANR
ODO1_BACSU      IGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPNKDLVPSEGSIGISYGWTGDVKYHLGANR
ODO1_OCEIH      MGMAHRGRLSVLANVLGKPYDKIFSEFNYTKEKELMPSEGSRAINYGWTGDVKYHYGAEK
ODO1_STAAC      IGMAHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLQLTAGWTGDVKYHLGGIK
ODO1_STAAS      IGMAHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLQLTAGWTGDVKYHLGGIK
ODO1_STAAW      IGMAHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLQLTAGWTGDVKYHLGGIK
ODO1_STAAM      IGMAHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLQLTAGWTGDVKYHLGGIK
ODO1_STAAR      IGMAHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLQLTAGWTGDVKYHLGGIK
ODO1_STAAN      IGMAHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLQLTAGWTGDVKYHLGGIK
ODO1_STAEQ      IGMAHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLELTSGWTSDVKYHLGGVK
ODO1_STAES      IGMAHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLELTSGWTSDVKYHLGGVK
ODO1_STAHJ      IGMAHRGRLNVLTHVLEKPYEMMISEFMHTDPMKFLPEDGSLELTAGWTGDVKYHLGGVK
ODO1_STAS1      IGMAHRGRLNVLTHVLEKPYEMMISEFMHIDPMKFLPEDGSLQLTSGWTGDVKYHLGGVK
ODO1_BRUME      LGMAHRGRLNVLSQVMGKPHRAIFHEFKGG---SYTPDDVE------GSGDVKYHLGASS
ODO1_BRUSU      LGMAHRGRLNVLSQVMGKPHRAIFHEFKGG---SYTPDDVE------GSGDVKYHLGASS
ODO1_LEPIC      IGMAHRGRLNVLVNIIEKPASLIFAEFE-----EKTDKDNL------SYADVKYHLGYSN
ODO1_LEPIN      IGMAHRGRLNVLVNIIEKPASLIFAEFE-----EKTDKDNL------SYADVKYHLGYSN
                :********.** : : **   :: **          ..          .***** *   

ODO1_BACCZ      VVSNEE-VSTRVTLANNPSHLEFVNPVVEGFARAAQENRKKSG----LPEQDTSKSFVIL
ODO1_BACHK      VVSNEE-VSTRVTLANNPSHLEFVNPVVEGFARAAQENRKKSG----LPEQDTSKSFVIL
ODO1_BACAN      VVSNEE-VSTRVTLANNPSHLEFVNPVVEGFARAAQENRKKSG----LPEQDTSKSFVIL
ODO1_BACC1      VVSNEE-VSTRVTLANNPSHLEFVNPVVEGFARAAQENRKKSG----LPEQDTSKSFVIL
ODO1_BACCR      VVSNEE-VSTRVTLANNPSHLEFVNPVVEGFARAAQENRKKSG----LPDQDTSKSFVIL
ODO1_ALKHC      QIRDENTAEARLTLANNPSHLEFVSPIVEGYARAAQEDRTSPG----APEQDIMKAYSIL
ODO1_BACSK      QISDDKSAQTIVSLANNPSHLEFVSPIVEGYARAAQEDRSSKG----APKQDTTRAYSIL
ODO1_GEOKA      RLRNQSAHTMRITLANNPSHLEVVNPVVLGYTRAAQEDRTKPG----VPVQNTDASFAIL
ODO1_BACLD      QIQDEHTKTARIALANNPSHLEFIDPIVEGSTRAAQETRTESG----YPVQDVKKSMAIL
ODO1_BACSU      ELQDAETKSARITLANNPSHLEFINPIVEGSTRAAQETRTQSG----YPVQDETKSLAIL
ODO1_OCEIH      EVEFGNKGQTRITLAHNPSHLEFVNPVVEGFTRAAQDDRSEKG----YPKQVTNKAVSVL
ODO1_STAAC      TTDSYG-TMQRIALANNPSHLEIVAPVVEGRTRAAQDDTQRAG----APTTDHHKAMPII
ODO1_STAAS      TTDSYG-TMQRIALANNPSHLEIVAPVVEGRTRAAQDDTQRAG----APTTDHHKAMPII
ODO1_STAAW      TTDSYG-TMQRIALANNPSHLEIVAPVVEGRTRAAQDDTQRAG----APTTDHHKAMPII
ODO1_STAAM      TTDSYG-TMQRIALANNPSHLEIVAPVVEGRTRAAQDDTQRAG----APTTDHHKAMPII
ODO1_STAAR      TTDSYG-TMQRIALANNPSHLEIVAPVVEGRTRAAQDDTQRAG----APTTDHHKAMPII
ODO1_STAAN      TTDSYG-TMQRIALANNPSHLEIVAPVVEGRTRAAQDDTQRAG----APTTDHHKAMPII
ODO1_STAEQ      TTNSYG-IEQRISLANNPSHLEIVAPVVAGKTRAAQDNTHQVG----GPSTDFHKAMPII
ODO1_STAES      TTNSYG-IEQRISLANNPSHLEIVAPVVAGKTRAAQDNTHQVG----APSTDFHKAMPII
ODO1_STAHJ      TTSSYG-IEQRISLANNPSHLEIVAPVVIGKTRASQDDTKHAG----KPTTDFHKGMPII
ODO1_STAS1      TTQSYG-SEQRISLANNPSHLEIVAPVVLGKTRANQDTTDKPG----AVTTEFKKSMPIL
ODO1_BRUME      DREFD-GNKVHLSLTANPSHLEIVNPVVMGKARAKQDLLVGRTRDDMVPLSERAKVLPLL
ODO1_BRUSU      DREFD-GNKVHLSLTANPSHLEIVNPVVMGKARAKQDLLVGRTRDDMVPLSERAKVLPLL
ODO1_LEPIC      SRMTTSGKEVKLSLAFNPSHLECVDPVVTGSVRARQTLIGDK---------DRSKYMPIL
ODO1_LEPIN      SRMTTSGKEVKLSLAFNPSHLECVDPVVTGSVRARQTLIGDK---------DRSKYMPIL
                           ::*: ****** : *:* * .** *                      ::

ODO1_BACCZ      VHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSYDSRSTKYSSDLAKG
ODO1_BACHK      VHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSYDSRSTKYSSDLAKG
ODO1_BACAN      VHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSYDSRSTKYSSDLAKG
ODO1_BACC1      VHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSYDSRSTKYSSDLAKG
ODO1_BACCR      VHGDAAFPGQGIVSETLNLSRLNAYQTGGTIHVIANNAVGFTTDSYDSRSTKYSSDLAKG
ODO1_ALKHC      IHGDAAFPGQGVVTETLNLSRLTGYQTGGSLHIIANNNIGFTTETFDSRSTLYSSDPAKG
ODO1_BACSK      IHGDAAFPGQGVVTETLNLSRLNGYHVGGSLHIIANNNIGYTTEMHDSRSTTYASDPAKG
ODO1_GEOKA      IHGDAAFPGQGIVAETLNLSQLRGYTTGGTIHIIANNMIGFTTESYDSRSTTYASDMAKG
ODO1_BACLD      IHGDAAFPGEGIVAETLNLSQLKGYQVGGAIHIIANNMIGFTTESNESRSTKYASDLAKG
ODO1_BACSU      IHGDAAFPGEGIVAETLNLSSLKGYQVGGAIHIIANNMIGFTTESAESRSTKYASDLAKG
ODO1_OCEIH      IHGDAAFIGEGVVAETLNLSGLPGYSTGGTLHIIANNLLGYTTDREDGRSTRYASDLAKG
ODO1_STAAC      IHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPIDARSTTYSTDVAKG
ODO1_STAAS      IHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPIDARSTTYSTDVAKG
ODO1_STAAW      IHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPIDARSTTYSTDVAKG
ODO1_STAAM      IHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPIDARSTTYSTDVAKG
ODO1_STAAR      IHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPIDARSTTYSTDVAKG
ODO1_STAAN      IHGDAAYPGQGINFETMNLGNLKGYSTGGSLHIITNNRIGFTTEPIDARSTTYSTDVAKG
ODO1_STAEQ      IHGDAAYPGQGINFETMNLGSLKGYSTGGSLHIITNNRIGFTTEPFDGRSTTYSSDVAKG
ODO1_STAES      IHGDAAYPGQGINFETMNLGSLKGYSTGGSLHIITNNRIGFTTEPIDGRSTTYSSDVAKG
ODO1_STAHJ      IHGDAAYPGQGINFETMNLSNLDGYSTGGALHIITNNRIGFTTEPVDGRSTTYSTDIAKG
ODO1_STAS1      IHGDAAYPGQGINFEAMNLGNLEGYSTGGSLHIITNNRIGFTTEPEDGRSTTYSSDVAKG
ODO1_BRUME      LHGDAAFAGQGVVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPAFSRSSPYPSDVAKM
ODO1_BRUSU      LHGDAAFAGQGVVAECLGLSGLKGHRVAGTLHFIINNQIGFTTNPAFSRSSPYPSDVAKM
ODO1_LEPIC      IHGDAAFAGQGVVAETLNLMNLEGYTTGGTFHIVVNNQIGFTTLPDESRSTLYATDLAKG
ODO1_LEPIN      IHGDAAFAGQGVVAETLNLMNLEGYTTGGTFHIVVNNQIGFTTLPDESRSTLYATDLAKG
                :*****: *:*:  * :.*  * .: ..*::*.: ** :*:**    .**: *.:* ** 

ODO1_BACCZ      FDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQPQVY
ODO1_BACHK      FDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQPQVY
ODO1_BACAN      FDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQPQVY
ODO1_BACC1      FDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQPQVY
ODO1_BACCR      FDIPIVHVNADDPEACLAAANLAIQYRMLFKKDFLIDLIGYRRYGHNEMDDPAVTQPQVY
ODO1_ALKHC      FEIPIVHVNADDPEACLAAVHLAFQYRKRFKKDFLIDLIGYRRFGHNEMDEPAVTQPGVY
ODO1_BACSK      FEIPIVHVNADDAEACVRAIKFAVEYRRKFQKDFLIDLIGYRRFGHNEGDEPAVTQPDLY
ODO1_GEOKA      FEVPIVHVNADDPEACLAAACLAFAYRQRFKKDFVIDLIGYRRFGHNEMDEPMATNPTMY
ODO1_BACLD      FEIPIVHVNADDPEACLSAVQLAVEYRMTFNKDFLIDLIGYRRFGHNEMDEPSATQPMLY
ODO1_BACSU      YEIPIVHVNADDPEACLSAVKFAVEYRKTFNKDFLIDLIGYRRYGHNEMDEPSTTQPMLY
ODO1_OCEIH      FEIPVIRVNADDPISCISAIKIAYEYRQKFQKDFLIDLVGYRRYGHNEMDEPRTTQPSLY
ODO1_STAAC      YDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPVPY
ODO1_STAAS      YDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPVPY
ODO1_STAAW      YDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPVPY
ODO1_STAAM      YDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPVPY
ODO1_STAAR      YDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPVPY
ODO1_STAAN      YDVPIFHVNADDVEATIEAIDIAMEFRKEFHKDVVIDLVGYRRFGHNEMDEPSITNPVPY
ODO1_STAEQ      YDVPILHVNADDVEATIEAIEIAMEFRKEFHKDVVIDLVGYRRYGHNEMDEPSITNPVPY
ODO1_STAES      YDVPILHVNADDVEATIEAIEIAMEFRKEFHKDVVIDLVGYRRYGHNEMDEPSITNPVPY
ODO1_STAHJ      YDVPILHVNADDVEATIEAIDIAMEFRKEFHKDFVIDLVGYRRYGHNEMDEPSITNPLPY
ODO1_STAS1      YDVPIMHVNADNVEATIEAIEIAMAFRKEFNKDVVIDLVGYRRYGHNEMDEPSITNPLQY
ODO1_BRUME      IEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPLMY
ODO1_BRUSU      IEAPIFHVNGDDPEAVVFAAKVATEFRMTFHKPVVIDMFCYRRFGHNEGDEPSFTQPLMY
ODO1_LEPIC      FQIPIIHVNGDDPEAVYRVVKLGMEYRQKFKKDFIIDLVCYRRLGHNETDEPAFTQPKMY
ODO1_LEPIN      FQIPIIHVNGDDPEAVYRVVKLGMEYRQKFKKDFIIDLVCYRRLGHNETDEPAFTQPKMY
                 : *:.:**.*:  :   .  ..  :*  *:* .:**:. *** **** *:*  *:*  *

ODO1_BACCZ      KKIKNHPTVRAIYADQLQAAGVLNADEIETITQFTQEQLKSDYAQVPP------ADTSDA
ODO1_BACHK      KKIKNHPTVRAIYADQLQAAGVLNADEIETITQFTQEQLKSDYAQVPP------ADTSDA
ODO1_BACAN      KKIKNHPTVRAIYADQLQAAGVLNADEIETITQFTQEQLKSDYAQVPP------ADTSDA
ODO1_BACC1      KKIKNHPTVRAIYADQLQAAGVLNADEIETITQFIQEQLKSDYAQVPP------ADTSDA
ODO1_BACCR      KKIKNHPTVRAIYADQLQAAGVLNADEVETITQFTQEQLKSDYAQVPP------ADTSDA
ODO1_ALKHC      QIIRKHPTVRELYSKQLVKKGLIDEQTVKQLDDEVQDKLQSVYEETL-------RNRTDE
ODO1_BACSK      AQIRKHPTVRAIYAKQLEAEQVITAKEAQKLDTDMYNYLLEEYNKVN-------SDKSEK
ODO1_GEOKA      AIINQHPTVRKLYAQKLMEKGIITEREVDEMEQEVAERLKIAYERVP-------KNEDEL
ODO1_BACLD      DAVRKHPTVKNIFAEKLIHKGIVDKETVGKIKDAVQKRLEEAYRKVP-------AKKEDM
ODO1_BACSU      DAVRKHPTVKQIFAEKLVKEGVVTEEVVQNIEKSVTKRIEDAYQKVP-------SKKEHT
ODO1_OCEIH      QQIDDHPSVASLFGKGMEEKGILQEGGFEEVKSAVEKKLTDIYKGMTE------SEIGEP
ODO1_STAAC      QNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKELRQAHDKINK------ADKMD-
ODO1_STAAS      QNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKELRQAHDKINK------ADKMD-
ODO1_STAAW      QNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKELRQAHDKINK------ADKMD-
ODO1_STAAM      QNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKELRQAHDKINK------ADKMD-
ODO1_STAAR      QNIRKHDSVEYVFGKKLVNEGIISEDEMHSFIEQVQKELRQAHDKINK------ADKMD-
ODO1_STAAN      QNIRKHDSVEYVFGKKLVNEGVISEDEMHSFIEQVQKELRQAHDKINK------ADKMD-
ODO1_STAEQ      QNIRKHDSVEILYGKKLVDEGIISEDEMNEVIDSVQKEMRTAHDKIDK------NDKMN-
ODO1_STAES      QNIRKHDSVEILYGKKLVDEGIISEDEMNEVIDGVQKEMRTAHDKIDK------NDKMN-
ODO1_STAHJ      HNIRKHDSVEIIYGNKLVEDGVISKEQMEDVMDKVQKEMRAAQDKIDK------SDKMD-
ODO1_STAS1      YEIRKHESVDILYGKQLVNENIISENQMNQIFDDVQNTLRAAHDKIDK------NDKMD-
ODO1_BRUME      KAIRAHKTTVQLYGEKLIAEGLVTQDDIDRMKADWRQKLEGEFEAGQSYKPN-KADWLDG
ODO1_BRUSU      KAIRAHKTTVQLYGEKLIAEGLVTQDDIDRMKADWRQKLEGEFEAGQSYKPN-KADWLDG
ODO1_LEPIC      AIIKNHPPTVKLYEKRLVEEGDIPQEDIDFIKNGSMHGLEDSFQRAKEQDVKIRVDTMQG
ODO1_LEPIN      AIIKNHPPTVKLYEKRLVEEGDIPQEDIDFIKNGSMHGLEDSFQRAKEQDVKIRVDTMQG
                  :  * ..  :: . :     :       .     . :                .  . 

ODO1_BACCZ      TIHVKVPDVVAKGIQPIDTGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALE-E
ODO1_BACHK      TIHVKVPDVVAKGIQPIDTGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALE-E
ODO1_BACAN      TIHVKVPDVVAKGIQPIDTGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALE-E
ODO1_BACC1      TIHVKVPDVVAKGIQPIDTGVELDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALE-E
ODO1_BACCR      TIHVKVPDVVAKGIQPIDTGVEIDSLRAINEGLLSWPEGFNVYPKVKKILERRKDALE-E
ODO1_ALKHC      HLPDTPPVEVVNGLPKLDTGVQSETLKAINNELLEWPESFSVNPKLEKILKRRLNVFD-G
ODO1_BACSK      KYELSPPDFIVDGLPKVKTAVEKEKLVAMNEQLLDWPSSFKPNQKLEKILKRRANAFD-G
ODO1_GEOKA      DFIMDPPKPVVDRLPEVKTSVAKDVLHRVNEELLQFPDGFNVFNKLERILKRRSGVFA-Q
ODO1_BACLD      THEIVLPEPVSNGFPDVDTSVDFETLRKINQELVSWPENFNVFDKLKRILERRAKAFE-D
ODO1_BACSU      ACEIELPEPVSNGFPDVDTSIDFDVLRKLNGELINWPESFNVFGKLKRILERRAKAFD-D
ODO1_OCEIH      EAKL-MPQVLTNGLDQFTTAIDLATLKSINEELLERPEGFKGFKKTERILQRRKDALE-E
ODO1_STAAC      NPDMEKPADLALPLQADEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKE
ODO1_STAAS      NPDMEKPADLALPLQADEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKE
ODO1_STAAW      NPDMEKPADLALPLQADEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKE
ODO1_STAAM      NPDMEKPAELALPLQADEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKE
ODO1_STAAR      NPDMEKPAELALPLQADEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKE
ODO1_STAAN      NPDMEKPAELALPLQADEQSFTFDHLKEINDALLTYPDGFNILKKLNKVLEKRHEPFNKE
ODO1_STAEQ      NPDMEKPESLQLPLQSDTKDFSFDHLKEINDAMLDYPKDFHVLKKLNKVLEKRREPFEKE
ODO1_STAES      NPDMEKPESLQLPLQSDTKDFSFDHLKEINDAMLDYPKDFHVLKKLNKVLEKRREPFEKE
ODO1_STAHJ      NPDMERPESLQEPLQSDDKDFSVDHLKEINDAMLTYPEDFHVLKKLNKVLEKRREPFESE
ODO1_STAS1      NPDMQKPDSLAEPIQTKDEEVSYEQLKEINDAMLSYPSDFNVLKKLNKVLEKRREPFESE
ODO1_BRUME      AWAGLRTADNADEQRRGKTAVPVKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMME-T
ODO1_BRUSU      AWAGLRTADNADEQRRGKTAVPVKTLKEIGKKLVEVPKDFHVHRTIQRFLDNRAKMME-T
ODO1_LEPIC      VWSKFSKDSLDSEP---ATKLLAEQMHGIVQALTSVPQGFTPNSKLVKLLQSRKEMAE-G
ODO1_LEPIN      VWSKFSKDSLDSEP---ATKLLAEQMHGIVQALTSVPQGFTPNSKLVKLLQSRKEMAE-G
                                    .    :  :   :   *..*    .  :.*. *       

ODO1_BACCZ      NGKIEWALAESLAFASILQEGTPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPN
ODO1_BACHK      NGKIEWALAESLAFASILQEGTPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPN
ODO1_BACAN      NGKIEWALAESLAFASILQEGTPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPN
ODO1_BACC1      NGKIEWALAESLAFASILQEGTPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPN
ODO1_BACCR      NGKIEWALAESLAFASILQEGTPIRLTGQDSQRGTFAHRHIVLHDTDTNETYSPLHRLPN
ODO1_ALKHC      DGKVDWALAETLAFATILHDGTPIRLTGQDSERGTFAHRHLVLHDSRTNDVHSPLQSFRH
ODO1_BACSK      EGNVDWGLAEILAFASILHDGTPVRLSGQDSERGTFAHRHFVLHDRETNETHVPLQTIKD
ODO1_GEOKA      NGKVDWAHAEILAFATILQDGVPIRLTGQDSQRGTFAQRHLVLHDVKTGEEYVPLHHISG
ODO1_BACLD      DRKVDWSLAEAMAFASILKDGTPLRLTGQDSERGTFAHRNLVLHDSKTGDEFIALHHLAD
ODO1_BACSU      DRKVEWSLAESLAFASILKDGTPIRLTGQDSERGTFAQRNLVLHDSETGKEFVPLHHLSD
ODO1_OCEIH      GNKADWGTGEALAFASILKEGTPIRLTGQDTERGTFAHRHIVLHDVETGEKYSPLHGLSD
ODO1_STAAC      DGLVDWAQAEQLAFATILQDGTPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPD
ODO1_STAAS      DGLVDWAQAEQLAFATILQDGTPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPD
ODO1_STAAW      DGLVDWAQAEQLAFATILQDGTPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPD
ODO1_STAAM      DGLVDWAQAEQLAFATILQDGTPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPD
ODO1_STAAR      DGLVDWAQAEQLAFATILQDGTPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPD
ODO1_STAAN      DGLVDWAQAEQLAFATILQDGTPIRLTGQDSERGTFSHRHAVLHDEQTGETYTPLHHVPD
ODO1_STAEQ      GGLVDWAQAEQLAFATILQDGTSIRLTGQDSERGTFSHRHAVLHDEENGNTFTPLHHVPQ
ODO1_STAES      EGLVDWAQAEQLAFATILQDGTSIRLTGQDSERGTFSHRHAVLHDEENGNTFTPLHHVPQ
ODO1_STAHJ      NGLVDWAQAEQLAFATIVQDGISVRLTGQDSERGTFSHRHAVLHDEENGDTFTPLHHVPN
ODO1_STAS1      DGLVDWAQAEQLAFATITQNGRPIRLTGQDSERGTFSHRHAVLHDPDTGAQYVPLHNVPD
ODO1_BRUME      GEGIDWATAESLAFGSLAVEAHPIRLSGQDVERGTFSQRHTVLYDQENQNRYIPLNNLQK
ODO1_BRUSU      GEGIDWATAESLAFGSLAVEGHPIRLSGQDVERGTFSQRHTVLYDQENQNRYIPLNNLQK
ODO1_LEPIC      KIPVDWGFAEALSFGSILESGFRIRLSGQDSQRGTFSHRHAVLVDTNTNEKYIPLNHISS
ODO1_LEPIN      KIPVDWGFAEALSFGSILESGFRIRLSGQDSQRGTFSHRHAVLVDTNTNEKYIPLNHISS
                    :*. .* ::*.::  ..  :**:*** :****::*: ** *  .   . .*: .  

ODO1_BACCZ      INASFSVHNSPLSEAAVVGYEYGYNVFAPETLVMWEAQYGDFSNTAQALFDQYVSAGRAK
ODO1_BACHK      INASFSVHNSPLSEAAVVGYEYGYNVFAPETLVMWEAQYGDFSNTAQALFDQYVSAGRAK
ODO1_BACAN      INASFSVHNSPLSEAAVVGYEYGYNVFAPETLVMWEAQYGDFSNTAQALFDQYVSAGRAK
ODO1_BACC1      INASFSVHNSPLSEAAVVGYEYGYNVFAPETLVMWEAQYGDFSNTAQALFDQYVSAGRAK
ODO1_BACCR      INASFSVHNSPLSEAAVVGYEYGYNVFAPETLVMWEAQYGDFSNTAQALFDQYVSAGRAK
ODO1_ALKHC      ANASFAVHNSPLSEMAIVGFEYGYNVFAPETLVLWEAQFGDFANGAQVMFDQWVSAGRAK
ODO1_BACSK      ANASFAVYNSPLTEQACVGFEYGYNVFSKETLVLWEAQFGDFVNGAQVMFDQWVSAGRAK
ODO1_GEOKA      AKASFVVYNSPLTEAAVLGYEYGYNVYAPETLVLWEAQFGDFANMAQVMFDQFISSGRAK
ODO1_BACLD      TKASFAVHNSPLSEGSVLGFEYGYNVSSPETMVIWEAQFGDFANAAQVYFDQFISAGRAK
ODO1_BACSU      CSTSFAVHNSPLSEGSVLGFEYGYNVHSPETLVLWEAQYGDFANAAQVYFDQFISAGRAK
ODO1_OCEIH      VEASFDVRNSPLSEAGVLGFEYGYSVQSPDTLVIWEAQFGDFANAGQVIFDQFISSARAK
ODO1_STAAC      QKATFDIHNSPLSEAAVVGFEYGYNVENKKSFNIWEAQYGDFANMSQMIFDNFLFSSRSK
ODO1_STAAS      QKATFDIHNSPLSEAAVVGFEYGYNVENKKSFNIWEAQYGDFANMSQMIFDNFLFSSRSK
ODO1_STAAW      QKATFDIHNSPLSEAAVVGFEYGYNVENKKSFNIWEAQYGDFANMSQMIFDNFLFSSRSK
ODO1_STAAM      QKATFDIHNSPLSEAAVVGFEYGYNVENKKSFNIWEAQYGDFANMSQMIFDNFLFSSRSK
ODO1_STAAR      QKATFDIHNSPLSEAAVVGFEYGYNVENKKSFNIWEAQYGDFANMSQMIFDNFLFSSRSK
ODO1_STAAN      QKATFDIHNSPLSEAAVVGFEYGYNVENKKSFNIWEAQYGDFANMSQMIFDNFLFSSRSK
ODO1_STAEQ      QQATFDIHNSPLSEAAVVGFEYGYNVENKGNFNIWEAQYGDFSNMSQMMFDNFLSSSRAK
ODO1_STAES      QQATFDIHNSPLSEAAVVGFEYGYNVENKGNFNIWEAQYGDFSNMSQMMFDNFLSSSRAK
ODO1_STAHJ      QKATFEVHNSPLSEAAVVGFEYGYNVENKNSMNIWEAQYGDFSNMAQMMFDNFMSSARAK
ODO1_STAS1      QKATFEVRNSPLSEAAVVGFEYGYNIQNKSCMTIWEAQYGDFSNMAQMIFDNFLFSSRAK
ODO1_BRUME      GQAIYEAINSMLSEEAVLGYEYGYSLSDPRALVLWEAQFGDFANGAQVVFDQFISSGERK
ODO1_BRUSU      GQAIYEAINSMLSEEAVLGYEYGYSLSDPRALVLWEAQFGDFANGAQVVFDQFISSGERK
ODO1_LEPIC      KQAKAEIINSSLSEFSVLGFEYGYSLSDPNALVMWEAQFGDFANSAQVIFDQFISSSEVK
ODO1_LEPIN      KQAKAEIINSSLSEFSVLGFEYGYSLSDPNALVMWEAQFGDFANSAQVIFDQFISSSEVK
                 .:     ** *:* . :*:****.:     : :****:*** * .*  **::: :.. *

ODO1_BACCZ      WGQKSGLVLLLPHGYEGQGPEHSSARPERFLQLAAENNWTVANLTSAAQYFHILRRQASI
ODO1_BACHK      WGQKSGLVLLLPHGYEGQGPEHSSARPERFLQLAAENNWTVANLTSAAQYFHILRRQASI
ODO1_BACAN      WGQKSGLVLLLPHGYEGQGPEHSSARPERFLQLAAENNWTVANLTSAAQYFHILRRQASI
ODO1_BACC1      WGQKSGLVLLLPHGYEGQGPEHSSARPERFLQLAAENNWTVANLTSAAQYFHILRRQASV
ODO1_BACCR      WGQKSGLVLLLPHGYEGQGPEHSSARPERFLQLAAENNWTVANLTSAAQYFHILRRQASI
ODO1_ALKHC      WGQKSGLVCLLPHGYEGQGPEHSSARLERFLVLAAENNWTIANCTSAAQYFHILRRQAAI
ODO1_BACSK      WGQKSGLVVLLPHGYEGAGPEHSSGRVERFLSSAAENNWTVANCTSAAQYFHILRRQAKI
ODO1_GEOKA      WGQKSGLVMLLPHGYEGQGPEHSSGRVERFLQLAAENNWTVANLSTAAQYFHILRRQAAL
ODO1_BACLD      WGQKSGLVVLLPHGYEGQGPEHSSGRTERFLQLAAENNWTVANLTSAAQYFHILRRQAKM
ODO1_BACSU      WGQKSGLVMLLPHGYEGQGPEHSSGRIERFLQLAAENNWTVANLTSAAQYFHILRRQAKM
ODO1_OCEIH      WGEKSNMVLLLPHGYEGQGPEHSSARLERFLQMAAENNWIVANVTSSAQLFHILRRQAAM
ODO1_STAAC      WGERSGLTLFLPHAYEGQGPEHSSARLERFLQLAAENNCTVVNLSSSSNYFHLLRAQAAS
ODO1_STAAS      WGERSGLTLFLPHAYEGQGPEHSSARLERFLQLAAENNCTVVNLSSSSNYFHLLRAQAAS
ODO1_STAAW      WGERSGLTLFLPHAYEGQGPEHSSARLERFLQLAAENNCTVVNLSSSSNYFHLLRAQAAS
ODO1_STAAM      WGERSGLTLFLPHAYEGQGPEHSSARLERFLQLAAENNCTVVNLSSSSNYFHLLRAQAAS
ODO1_STAAR      WGERSGLTLFLPHAYEGQGPEHSSARLERFLQLAAENNCTVVNLSSSSNYFHLLRAQAAS
ODO1_STAAN      WGERSGLTLFLPHAYEGQGPEHSSARLERFLQLAAENNCTVVNLSSSSNYFHLLRAQAAS
ODO1_STAEQ      WGERSGLTLFLPHAFEGQGPEHSSARLERFLQLAAENNSTVVNLSSASNYFHLLRAQAAS
ODO1_STAES      WGERSGLTLFLPHAFEGQGPEHSSARLERFLQLAAENNSTVVNLSSASNYFHLLRAQAAS
ODO1_STAHJ      WGERSGLTLFLPHAFEGQGPEHSSARLERFLQLAAENNSTVVNLSSSSNYFHLLRAQAKS
ODO1_STAS1      WGERSGLTLFLPHSFEGQGPEHSSARLERFLQLAGENNSTIVNLSSSSNYFHLLRAQAAN
ODO1_BRUME      WLRMSGLVCLLPHGFEGQGPEHSSARLERYLQLCAEDNMQVANVTTPANYFHILRRQ---
ODO1_BRUSU      WLRMSGLVCLLPHGFEGQGPEHSSARLERYLQLCAEDNMQVANVTTPANYFHILRRQ---
ODO1_LEPIC      WQRLSGLIMLLPHGYEGQGPEHSSARLERFLQLCALDNMQVCNLTTAAQYFHLLRRQ---
ODO1_LEPIN      WQRLSGLIMLLPHGYEGQGPEHSSARLERFLQLCALDNMQVCNLTTAAQYFHLLRRQ---
                * . *.:  :***.:** ******.* **:*  .. :*  : * ::.:: **:** *   

ODO1_BACCZ      LGTEAVRPLVLMTPKS-LLRHPLTLSTASQLS-EGRFQPALEQENLGTKPN--------K
ODO1_BACHK      LGTEAVRPLVLMTPKS-LLRHPLTLSTASQLS-EGRFQPALEQENLGTKPN--------K
ODO1_BACAN      LGTEAVRPLVLMTPKS-LLRHPLTLSTANQLS-EGRFQPALEQENLGTKPN--------K
ODO1_BACC1      LGTEAVRPLVLMTPKS-LLRHPLTLSTASQLS-EGRFQPALEQENLGTKPN--------K
ODO1_BACCR      LGTEAVRPLVLMTPKS-LLRHPLTLSTASQLS-EGRFQPALEQENLGMKPN--------K
ODO1_ALKHC      LNTDSVRPLIMMTPKS-LLRNQKVASSVEELT-TGRFKTVLEQPNLGESHE--------K
ODO1_BACSK      LQKNTVRPLIIMTPKS-LLRNQVVASPTSAFT-EGEFQPILEEPTLGHDPN--------A
ODO1_GEOKA      LTREEVRPLIIMTPKS-LLRHPLAASDAEVFV-DGAFSPVLEQPGLGADAG--------K
ODO1_BACLD      LLREEIRPLIIMTPKS-LLRNPNTVSEVQELS-NSSFKPVYEMSGLSHQYD--------K
ODO1_BACSU      LLREEIRPLVIMTPKS-LLRNPNTVSEVQELS-ESRFQPVYEQSGLSHDYE--------K
ODO1_OCEIH      RDRDEARPLVLMTPKSSLIRHPRMGATAEEFT-DGGFLALRDQPGFEANRE--------K
ODO1_STAAC      LDSEQMRPLVVMSPKS-LLRNKTVAKPIDEFT-SGGFEPILTE---SYQAD--------K
ODO1_STAAS      LDSEQMRPLVVMSPKS-LLRNKTVAKPIDEFT-SGGFEPILTE---SYQAD--------K
ODO1_STAAW      LDSEQMRPLVVMSPKS-LLRNKTVAKPIDEFT-SGGFEPILTE---SYQAD--------K
ODO1_STAAM      LDSEQMRPLVVMSPKS-LLRNKTVAKPIDEFT-SGGFEPILTE---SYQAD--------K
ODO1_STAAR      LDSEQMRPLVVMSPKS-LLRNKTVAKPIDEFT-SGGFEPILTE---SYQAD--------K
ODO1_STAAN      LDSEQMRPLVVMSPKS-LLRNKTVAKPIDEFT-SGGFEPILTE---SYQAD--------K
ODO1_STAEQ      LDTLEMRPLIVMSPKS-LLRNKTVAKPIDEFT-SGGFKPIITE---DIDEQ--------K
ODO1_STAES      LDTLEMRPLIVMSPKS-LLRNKTVAKPIDEFT-SGGFKPIITE---DIDEQ--------K
ODO1_STAHJ      LGTEAMRPLIVMSPKS-LLRNKTVAKPIDQFT-SGGFKPIIVE---DGNKE--------K
ODO1_STAS1      LGTQSMRPLVVMSPKS-LLRNKTVADPISKFT-SGKFEPILPE---AHDKA--------S
ODO1_BRUME      MKRDFRKPLIMMTPKS-LLRHKRAISTLAELSGESSFHRLLWDDAQYNKDEGIKLQKDAK
ODO1_BRUSU      MKRDFRKPLIMMTPKS-LLRHKRAISTLAELSGESSFHRLLWDDAQYNKDEGIKLQKDAK
ODO1_LEPIC      MLRNYRKPLVIVTPKS-LLRFPASLSPVEDIL-QGAFREILIDDSGSKPD---------K
ODO1_LEPIN      MLRNYRKPLVIVTPKS-LLRFPASLSPVEDIL-QGAFREILIDDSGSKPD---------K
                      :**::::*** *:*          :   . *                       

ODO1_BACCZ      VKRLVLSTGKMAIDLAAEIESGKHEYNLDEIHIVRIEQLYPFPAEKVQSIIKRFKNLEEI
ODO1_BACHK      VKRLVLSTGKMAIDLAAEIESGKHEYNLDEIHIVRIEQLYPFPAEKVQSIIKRFKNLEEI
ODO1_BACAN      VKRLVLSTGKMAIDLAAEIESGRHEYNLDEIHIVRIEQLYPFPAEKVQSIIKRFKNLEEI
ODO1_BACC1      VKRLVLSTGKMAIDLAAEIESGKHEYNLDEIHIVRIEQLYPFPAEKVQSIIKRFKNLEEI
ODO1_BACCR      VKRLVLSTGKMAIDLAAEIESGKHEYNLDEVHVVRIEQLYPFPAEKVQSIIKRFKNLEEI
ODO1_ALKHC      VERIVLCSGKIAIDLQDRIEKEA-DKDWDWVHIVRVEQLYPFPKEPLQEIFARYPNVKEI
ODO1_BACSK      VKRIILCSGKLAIELQDYVNKN--DEDWSWVHIIRVEELYPFPRRAIRERLKEFPNLEEV
ODO1_GEOKA      VERIVFGTGKLMIDLAEQIGKM---ESLDWLHIVRIEELYPFPEEAVKDIIARYPNVKEL
ODO1_BACLD      VTRLVLSSGKVSIDISDHFNKM--EGEKDWLHIARVEELYPFPAKHIKAIFSKLPNLEEI
ODO1_BACSU      VTRLVLSSGKVSIDISDHFNKL--EDGKEWLHIARIEQLYPFPAKGVKELFAKLPNLKEI
ODO1_OCEIH      VTRLVVGSGKMMIDIEEAMDDS--DETYDWLQIKRVEQIYPFPKKALEEEIKQLPNLKEI
ODO1_STAAC      VTKVILATGKMFIDLKEALAKN----PDESVLLVAIERLYPFPEEEIEALLAQLPNLEEV
ODO1_STAAS      VTKVILATGKMFIDLKEALAKN----PDESVLLVAIERLYPFPEEEIEALLAQLPNLEEV
ODO1_STAAW      VTKVILATGKMFIDLKEALAKN----PDESVLLVAIERLYPFPEEEIEALLAQLPNLEEV
ODO1_STAAM      VTKVILATGKMFIDLKEALAKN----PDESVLLVAIERLYPFPEEEIEALLAQLPNLEEV
ODO1_STAAR      VTKVILATGKMFIDLKEALAKN----PDESVLLVAIERLYPFPEEEIEALLAQLPNLEEV
ODO1_STAAN      VTKVILATGKMFIDLKEALAKN----PDESVLLVAIERLYPFPEEEIEALLAQLPKLEEV
ODO1_STAEQ      VKKVILASGKMYIDLKEYLAKN----PNDSILLIAVERLYPFPEEEIKEVLKSLPHLENV
ODO1_STAES      VKKVILASGKMYIDLKEYLAKN----PNDSILLIAVERLYPFPEEEIKEVLKSLPHLENV
ODO1_STAHJ      VTKLVLASGKMFIDLKEHLAKN----PDDSILLVAVDRLYPFPEGEIKEVLNELPNLETV
ODO1_STAS1      VKKVILASGKMFIDLKEYLTKN----PNKSILLVAVERLYPFPADEIDALLSELPNLEHV
ODO1_BRUME      IRRVVLCSGKVYYDLYEEREKR----GIDDVYLLRVEQLYPFPAKALINELSRFRHA-EM
ODO1_BRUSU      IRRVVLCSGKVYYDLYEEREKR----GIDDVYLLRVEQLYPFPAKALINELSRFRHA-EM
ODO1_LEPIC      IEKVVFSAGKVYYDLMKYKDEN----KIKNVALVRVEQIYPFPAKEIQSSLKTFKNAKQF
ODO1_LEPIN      IEKVVFSAGKVYYDLMKYKDEN----KIKNVALVRVEQIYPFPAKEIQSSLKTFKNAKQF
                : :::. :**:  ::     .       . : :  ::.:****   :   :    :   .

ODO1_BACCZ      IWVQEEPRNMGAWHYMAPILFELAG----DKVKTGYIGRPDRSSPSGGDPFAHKAEQELI
ODO1_BACHK      IWVQEEPRNMGAWHYMAPILFELAG----DKVKTGYIGRPDRSSPSGGDPFAHKAEQELI
ODO1_BACAN      IWVQEEPRNMGAWHYMAPILFELAG----DKVKTGYIGRPDRSSPSGGDPFAHKAEQELI
ODO1_BACC1      IWVQEEPRNMGAWHYMAPILFELAG----DKVKTGYIGRPDRSSPSGGDPFAHKAEQELI
ODO1_BACCR      IWVQEEPRNMGAWHYMAPILFELAG----DKVKTGYIGRPDRSSPSGGDPFAHKAEQELI
ODO1_ALKHC      VWSQEEPRNMGAWPFVQSKIRRAAP----NGINVRYEGRTYRSSPAEGDPIIHKQEQERI
ODO1_BACSK      KWVQEEPKNMGAWTFMEPRIREILP----SGVPLSYIGRTYRSSPAEGVSNAHKVEQKRI
ODO1_GEOKA      VWVQEEPKNMGAWLYMEPRLRALAP----EGVDVSYIGRRRRASPAEGDPVVHRKEQERI
ODO1_BACLD      VWVQEEPQNMGAWNYIEPYLREVAP----KDVKVRYIGRRRRSSPAEGDPTVHKKEQERI
ODO1_BACSU      VWVQEEPQNMGAWGYISPYLTEIAP----EGVSVQYIGRRRRSSPAEGDPTVHKKEQERI
ODO1_OCEIH      VWVQEEPKNMGAWNFVDDYLRELLN----EDQKLKVISRPDRSAPAGGIPTVHKTAQNKI
ODO1_STAAC      SWVQEEPKNQGAWLYVYPYVKVLVA----DKYDLSYHGRIQRAAPAEGDGEIHKLVQNKI
ODO1_STAAS      SWVQEEPKNQGAWLYVYPYVKVLVA----DKYDLSYHGRIQRAAPAEGDGEIHKLVQNKI
ODO1_STAAW      SWVQEEPKNQGAWLYVYPYVKVLVA----DKYDLSYHGRIQRAAPAEGDGEIHKLVQNKI
ODO1_STAAM      SWVQEEPKNQGAWLYVYPYVKVLVA----DKYDLSYHGRIQRAAPAEGDGEIHKLVQNKI
ODO1_STAAR      SWVQEEPKNQGAWLYVYPYVKVLVA----DKYDLSYHGRIQRAAPAEGDGEIHKLVQNKI
ODO1_STAAN      SWVQEEPKNQGAWLYVYPYVKVLVA----DKYDLSYHGRIQRAAPAEGDGEIHKLVQNKI
ODO1_STAEQ      SWVQEEPKNQGAWLFVYPYLKALVA----NKYDLTYHGRIQRAAPAEGDGEIHKLVQTKI
ODO1_STAES      SWVQEEPKNQGAWLFVYPYLKALVA----NKYDLTYHGRIQRAAPAEGDGEIHKLVQTKI
ODO1_STAHJ      SWVQEEPKNQGAWLFVYPYLKSLVG----NQFNLSYHGRIQRAAPAEGDGEIHKLVQNQI
ODO1_STAS1      AWVQEEPKNQGAWSFVYPYLKELTT----DKYDLSYHGRIQRSAPAEGDGEIHKLVQNMI
ODO1_BRUME      VWCQEEPKNMGAWSFIDPYLEWVLAHIDAKHQRVRYAGRPAAASPATGLMSKHLAQLAAF
ODO1_BRUSU      VWCQEEPKNMGAWSFIDPYLEWVLAHIDAKHQRVRYAGRPAAASPATGLMSKHLAQLAAF
ODO1_LEPIC      VWCQEEPKNQGAWFFVRERIEELLP----GNARLVYAGRHESPSPAAGHMKLHLQEQDQL
ODO1_LEPIN      VWCQEEPKNQGAWFFVRERIEELLP----GNARLVYAGRHESPSPAAGHMKLHLQEQDQL
                 * ****:* *** ::   :                 .*   .:*: *    *      :

ODO1_BACCZ      VAHALDVKYNFRQDKLEIEVFSN
ODO1_BACHK      VAHALDVKYNFRQDKLEIEVFSN
ODO1_BACAN      VSHALDVKYNFRQDKLEIEVFSN
ODO1_BACC1      VAHALDVKYNFRQDKLEIEVFSN
ODO1_BACCR      VAHALDVKYNFRQDKQEIEVYSN
ODO1_ALKHC      VTETLTR----------------
ODO1_BACSK      VTESLTRKN--------------
ODO1_GEOKA      IRCALTKHE--------------
ODO1_BACLD      VSDSLTRKN--------------
ODO1_BACSU      VSDSLTRKN--------------
ODO1_OCEIH      IKQALNQSEGGKSSAGN------
ODO1_STAAC      IENALKNN---------------
ODO1_STAAS      IENALKNN---------------
ODO1_STAAW      IENALKNN---------------
ODO1_STAAM      IENALKNN---------------
ODO1_STAAR      IENALKNN---------------
ODO1_STAAN      IENALKNN---------------
ODO1_STAEQ      IESSINN----------------
ODO1_STAES      IESSINN----------------
ODO1_STAHJ      IESSIEK----------------
ODO1_STAS1      IEQSTNIN---------------
ODO1_BRUME      LEDALG-----------------
ODO1_BRUSU      LEDALG-----------------
ODO1_LEPIC      VLDAFQA----------------
ODO1_LEPIN      VLDAFQA----------------
                :  :