CLUSTAL format seed alignment for MF_01172

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ASTB_SHIBS       --MNAWEVNFDGLVGLTHHYAGLSFGNEASTRHRFQVSNPRLAAKQGLLKMKTLADAGFP
ASTB_SHISS       --MNAWEVNFDGLVGLTHHYAGLSFGNEASTRHRFQVSNPRLAAKQGLLKMKTLADAGFP
ASTB_ECOLI       --MNAWEVNFDGLVGLTHHYAGLSFGNEASTRHRFQVSNPRLAAKQGLLKMKALADAGFP
ASTB_ECO57       --MNAWEVNFDGLVGLTHHYAGLSFGNKASTRHRFQVSNPRLAAKQGLLKMKTLADAGFP
ASTB_SHIDS       -MRNAWEVNFDGLVGLTHNYAGLLFGNEASTRHRFQVSNPRLAAKQGLLKMKNLADAGFP
ASTB_ECOL6       --MNAWEVNFDGLVGLTHHYAGLSFGNEASTRHRFQVSNPRLAAKQGLLKMKKLAGAGFP
ASTB_ECOUT       --MNAWEVNFDGLVGLTHHYAGLSFGNEASTRHRFQVSNPRLAAKQGLLKMKKLADAGFP
ASTB_ECOL5       --MNAWEVNFDGLVGLTHHYAGLSFGNEASTRHCFQVSNPRLAAKQGLLKMKTLADAGFP
ASTB_SALPA       --MTAHEVNFDGLVGLTHHYAGLSFGNEASTRHRFQVSNPRLAVKQGLLKMKALADAGFP
ASTB_SALTI       --MTAHEVNFDGLVGLTHHYAGLSFGNEASTRHRFQVSNPRLAVKQGLLKMKALADAGFP
ASTB_SALTY       --MTAHEVNFDGLVGLTHHYAGLSFGNEASTRHRFQVSNPRLAVKQGLLKMKALADAGFP
ASTB_YERPA       --MAGYEVNFDGLVGLTHHYAGLSFGNEASTTHQNRTSNPRLAAKQGLLKMKALADLGYK
ASTB_YERPE       --MAGYEVNFDGLVGLTHHYAGLSFGNEASTTHQNRTSNPRLAAKQGLLKMKALADLGYK
ASTB_YERPS       --MAGYEVNFDGLVGLTHHYAGLSFGNEASTTHQNRTSNPRLAAKQGLLKMKALADLGYK
ASTB_ACIAD       --MSGYEINFDGLVGPTHHYAGLSFGNEASTKNRNHLSNPKLAAKQGLLKMKALADMGMK
ASTB_PHOLL       --MAGFEANFDGLVGMTHHYAGLSVGNKASINNKDSVSNPRKAALQGLMKMKALADEGFI
ASTB_BURCA       --MNAQEANFDGLVGPTHNYAGLSFGNVASLNNEKSAANPKAAAKQGLRKMKQLADLGFA
ASTB_BURL3       --MNAQEANFDGLVGPTHNYAGLSFGNVASLNNEKSAANPKAAAKQGLRKMKQLADLGFA
ASTB_BURP1       --MNAKEANFDGLVGPTHNYAGLSFGNVASLSNEKSDANPKAAAKQGLRKMKQLADLGFA
ASTB_BURPS       --MNAKEANFDGLVGPTHNYAGLSFGNVASLSNEKSDANPKAAAKQGLRKMKQLADLGFA
ASTB_BURMA       --MNAKEANFDGLVGPTHNYAGLSFGNVASLSNEKSDANPKAAAKQGLRKMKQLADLGFA
ASTB_BURTA       --MNAKEANFDGLVGPTHNYAGLSFGNVASLSNEKSDANPKAAAKQGLRKMKQLADLGFA
ASTB_PARXL       --MQATEANFDGLVGPTHNYAGLSFGNVASQNNEKSVANPKAAAKQGLRKMKQLADLGFH
ASTB_PSE14       --MKSCEVNFDGLVGPTHNYGGLSYGNVASQSNSQQCANPREAALQGLAKMKALMDLGFT
ASTB_PSEU2       --MKSCEVNFDGLVGPTHNYGGLSYGNVASQSNSQQSANPREAALQGLAKMKALMDLGFT
ASTB_PSESM       --MKSCEVNFDGLVGPTHNYGGLSYGNVASQSNSQQCSNPREAALQGLAKMKALMDMGFT
ASTB_PSEF5       --MKSYEVNFDGLVGPTHNYGGLSYGNVASQSNSQQGSNPREAALQGLAKMKALMEMGFQ
ASTB_PSEPF       --MKSYEVNFDGLVGPTHNYGGLSYGNVASQSNSQQSSNPKEAALQGLAKMKALMEMGFQ
ASTB_PSEPK       --MKSYEVNFDGLVGPTHNYGGLSYGNVASQSNSQQASNPREAARQGLAKMKALADMGFK
ASTB_PSEAE       --MNAHEVNFDGLVGPTHNYGGLSYGNVASQSNSQAVSNPKEAAKQGLAKMKALMEMGFK
ASTB_CHRVO       --MNAYEVNFDGLVGPTHNYSGLSFGNVASTSNVSAASNPKLAAKQGLQKMKALYDLGFK
ASTB_HAHCH       --MKAFEVNFDGLVGPTHNYSGLSYGNVASETNIRDVSNPKEAAKQGLRKMKALHDMGFK
ASTB_IDILO       --MQHFEVNYDGLVGPTHNYAGLSFGNVASLANAKATSSPKHAALQGLKKMKALHDMGMK
ASTB_PSEA6       --MKQFEVNFDGLVGPTHNYAGLSYGNVASLNNASAQSSPKQAAKQGLKKMKALADLGMI
ASTB_SHEDO       --MKHFEANFDGLVGPTHNYAGLSFGNVASYSNAAQTANPKAAAKQGLQKAKALADLGMT
ASTB_SHEFN       --MKHFEANFDGLVGPTHNYAGLSFGNVASFSNAAQTSNPKAAAKQGLQKAKSLADLGMV
ASTB_SHEON       --MKHFEANFDGLVGPTHNYAGLSFGNVASLNNAALVSNPKAAAKQGLQKAKALADLGMI
ASTB_PHOPR       --MKAREANFDGLVGPTHNYSGLSFGNVASEKNQANQSNPKQAAKQGLAKMKALADMGLV
ASTB_ALIF1       --MKTVESNFDGLVGPTHNYSGLSVGNIASKSNQSGVSNPKQAVKQGLEKMKALHDMGFV
ASTB_PSET1       --MPALEVNFDGLVGPTHNYAGLSYGNVASLNNAASFSNPQEAVLQGLEKMKAMHDKGLT
ASTB_LEGPH       --MNVYELNMDGLVGQTHHYAGLSSGNIASTNNALSISNPQAAARQGLEKMRQLYNMGLK
ASTB_LEGPL       --MNVYELNMDGLVGQTHHYAGLSSGNIASTNNALSISNPQAAARQGLEKMRRLYNMGLK
ASTB_LEGPA       --MNAYELNMDGLVGQTHHYAGLSSGNIASTNNALSISNPQAAARQGLEKMRQLYNMGLK
ASTB_CHRSD       MSQDVREVNFDGLVGPTHNYAGLAHGNVASMRHGGLTANPREAALQGLAKMKSLMEAGFA
ASTB_MYXXD       ----MREYNFDGLVGPTHNYGGLSPGNLASQSHVGEPSHPRDAALQGLEKMRFVSALGVG
ASTB_NITMU       --MNAYEANFDGLVGPTHNYGGLAVGNIASAESALTNSNPREAALQGLEKMKRLADLGLM
ASTB2_CAUVC      -MISAFEANCDGLVGPTHSYVGLSPGNLASTRNAGEVSNPRGAALEGLAKMRRLADLGLP
ASTB1_CAUVC      ---MTLEINFDGLIGPTHNYAGLSLGNIASHSNAGAVSSPRAAALQGLTKMRTLLDLGLT
ASTB_ZYMMO       --MIVSEVNFDGLIGPTHNYAGLSRGNVASALHAGQPSYPRQAALQGLEKMKHLMDMGLT
ASTB_NOVAD       --MPLVEINFDGLVGPSHNYAGLSLGNLASASNAGEVSYPRAAALQGLGKMRHNLALGLT
ASTB_SPHAL       ---MLTEINFDGIIGPTHNYAGLSRGNIASASHAGDVSQPRAAALQGIDKMRHNLVLGLP
                       * * **::* :* * **  ** **       : *: *. :*: * :     *  

ASTB_SHIBS       QAVIPPHERPFIPVLRQLGFSGSDEQVLEKVARQAPHWLSSVSSASPMWVANAATIAPSA
ASTB_SHISS       QAVIPPHERPFIPVLRQLGFSGSDEQVLEKVARQAPHWLSSVSSASPMWVANAATIAPSA
ASTB_ECOLI       QAVIPPHERPFIPVLRQLGFSGSDEQVLEKVARQAPHWLSSVSSASPMWVANAATIAPSA
ASTB_ECO57       QAVIPPHERPFIPVLRQLGFSGSDEQVLEKVVRQAPHWLSSVSSASPMWVANAATIAPSA
ASTB_SHIDS       QAVIPPHERPFIPVLRQLGFSGSDEQVLEKVARQAPHWLSSVSSASPMWVANAATIAPSV
ASTB_ECOL6       QAVIPPHERPFIPVLRQLGFSGSDEQVLEKVARQAPHWLSSVSSASPMWVANAATIAPSA
ASTB_ECOUT       QAVIPPHERPFIPVLRQLGFRGSDEQVLEKVARQAPHWLSSVSSASPMWVANAATIAPSA
ASTB_ECOL5       QAVIPPHERPFIPVLRQLGFSGSDEQVLEKVARQAPHWLSSASSASPMWVANAATIAPSA
ASTB_SALPA       QAVIPPHERPFIPALRQLGFTGSDEQILDKVARQAPRWLSSVSSASPMWVANAATVCPSA
ASTB_SALTI       QAVIPPHERPFIPALRQLGFTGSDEQILDKVARQAPRWLSSVSSASPMWVANAATVCPSA
ASTB_SALTY       QAVIPPHERPFIPALRQLGFTGSDEQILDKVARQAPRWLSSVSSASPMWVANAATVCPSA
ASTB_YERPA       QGVLPPQERPAIGVLRKLGFSGSDEQVLSDVARNAPRLLSAVSSASSMWTANAATVSPSA
ASTB_YERPE       QGVLPPQERPAIGVLRKLGFSGSDEQVLSDVARNAPRLLSAVSSASSMWTANAATVSPSA
ASTB_YERPS       QGVLPPQERPAIGVLRKLGFSGSDEQVLSDVARNAPRLLSAVSSASSMWTANAATVSPSA
ASTB_ACIAD       QGVLAPQERPHVPSLRKLGFGGDDHAVITQAMRTSPELLSALSSASCMWTANAATVSPSA
ASTB_PHOLL       QGVLPPQQRPHIPALRNLGFVGSDEQILHKAAKYSPVLLSKLSSASSMWTANAATVSPSA
ASTB_BURCA       QGVLPPQERPSLRLLRELGFSGKDADVIAKAAKQAPELLAAASSASAMWTANAATVSPSA
ASTB_BURL3       QGVLPPQERPSLRLLRELGFSGKDADVIAKAAKQAPELLAAASSASAMWTANAATVSPSA
ASTB_BURP1       QGVLPPQERPSLRLLRELGFSGKDADVIAKAARQAPELLAAASSASAMWTANAATVSPSA
ASTB_BURPS       QGVLPPQERPSLRLLRELGFSGKDADVIAKAARQAPELLAAASSASAMWTANAATVSPSA
ASTB_BURMA       QGVLPPQERPSLRLLRELGFSGKDADVIAKAARQAPELLAAASSASAMWTANAATVSPSA
ASTB_BURTA       QGVLPPQERPSLRLLRELGFSGKDADVIAKAAKQAPEMLAAASSASAMWTANAATVSPSA
ASTB_PARXL       QGVLPPQERPSMRLLRELGFSGDDATVIARVARDAPELLAAASSASAMWTANAATVSPSA
ASTB_PSE14       QGVLAPQERPDVAGLRQLGFIGSDEQVIEKAARQDMPLLVASCSASSMWVANAATVSPSA
ASTB_PSEU2       QGVLAPQERPDVSGLRRLGFTGSDEQVIEKAARQDMPLLVASCSASSMWVANAATVSPSA
ASTB_PSESM       QGVLAPQERPDVASLRQLGFTGSDEQVIEKAARQDMPLLVASCSASSMWVANAATVSPSA
ASTB_PSEF5       QGVLAPQERPDVAALRNLGFAGTDAQVIQQAAKQAMPLLVASCSASSMWVANAATVSPSA
ASTB_PSEPF       QGVLAPQERPDVAALRRLGFSGTDAQVIERAAKEAMPLLVASCSASSMWVANAATVSPSA
ASTB_PSEPK       QGVLAPQERPDVAALRRLGFSGSDAEVIQRAAREAMPLLVASCSASSMWVANAATVSPSA
ASTB_PSEAE       QGVLAPQARPDTAALRSLGFSGSDEEVIRRAAKEAMPLLAACSSASSMWTANAATVSPSA
ASTB_CHRVO       QGVLAPQERPDVASLRRLGFGGSDAEVIARAAKEAPTILAAATSASCMWTANAATVSPSA
ASTB_HAHCH       QGVLLPQERPDIATLRRLGFTGSDREVLLQAAHQAPVFLGAVASASCMWTANAATVSPSA
ASTB_IDILO       QGVLAPQERPDIFALRRLGFHGTDSEVLYRAATEAPAIFQAVCSASSMWTANAATVSPSA
ASTB_PSEA6       QGVLAPQARPDVDALRRLGFSGSDANVLQQAAKQAPAIFQACCSASSMWTANAATVSPSA
ASTB_SHEDO       QGVLAPQERPDLYTLRRIGFSGSDAEVIQKAAKQAPALLNACCSASSMWTANAATVSPSA
ASTB_SHEFN       QGVLAPQERPDLYTLRRIGFSGSDAEVLQKAAQQAPALLNACCSASSMWTANAATVSPSA
ASTB_SHEON       QGMLAPQERPDLNTLRRIGFSGSDAQVLQQAAKTAPALLNACCSASSMWTANAATVSPSA
ASTB_PHOPR       QGILAPQERPDVHTLRRLGFMGSDANVIEQAAKQAPKVLAACCSASSMWTANAATVSPSA
ASTB_ALIF1       QGVLAPQERPDIHTLRRLGFSGSDSEVLKKSYQYSPQLLAACSSASSMWTANAGTVSPSA
ASTB_PSET1       QGVFAPHARPDLNILRRLGFSGNDAQIINKAFNADPILLRACYSASAMWTANAATVSPSP
ASTB_LEGPH       QGLLPPHQRPNLNLLYQLGFKGTPSEQINKAYKTAPELLSACYSASSMWTANAATVSASV
ASTB_LEGPL       QGLLPPHQRPNLNLLYQLGFKGTPSEQINKAYKTAPELLSACYSASCMWTANAATVSASV
ASTB_LEGPA       QGLLPPHQRPNLNLLYQLGFKGSPSEQINKAYKTAPELLSACYSASSMWTANAATVSASV
ASTB_CHRSD       QGVLPPQQRPDLGALRDLGFTGDDAGVLAQAARQAPQLLRAVCSASSMWTANAATVTPSL
ASTB_MYXXD       QAVLPPQPRPSLHALRALGFTGSDEEVITRAAREAEHLLRLTSSASSMWTANAATVAPSA
ASTB_NITMU       QGVLPPQERPAVSVLRKLGFTGEDATIIRCAAKVAPGLLRACSSASSMWVANAATVSPSA
ASTB2_CAUVC      QFVLPPHERPAVSLLRQLGFSGPDEIVLTSAWRDAPALAAAACSASPMWAANAATVTPSA
ASTB1_CAUVC      QGFLPPPPRPAAHVLRRLGFKGSDQAVLAQVADEDLDLLRAASSASSMWTANAATVLAAP
ASTB_ZYMMO       QGVFLPPLRPVTHLLHHLGYKGDDKTILKQAAKDDRLLFNNLCSASSMWAANAATVISEF
ASTB_NOVAD       QGLFAPLPRPNPVFLGALGLNA-----IDEVDQAQRRLRAAAWSASSMWTANAATVSPAP
ASTB_SPHAL       QGFFVPLDRPDAPWLAALG---------TSVEKAEGHLRAQAWSASSMWAANAATVSPAP
                 * .: *  **    *  :*                        *** **.***.*: .  

ASTB_SHIBS       DTLDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVHSALPQVALLGDEGAAN
ASTB_SHISS       DTLDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVHSALPQVALLGDEGAAN
ASTB_ECOLI       DTLDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVHSALPQVALLGDEGAAN
ASTB_ECO57       DTLDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVHSALPQVALLGDEGAAN
ASTB_SHIDS       DTLDGKVHRTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVHSALPQVALLGDEGAAN
ASTB_ECOL6       DTLDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVHSALPQVALLGDEGAAN
ASTB_ECOUT       DTLDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVHSALPQVALLGDEGAAN
ASTB_ECOL5       DTLDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVHSALPQVALLGDEGAAN
ASTB_SALPA       DALDGKVHLTVANLNNKFHRALEAPVTEALLRAIFRDESQFSVHSALPQVALLGDEGAAN
ASTB_SALTI       DALDGKVHLTVANLNNKFHRALEAPVTEALLRAIFRDESQFSVHSALPQVALLGDEGAAN
ASTB_SALTY       DALDGKVHLTVANLNNKFHRALEAPVTEALLRAIFRDESQFSVHSALPQVALLGDEGAAN
ASTB_YERPA       DSADGRVHFTVANLHNKFHRAIEAETTAVLLPAVFNNHRHFVHHDALPSVTLLGDEGAAN
ASTB_YERPE       DSADGRVHFTVANLHNKFHRAIEAETTAVLLPAVFNNHRHFVHHDALPSVTLLGDEGAAN
ASTB_YERPS       DSADGRVHFTVANLHNKFHRAIEAETTAVLLPAVFNNHRHFVHHDALPSVTLLGDEGAAN
ASTB_ACIAD       DSADGRVHFTAANLNNKFHRSIEHETTSQILAAIFRDERYFAHHLALPPVALFGDEGAAN
ASTB_PHOLL       DSADQRVHFTVANLNNKLHRSLEIATTTAALKATFADQNYFVHHQALPQHEDFGDEGAAN
ASTB_BURCA       DTSDGRVHFTPANLCSKLHRAIEHEATRRTLSTLFADPTHFAVHEALTGTPALGDEGAAN
ASTB_BURL3       DTSDGRVHFTPANLCSKLHRAIEHEATRRTLSTLFADPAHFAVHEALTGTPALGDEGAAN
ASTB_BURP1       DTSDARVHFTPANLCSKLHRAIEHESTRRTLAAIFADEARFAVHDALPGTPALGDEGAAN
ASTB_BURPS       DTSDARVHFTPANLCSKLHRAIEHESTRRTLAAIFADEARFAVHDALPGTPALGDEGAAN
ASTB_BURMA       DTSDARVHFTPANLCSKLHRAIEHESTRRTLAAIFADEARFAVHDALPGTPALGDEGAAN
ASTB_BURTA       DTSDGRVHFTPANLCSKLHRAIEHESTRRTLAAIFADEARFAVHDALPGTPALGDEGAAN
ASTB_PARXL       DTNDGRVHFTPANLCSKLHRAIEHESTRRTLRTMFNDTDRFVVHEALPGTPALGDEGAAN
ASTB_PSE14       DTADGRVHFTAANLNCKYHRSIEHPTTSRVLGAMFADAKHFAHHPALPPVAQFGDEGAAN
ASTB_PSEU2       DTADGRVHFTAANLNCKYHRSIEHPTTTRVLGAMFADAKHFAHHPALPAVAQFGDEGAAN
ASTB_PSESM       DTADGRVHFTAANLNCKYHRSIEHPTTSRVLGAMFADAKHFAHHPALPSVAQFGDEGAAN
ASTB_PSEF5       DTADGRVHFTAANLNCKYHRSIEHPTTSRVLGAMFADQKHFAHHAALPAVAQFGDEGAAN
ASTB_PSEPF       DTADGRVHFTAANLNCKYHRSIEHPTTSRVLGAMFANQQHFAHHAALPAVAQFGDEGAAN
ASTB_PSEPK       DTADGRVHFTAANLNCKYHRSIEHPTTSRVLGAMFNDEKYFAHHAALPAVAQFGDEGAAN
ASTB_PSEAE       DTADGRVHFTAANLNCKFHRSIEHPTTSRVLAAMFNDERHFAHHAALPAVSQFGDEGAAN
ASTB_CHRVO       DTADGRVHFTPANLNNKFHRSIEHPTTRRVLRAMFADETRFAVHEALPAQMHFGDEGAAN
ASTB_HAHCH       DTTDGRVHFTAANLNAKFHRSIEHPTTTRILQGIFNNDQYFAHHKALPPTSQFGDEGAAN
ASTB_IDILO       DTANGKVHFTPANLTNKFHRSLEPQTSGRILQAMFNNGRYFEHHTHLPDNEHFGDEGAAN
ASTB_PSEA6       DTADGKVHFTPANLTNKYHRSLEPQVTGNILKATFANQQYFSHHNHLPDNEHFGDEGAAN
ASTB_SHEDO       DTRDGKVHFTPANLVDKLHRSIEPITTANILKATFKDPHFFQHHAHLPEHAHFGDEGAAN
ASTB_SHEFN       DTRDGKVHFTPANLVDKLHRSIEPVTTGNILQATFNNDRYFKHHQHLPEHASFGDEGAAN
ASTB_SHEON       DTRDGKLHFTPANLVDKLHRSIEPITTGRILTATFNDPHYFYHHNHLPEHNSFGDEGAAN
ASTB_PHOPR       DTADGKVHFTPANLTNKFHRSIEHETTGRILQATFADKNHFAHHSALPAVEHFGDEGAAN
ASTB_ALIF1       DTADGKVHFTPANLINKFHRSIEDQVTGNILKATFSDEEHFVHHQALPHSDYFGDEGAAN
ASTB_PSET1       DTTDGKVHFTAANLNNKFHRSLEPATTTRLLKAMFNNQNHFAHHTHLPDQGFFGDEGAAN
ASTB_LEGPH       DTEDNKVHFTAANLISNLHRHQEADFSKKLLEFIFSNSDYFNHHPLLPKSMGTSDEGAAN
ASTB_LEGPL       DTEDNKVHFTAANLISNLHRHQEADFSKKLLEFIFSNSDYFNHHPLLPKSMGTSDEGAAN
ASTB_LEGPA       DTEDNKVHFTAANLISNLHRHQEADFSKKLLEFIFSNSDYFNHHPLLPKSMGTSDEGAAN
ASTB_CHRSD       DAPDGRVHFTAANLQSSFHRYLEPRTTARVLAAMFHDPAHFAHHPVLPATPTFSDEGAAN
ASTB_MYXXD       DTADGRVHLTPANLSQMYHRAIEAETTHSVLRAIFSNEKYFAVHAPLPGSGHFADEGAAN
ASTB_NITMU       DTEDGKVHLTAANLPSQFHRSIEAPVTSAVLKRVFSNERYFVHHDPLPSNLYFGDEGAAN
ASTB2_CAUVC      DAADGRVHFTPANLLTNLHRSLEGRQTARSLRRLFADETRFAVHDPLPAQPHFADEGAAN
ASTB1_CAUVC      DTADGRVHLVTANLGTMLHRSLEADDTYATLRRVFSGEAF-AVHAPLPFAAHLGDEGAAN
ASTB_ZYMMO       DSHDGRVHFITANLATMLHRHLEAQTTYAQLNQIFSNSCFFAMHHPLPCGQHFSDEGAAN
ASTB_NOVAD       DTPDGRCHLTAANLVTMPHRSQEWPDTVRQLRLAFADAAHFAVHDAVP--ACFGDEGAAN
ASTB_SPHAL       DSADGKCHLTVANLVTMPHRSHEWPGTLAQLRLAFAHPA-FSVHPPVP--APFGDEGAAN
                 *: : : *   ***    **  *   :   *   *        *  :.     .******

ASTB_SHIBS       HNRLGGHYGEPGMQLFVYGRE-EGNDT---RPSRYPARQTREASEAVARLNQVNPQQVIF
ASTB_SHISS       HNRLGGHYGEPGMQLFVYGRE-EGNDT---RPSRYPARQTREASEAVARLNQVNPQQVIF
ASTB_ECOLI       HNRLGGHYGEPGMQLFVYGRE-EGNDT---RPSRYPARQTREASEAVARLNQVNPQQVIF
ASTB_ECO57       HNRLGGHYGEPGMQLFVYGRE-EGNDT---RPSRYPARQTREASEAVARLNQVNPQQVIF
ASTB_SHIDS       HNRLGGHYGEPGMQLFVYGRE-KGNDT---RPSRYPARQTREASEAVARLNQVNPQQVIF
ASTB_ECOL6       HNRLGGHYGEPGMQIFVYGRE-EGNDT---RPSRYPARQTREASEAVARLNQVNPQQVIF
ASTB_ECOUT       HNRLGGHYGEPGMQLFVYGRE-EGNDT---RPSRYPARQTREASEAVARLNQVNPQQVIF
ASTB_ECOL5       HNRLGGHYGEPGIQLFVYGRE-EGNDT---RPSRYPARQTREASEAVARLNQVNPQQVIF
ASTB_SALPA       HNRLGGEYGSAGVQLFVYGRE-EENEI---RPARYPARQSREASEAVARLNQVNPQQVIF
ASTB_SALTI       HNRLGGEYGSAGVQLFVYGRE-EENEI---RPARYPARQSREASEAVARLNQVNPQQVIF
ASTB_SALTY       HNRLGGEYGSAGVQLFVYGRE-EENEI---RPARYPARQSREASEAVARLNQVNPQQVIF
ASTB_YERPA       HNRLGGEYDSPAIQMFVYGRQGMESGA---VPGRYPARQTREASQAVARLHQLDPKRTVF
ASTB_YERPE       HNRLGGEYDSPAIQMFVYGRQGMESGA---VPGRYPARQTREASQAVARLHQLDPKRTVF
ASTB_YERPS       HNRLGGEYDSPAIQMFVYGRQGMESGA---VPGRYPARQTREASQAVARLHQLDPKRTVF
ASTB_ACIAD       HNRLGGPYDSAAVQVFVYGQQFLGGQV---APKRYPARQSLEACQAVARLHQLDSNRTVF
ASTB_PHOLL       HNRLGGDYDSPGVQVFVYGRSVFRGGP---VPKRYPARQTLEASEAIARLHRLNPAQTVF
ASTB_BURCA       HTRFCAEYGKPGIEFFVYGRAEYRRGP---EPKRFPARQTFEASRAVAHRHGLAEEATVY
ASTB_BURL3       HTRFCAEYGKPGIEFFVYGRAEYRRGP---EPKRFPARQTFEASRAVAHRHGLAEEATVY
ASTB_BURP1       HTRFCAEYGAPGVEFFVYGRAEYRRGP---EPTRFPARQTFEASRAVAHRHGLREEATIY
ASTB_BURPS       HTRFCAEYGAPGVEFFVYGRAEYRRGP---EPTRFPARQTFEASRAVAHRHGLREEATIY
ASTB_BURMA       HTRFCAEYGAPGVEFFVYGRAEYRRGP---EPTRFPARQTFEASRAVAHRHGLREEATIY
ASTB_BURTA       HTRFCSEYGAPGVEFFVYGRAEYRRGP---EPTRFPARQTFEASRAVAQRHGLREEATIY
ASTB_PARXL       HTRFCEEYGARGVEFFVYGRSEYRRGP---EPKRFPARQSFEASRAVAHRHGLADEATVY
ASTB_PSE14       HTRFCQDYGQPGVEFFVFGRSAFDTRYP--APQKYPARQTLEASRAVARLHGLSEGGVVY
ASTB_PSEU2       HTRFCRDYGEAGVEFFVFGRSAFDTRYP--APQKYPARQTLEASRAVARLHGLSEAGVVY
ASTB_PSESM       HTRFCQDYGQAGVEFFVFGRSAFDTRYA--APQKYPARQTLEASRAVARLHGLSDECVVY
ASTB_PSEF5       HTRFCRDYGQAGVEFFVFGRSAFDTRYP--APQKYPARQTLEASQAVARLHGLSEEGVVY
ASTB_PSEPF       HTRFCREYGDAGVEFFVFGRSAFDTRYP--APQKYPARQTLEASQAVARLHGLRDDGVVY
ASTB_PSEPK       HTRFCRAYGEAGVEFFVYGRSAFDSRYP--APQKYPARQTLEASQAVARLHGLSDDGVVY
ASTB_PSEAE       HTRFCKDYGDAGVEFFVFGRSAFDSRFP--APQRYPARQTLEACQAVARLHGLSEAGVVY
ASTB_CHRVO       HTRFCADYGQPGVEFFVFGAAAFDMRYP--KPAKFPARQTLEASQAVARLHGLSEAGVVY
ASTB_HAHCH       HTRFCKNYEDKGVELFVYGRVAFDENAP--RPMKYPARQTLEACQAVARLHGLADSSVVY
ASTB_IDILO       HTRLCREYGHAGIELFVFGRYAFDSSKP--APKRFPARQTLEASQAIARLHGLSEDNTVY
ASTB_PSEA6       HTRLCREYGERGVELFVYGRYAFDKSKP--APVKFPARQTFEASQAVARLHGLSDDNVVF
ASTB_SHEDO       HTRLCGEYGHSGVELFVYGQEATNPNAP--KPKKYPARQTLEASQAIARLHQLEDESTVF
ASTB_SHEFN       HTRLCSEYGHAGVELFVYGQTATNPDAP--KPTKYPARQTLEASQAVARLHQLEDESCVF
ASTB_SHEON       HTRLCQEYGHAGVELFVYGQEATNPHAP--KPLKFPARQTLEASMAIARLHQLEEDNCVF
ASTB_PHOPR       HTRFCHQYDEHGVEFFVYGRHAFDSRYP--APKKYPARHTFEACEAVVRLHQLTSDKVVI
ASTB_ALIF1       HTRFCREYGEQGVEFFVFGKSAFNESYL--APKKYPARQTLEASEAIARTHGLREQFTVF
ASTB_PSET1       HTRFCDSHGEQGLEMFVFGASAFNSHLP--KPVKFPARQTLEASEAICRLHNLKDTSQIL
ASTB_LEGPH       HNRLCQSHAHSGINLFVYGKKVLGNHQFEQSPIKYPARQTKEASEAIARNHLLNPERVIF
ASTB_LEGPL       HNRLCQSHAHSGINLFVYGKKVLGNHQFEQSPIKYPARQTKEASEAIARNHLLNPERVIF
ASTB_LEGPA       HNRLCQSHAHSGINLFVYGKKVLGNHQFEQSPIKYPARQTKEASEAIARNHLLNPERVIF
ASTB_CHRSD       HTRLCGDHDEPGVHLYVYGRQAFGGEHG---PKRYPARQTLEASQAIARQHGLDDTRTVF
ASTB_MYXXD       HTRLATP-GHAGVHLLAWGRSAWQDVQG---PSRFPARQTLEASQALARLHQLDAKSVLF
ASTB_NITMU       HMRLCPRHGEPGVEIFVFGRSASRDIPK---PLRFPARQSLEASEAVARLHQIKRGKELF
ASTB2_CAUVC      HVRLCAEHGGPGVNLFVWGREAWSHWDG-----RFPARQTKEAFEAIQRRHGA--ARAVF
ASTB1_CAUVC      HMRLAANHGARGVNVFVHGAP---------RGGRFPERQALRASQAAARLAGVQPT-ALF
ASTB_ZYMMO       HMRITSAHGRTGINIFVYGE----------KNDIYPARQKLRASQAVARLGEVKPDLAWF
ASTB_NOVAD       HMRMCKSHDAPGIEIFVYGT----------TGGAFPARQHEQASRAVARLHGLAPERCLF
ASTB_SPHAL       HMRLCSGHDRVGVEIFVYGV----------AGGRFPARQHLDASKAIARRHRLDPARTLF
                 * *:       .:.. . *               :* *:   *  *  :           

ASTB_SHIBS       AQQNPDVIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARV----NGFMAIEVP
ASTB_SHISS       AQQNPDVIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARV----NGFMAIEVP
ASTB_ECOLI       AQQNPDVIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARV----NGFMAIEVP
ASTB_ECO57       AQQNPDVIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARV----NGFMAIEVP
ASTB_SHIDS       AQQNPDVIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARV----NGFMAIEVP
ASTB_ECOL6       AQQNPDVIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARV----NGFMAIEVP
ASTB_ECOUT       AQQNPDVIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARV----NGFMAIEVP
ASTB_ECOL5       AQQNPDVIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRSRV----NGFMAIEVP
ASTB_SALPA       AQQNPEVIDQGVFHNDVIAVSNRQVLFCHEAAFARQKVLINQLRTRV----DGFMAIEVP
ASTB_SALTI       AQQNPEVIDQGVFHNDVIAVSNRQVLFCHEAAFARQKVLINQLRTRV----DGFMAIEVP
ASTB_SALTY       AQQNPEVIDQGVFHNDVIAVSNRQVLFCHEAAFARQKVLINQLRTRV----DGFMAIEVP
ASTB_YERPA       VQQNPAVIDQGVFHNDVIAVSNRNVLFHHELAFLSSTQVMDDIRCKMAGLEQQLVNIEVP
ASTB_YERPE       VQQNPAVIDQGVFHNDVIAVSNRNVLFHHELAFLSSTQVMDDIRCKMAGLEQQLVNIEVP
ASTB_YERPS       VQQNPAVIDQGVFHNDVIAVSNRNVLFHHELAFLSSTQVMDDIRCKMAGLEQQLVNIEVP
ASTB_ACIAD       VQQNPDVIDEGVFHNDVIAVSNQQVLFHHQKAFFNQAQALNEIREKMALLEQDLIAIEVP
ASTB_PHOLL       VQQNPVAIDSGVFHNDVIAVSNRNVLFHHQYAYLNQSQVLTEIRQKMAVLGQNFVSIEVP
ASTB_BURCA       AQQDPDVIDAGVFHNDVISVGNRDTLFTHERAFVNKQAIYDTLTAALDARGARLNVIEVP
ASTB_BURL3       AQQDPDVIDAGVFHNDVISVGNRDTLFTHERAFVNKQAIYDTLTAALDARGARLNVIEVP
ASTB_BURP1       AQQRPDVIDAGVFHNDVIAVGNRDTLFCHEHAFVDRQAVYDALAASLGALGAQLNVIEVP
ASTB_BURPS       AQQRPDVIDAGVFHNDVIAVGNRDTLFCHEHAFVDRQAVYDALAASLGALGAQLNVIEVP
ASTB_BURMA       AQQRPDVIDAGVFHNDVIAVGNRDTLFCHEHAFVDRQAVYDALAASLGALGAQLNVIEVP
ASTB_BURTA       AQQSPDVIDAGVFHNDVIAVGNRDTLFCHERAFVDKQAVYDALTASLGALGARLNVIEVP
ASTB_PARXL       AQQNPDVIDAGVFHNDVIAVGNRNTLFCHQFAFVEPNAVYDELRAKLSGLKAAFNVIEVP
ASTB_PSE14       AQQNPAVIDQGVFHNDVIAVGNGEVLFYHEDAFLNTEPMLNELRDKLGRVGGQLRAICVP
ASTB_PSEU2       SQQNPAVIDQGVFHNDVIAVGNGEVLFYHQDAFLNTDPMLNELRDKLGRVGGQLRAICVP
ASTB_PSESM       GQQNPAVIDQGVFHNDVIAVGNGEVLFYHEDAFLHTEQMLGELRDKLSRAGGQLQAVCVP
ASTB_PSEF5       AQQNPSVIDQGVFHNDVIAVGNGEVLFYHEDAFLETDKMLAELQGKLGKRGGNFQSICVP
ASTB_PSEPF       AQQNPAVIDQGVFHNDVIAVGNGEVLFYHEDAFLDTDQMLAELQAKLAKVGGKFQSVCVP
ASTB_PSEPK       AQQNPAVIDQGVFHNDVISVGNGEVLFYHEDAFLETDAVLGQLRAKLASKGGNFQAICVP
ASTB_PSEAE       AQQNPAVIDQGVFHNDVISVGNGEVLFHHEDAFLDTEKVLAELHDKLGRRGGRFRAICVP
ASTB_CHRVO       AQQDPDTIDAGVFHNDVISVGNGEVLFHHQQAFLNQADVLDEIARKLEARGGRFTAIEVP
ASTB_HAHCH       AQQNPAVIDQGVFHNDVIAVGNRNVLFYHEQAFLNTSQMLTELEGKL--QGCLLKAVKVS
ASTB_IDILO       IQQNPDVIDQGVFHNDVIAVGNQNVLFYHEQAFTDTESKLAEIQRKFGEH--PLHFIKVA
ASTB_PSEA6       IQQNPDLIDQGVFHNDVISVGNQNVLFYHEQAFLDTDKAFAEIKQKYGAG--DLHFIKVI
ASTB_SHEDO       MQQNPDVIDQGVFHNDVISVGNQNVLFYHEQAFLNTDAKFDEIRRKMNA---DMHFVKVA
ASTB_SHEFN       MQQNPNVIDQGVFHNDVISVGNKNVLFYHEQAFLDTETKFDEIRRKMNS---DMYFVKVT
ASTB_SHEON       IQQNPAVIDQGVFHNDVIAVGNQNVLFYHEQAFLNTQAKLDEIKRKLDT---ELYFIEVP
ASTB_PHOPR       AQQNPDVIDQGVFHNDVIAVGNKNVLFCHEQAFLNQQAVYKELTAKVGG---NFKIIEVP
ASTB_ALIF1       AQQNPDVIDQGVFHNDVIAVGNKNTLFCHQQAFLNQEKVKSDLSDSYGS---GFNVIEVP
ASTB_PSET1       LQQNPDVIDQGVFHNDVIAVGNANVLLCHQQAFLNQQQALQDIREAYVGNK-QFYIIEVP
ASTB_LEGPH       ACQNPLAIDQGVFHNDVISVANEHVFLVHEEAFYNQAYVLDQLREKADF---PLVIIQIS
ASTB_LEGPL       ACQNPLAIDQGVFHNDVISVANEHVFLVHEEAFYNQTYVLDQLREKADF---PLVIIQIS
ASTB_LEGPA       ACQNPLAIDQGVFHNDVISVANEHVFLVHEEAFYNQAYVLDQLKEKADF---PLVIIQIS
ASTB_CHRSD       AQQHPDAIDAGVFHNDVIAVGNGPVLLYHEMAFRDETATLEALRARMST---PLIPVRVP
ASTB_MYXXD       PQQHPEGIDAGAFHTDVLAVGNERFLMLHELAFVDHAGLLAVLREKLGQ---DFRAVVAT
ASTB_NITMU       VQQGPAAIDAGAFHNDVLAVANCDVLFYHEAAYRDWEETEARITKACDW---PIHFIRTG
ASTB2_CAUVC      PQQGKAAIEGGAFHNDVVCVGTRECLFFHERAFEDRATMAREVRAAASGL-FEPAFVEVT
ASTB1_CAUVC      AMQSAEAIKAGAFHNDVVAVANANVLLAHPQAFATRPDLLAELSARLPG------LVVIE
ASTB_ZYMMO       IPQKKEAIAKGAFHNDVVAVANEYVLLAHAEAFEDQGEWIKRIAEKIDG------FIPII
ASTB_NOVAD       VEQAPEAIAAGAFHNDVVAVANERVLFTHEQAFANPEATYAAIRERLPEA----EIVVVP
ASTB_SPHAL       IRQSDTAIQGGAFHNDVVAVANEHVLFTHETAFEDREAAHAEIRAAFPAV----EIVEVP
                   *    *  *.**.**:.*..   :: *  *:         :             :   

ASTB_SHIBS       ATQVSVSDAVSTYLFNSQLLSRDDGS-MMLVLPQECREHAGVWGYLNELLAA-DNPISEL
ASTB_SHISS       ATQVSVSDAVSTYLFNSQLLSRDDGS-MMLVLPQECREHAGVWGYLNELLAA-DNPISEL
ASTB_ECOLI       ATQVSVSDTVSTYLFNSQLLSRDDGS-MMLVLPQECREHAGVWGYLNELLAA-DNPISEL
ASTB_ECO57       ATQVSVSDAVSTYLFNSQLLSRDDGS-MMLVLPQECREHAGVWGYLNELLAA-DNPISEL
ASTB_SHIDS       ATQVSVSDAVSTYLFNSQLLSRDDGS-MMLVLPQECREHAGVWCYLNELLAA-DNPISEL
ASTB_ECOL6       ATQVSVSDAVSTYLFNSQLLSRDDGS-MVLVLPQECREHAGVWRYLNELLAA-DNPISEL
ASTB_ECOUT       ATQVFVSDAVSTYLFNSQLLSRDDGS-MVLVLPQECREHAGVWRYLNELLAA-DNPISEL
ASTB_ECOL5       AAQVSVSDAVSTYLFNSQLLSRDDGS-MMLVLPQECREHAGVWRYLNELLAA-DNPISSL
ASTB_SALPA       AGEVSVSDAVAPYLFNSQLLSRDDGS-MLLVLPRECQDHAGVWRYLNKLVAE-DNPISAM
ASTB_SALTI       AGEVSVSDAVATYLFNSQLLSRDDGS-MLLVLPRECQDHAGVWRYLNKLVAE-DNPISAM
ASTB_SALTY       AGEVSVSDAVATYLFNSQLLSRNDGL-MLLVLPRECQDHVGVWRYLNKLVAE-DNPISAM
ASTB_YERPA       EAEVSVADAVSTYLFNSQLLHKANGK-MLLVIPQESQDNPSVWRYLSELVSG-DGPIDEL
ASTB_YERPE       EAEVSVADAVSTYLFNSQLLHKANGK-MLLVIPQESQDNPSVWRYLSELVSG-DGPIDEL
ASTB_YERPS       EAEVSVADAVSTYLFNSQLLHKANGK-MLLVIPQESQDNPSVWRYLSELVSG-DGPIDEL
ASTB_ACIAD       DQRVSVGDAVSTYLFNSQLITRPDGG-MTIVVPEESRQNLAVWSYLNDMIQM-GTPVDQI
ASTB_PHOLL       AEQISIKDAVDSYLFNSQLLSKIDGK-MVLVVPEECRQHSAVWDYLQSLSAQTSAPINEV
ASTB_BURCA       DAAVSVNDAVTSYLFNSQLLSRADGS-QVLVVPQECRENARVAAYLDQLAAG-NGPIHDV
ASTB_BURL3       EAAVSVNDAVTSYLFNSQLLSRADGS-QVLVVPQECRENGNVAAYLDELAAG-NGPIHDV
ASTB_BURP1       DRAVSVADAVGSYLFNSQLLAREDGT-QMLVVPQECRENANVAAYLDALVAG-NGPIRDV
ASTB_BURPS       DRAVSVADAVGSYLFNSQLLAREDGT-QMLVVPQECRENANVAAYLDALVAG-NGPIRDV
ASTB_BURMA       DRAVSVADAVGSYLFNSQLLAREDGT-QMLVVPQECRENANVAAYLDALVAG-NGPIRDV
ASTB_BURTA       ERAVSVADAVGSYLFNSQLLTREDGR-QLLVVPQECRENANVSAYLDALAAG-NGPIRDV
ASTB_PARXL       DAQVSVADAVSSYLFNSQLLTRPDGK-QVLVVPQECRENPRVAAYLDDLTSR-TGPIDDV
ASTB_PSE14       RAEVSVQDAVRSYLFNSQLLSRPDGS-MLLIVPQECQANASVWAYLQRLI-ADDSPVAQV
ASTB_PSEU2       RAEVSVQDAVRSYLFNSQLLSRPDGS-MLLIVPQECQANASVWAYLQRLI-ADDSPVAEV
ASTB_PSESM       RAEVSVQDAVRSYLFNSQLLSRPDGS-MLLIVPQECQANANVWGYLQRLI-ADAGPVAEV
ASTB_PSEF5       RSQVTVEDAVRSYLFNSQLLSRADGS-MLLIVPEECRGNERVWQYLQSLT-SSGGLIREV
ASTB_PSEPF       RSAVTVDDAVRSYLFNSQLLSRPDGS-MLLIVPEECRGNERVWNYLQGLT-SSGGLIREV
ASTB_PSEPK       RAAVAVEDAVRSYLFNSQLLSREDGS-MLLVVPEECRNNERVWAYLGQLT-SQGGPVKEV
ASTB_PSEAE       RDQVAVEDAVKSYLFNSQLLSKADGS-MLLVVPEECRNNPRVWNYLDQLT-GDDGPIREV
ASTB_CHRVO       RAEVTVEEAVKSYLFNSQLLSKPGGK-MLIVVPEECRNSERVWSYLQKLA-ASGGPIDEV
ASTB_HAHCH       DSEVSVADAVSSYLFNSQLLSLNDDD-MMLVVPHECRDNPNVKAYLDDLV-TRGGPIKRV
ASTB_IDILO       TEQVSIQDAVNTYLFNTQLITPPDGQ-MTIIAPTECQENDNVRSYLEQLTQSADSPIKRV
ASTB_PSEA6       TEQVSLQDAIKSYLFNTQLVTLANGE-MAIIAPTDCEENPAVSAYLNELV-SLNTPIKHI
ASTB_SHEDO       TSQVSIDDAVKSYLFNTQIITLPSGE-MTIIAPTDCQENLAVFAYLNELV-TLGTPIKQV
ASTB_SHEFN       TEQVSIDDAVRSYLFNTQIITLPSGE-MAIIAPTNCQENPAVFAYLNELV-TLGTPIKQV
ASTB_SHEON       TAKVSINDAVKSYLFNTQIITLPSGE-MAIIAPTDCQENPAVYAYLNELL-SLNTPIKQV
ASTB_PHOPR       TSAITIEDAVTSYLFNSQLIEMPNGE-TLLILPEECRNNERVWAHVQTII-NAKQGIDKV
ASTB_ALIF1       TDKVSVQDAVETYLFNSQLITKADGT-TLIILPEHCRQNSRVWAYLNELV-EQKCGIDEL
ASTB_PSET1       TSKVTIQDAVSSYLFNSQLVSLSDGS-MLLVAPKECQRNSAVNDYIEEMI-MADNPINQV
ASTB_LEGPH       KEQISVSEAVDTYLFNSQLITLPDQKNMILIAPAECQANLKVKTCIDGLVADPQNPINSV
ASTB_LEGPL       KEQISVSEAVDTYLFNSQLITLPDQKNMILIAPAECQANLKVKTCIDGLVADPQNPINSV
ASTB_LEGPA       KEQISVSEAVDTYLFNSQLITLPDQKNMILIAPAECQANLKVKTCIDGLVADSQNPINSV
ASTB_CHRSD       SEAISLEDAVATYLFNSQLLSNPDGS-MTLVVPGECQENETVWRTIQDLLLGGNNPISEV
ASTB_MYXXD       KAELPAKDAVKAYPFNSQVLTLPDGT-MAIVAPIESRETPAARQFLERVVAEDT-PVKAV
ASTB_NITMU       EEDVTLAEAVRTYLFNAQLLTLPGNE-MMILAPSECRDSHSARNFLERVVQDAANPIAHV
ASTB2_CAUVC      EADLPMADLVASYLFNSQLLVVPGEDRLVLLAPVETRDNPRAYAVAESLATS-NGPIGRV
ASTB1_CAUVC      TRDLSLEDAVASYLFNSQLVSLPDGY-MALIVPVEARDNAAAWREIQTILAA-DNPVTKV
ASTB_ZYMMO       IDNITLEQAVKSYLFNSQIVTLKDRT-MALILPQEVKSDPAVWETVNRIISG-NNPIKKA
ASTB_NOVAD       SSVVSLADAIRSYLFNAQLLTLPSGE-MGLVIPVEAWETPSVRGWLEAHLAS-NGPIRRV
ASTB_SPHAL       ASAVSLAHAIKSYLFNAQLVTLPEGG-MGLVLPTEAHETPAVWNWLEAMIVG-NGPIRRL
                    :   . : .* **:*::         :: * .      .              :   

ASTB_SHIBS       KVFDLRESMANGGGPACLRLRVVLTEEERRAVNPA--VMMNDTLFNALNDWVDRYYRDRL
ASTB_SHISS       KVFDLRESMANGGGPACLRLRVVLTEEERRAVNPA--VMMNDTLFNALNDWVDRYYRDRL
ASTB_ECOLI       KVFDLRESMANGGGPACLRLRVVLTEEERRAVNPA--VMMNDTLFNALNDWVDRYYRDRL
ASTB_ECO57       KVFDLRESMANGGGPACLRLRVVLTQEERRAVNPA--VMMNDTLFNALNDWVDRYYRDRL
ASTB_SHIDS       KVFDLRESMANGGGPACLRLRVVLTEEERRAVNPA--VMMNDTLFNALNDWGDRYYRDRL
ASTB_ECOL6       KVFDLRESMANGGGPACLRLRVVLTEEERRAVNPA--VMMNDTLFNALNDWVDRYYRDRL
ASTB_ECOUT       KVFDLRESMANGGGPACLRLRVVLTEEERRAVNPA--VMMNDTLFNALNDWVDRYYRDRL
ASTB_ECOL5       KVFDLRESMANGGGPACLRLRVVLTEEERRAVNPA--VMMNDTLFNALNDWVDRYYRDRL
ASTB_SALPA       QVFDLRESMANGGGPACLRLRVVLTEEERRAVNPA--VMMNDALFTALNAWADRYYRDRL
ASTB_SALTI       QVFDLRESMANGGGPACLRLRVVLTEEERRAVNPA--VMMNDALFTALNAWADRYYRDRL
ASTB_SALTY       QVFDLRESMANGGGPACLRLRVVLTEEERRAVNPA--VMMNDALFTALNAWADRYYRDRL
ASTB_YERPA       RVFDLRESMRNGGGPACLRLRVVLNDAELQAVNSR--VMLTPALFVTLNNWVDQHYRDHL
ASTB_YERPE       RVFDLRESMRNGGGPACLRLRVVLNDAELQAVNSR--VMLTPALFVTLNNWVDQHYRDHL
ASTB_YERPS       RVFDLRESMRNGGGPACLRLRVVLNDAELQAVNSR--VMLTPALFVTLNNWVDQHYRDHL
ASTB_ACIAD       KVFDLRESMRNGGGPACLRLRVAVNDAEFNAINHN--VLMNDALFARLNTWVDRRYRDQL
ASTB_PHOLL       RVFDLRESMRNGGGPACLRLRVVLNDAEFRAVNPA--TLMNTQLYQRLTKWIEHHYRDEL
ASTB_BURCA       LVFDLRESMKNGGGPACLRLRVVLNDAERAAVTSN--VWINDTLFASLDAWIDKHYRDRL
ASTB_BURL3       LVFDLRESMKNGGGPACLRLRVVLNEAERAAVTSN--VWINDTLFTSLDTWIDRHYRDRL
ASTB_BURP1       RVFDLRESMKNGGGPACLRLRVVLNDAERAAVKPN--VWIGDALFASLDAWIDKHYRDRL
ASTB_BURPS       RVFDLRESMKNGGGPACLRLRVVLNDAERAAVKPN--VWIGDALFASLDAWIDKHYRDRL
ASTB_BURMA       RVFDLRESMKNGGGPACLRLRVVLNDAERAAVKPN--VWIGDALFASLDAWIDKHYRDRL
ASTB_BURTA       RVFDLRESMKNGGGPACLRLRVVLNDAERAAVKPN--VWIGDALFASLDAWIDKHYRDRL
ASTB_PARXL       LVFDLRESMKNGGGPACLRLRVVLDDAERAAVTPG--VWIDDTLFGRLDAWIEKHYRDRL
ASTB_PSE14       KVFDLKQSMQNGGGPACLRLRVALKETELAAVNPG--VIMTAPLYDTLTQWVDRHYRDRM
ASTB_PSEU2       KVFDLKQSMQNGGGPACLRLRVALNDTELAAVNPG--VIMTAPLYETLTQWVDRHYRDRM
ASTB_PSESM       KVFDLKQSMQNGGGPACLRLRVALNETELAAVNPG--VIMTAPLYETLTQWVDRHYRDRM
ASTB_PSEF5       KVFDLKQSMQNGGGPACLRLRVALKETELAAVNPG--VIMTAPLYDTLTQWVGKHYRDRL
ASTB_PSEPF       KVFDLKQSMQNGGGPACLRLRVALNETELAAVNPG--VIMTAPLYGSLTAWVEKHYRDRL
ASTB_PSEPK       KVFDLKQSMQNGGGPACLRLRVALKEAELAAVNQG--VIMTATLYDTLLQWVDRHYRDRL
ASTB_PSEAE       KVFDLKQSMQNGGGPACLRLRVALQERELAAVNPG--VIMSAGLYDTLVAWVDRHYRDRL
ASTB_CHRVO       RVFDLKQSMQNGGGPACLRLRVALNQAELAAVNPK--VLMSDALFASLNGWVDRHYRDRL
ASTB_HAHCH       EVFDLKQSMKNGGGPACLRLRVALTEAELAAVHPH--VMMSDGLFDTLNAWVDKHYRDRI
ASTB_IDILO       EYFDVKQSMRNGGGPACLRLRVALNDEEIAGANQN--CLMSDGLFNRLNQWVEKHYRDEL
ASTB_PSEA6       RYYDVKQSMRNGGGPACLRLRVAMNETELAAVNQS--TMMNDAQFERLNNWVDKHYRDRL
ASTB_SHEDO       RYYDVKQSMQNGGGPACLRLRVALNDQELAAVNQD--TLMNDALFGRLNTWVEKHYRDSL
ASTB_SHEFN       RYYDVKQSMQNGGGPACLRLRVAMNEQEVAAVNQN--TLMDDGLFTRLNTWVDRHYRDQL
ASTB_SHEON       LYFDVKQSMQNGGGPACLRLRVAMNEREVAAVNQH--TLLTDALFTRLNTWVEKHYRDRL
ASTB_PHOPR       QIFDLKQSMANGGGPACLRLRVVLNEQELQAVNQS--TLMNDTLFNRLNTWVDSHYRDTV
ASTB_ALIF1       HTFDLKQSMQNGGGPACLRLRVVLNEAEQKAVNQH--TLMSEELFTTLNLWADKHYRDRI
ASTB_PSET1       RFFDLRQSMQNGGGPACLRLRVALNEQELAAVNPD--VILTDTKYTQLCNWAQRNYRDQL
ASTB_LEGPH       YYLDLKQSMRNGGGPACLRLRVPLNDYELKAMHQG--ILIDNDLLDILDKWVLKYYRTEL
ASTB_LEGPL       YYLDLKQSMRNGGGPACLRLRVPLNDYELKAMHQG--ILIDNDLLDILDKWVLKYYRTEL
ASTB_LEGPA       YYLDLKQSMRNGGGPACLRLRVPLNDYELKAMHQG--ILIDNDLLDILDKWVLKYYRTEL
ASTB_CHRSD       LVKDVKQSMRNGGGPACLRLRVALAARERQALTGR--VLLDEALHDDLAAWVERHYRDRL
ASTB_MYXXD       HYLDVRQSMNNGGGPACLRQRVWLTDEERGAIKAD--VFYTPALHDSLAGWVRRHYREVL
ASTB_NITMU       EYVDLRQSMKNGGGPACLRLRVVLTEPELDAVQENSRVILDECLYNDLKAWIEKHYRECL
ASTB2_CAUVC      EYVDVRQSMRNGGGPACLRLRVVLTEAELAAANPA--QRFTADLQDALADWITRRYRDRL
ASTB1_CAUVC      KVVDLRQSMSNGGGPACLRLRVPVAAAARDQINPAF--LLDHARLDRLTRLVETWWPRAI
ASTB_ZYMMO       VVVDVRESMANGGGPACLRLRVPLSKAALEAVDQRF--ILTPKRWEKLYQLVENFWPEKI
ASTB_NOVAD       LPVDVRQSMANGGGPACLRLRVVADPAT---VDPRF--LLDEARVAIVEEVVRRHWPEQI
ASTB_SPHAL       FPVDVRQSMANGGGPACLRLRVVADPAT---VDPRF--LADEAKLDRIAGVVAKHWPEAI
                    *:::** ********* **                         :       :   :

ASTB_SHIBS       TAADLADPQLLREGREALDVLSQLLNLGS-VYPFQREGGGNG
ASTB_SHISS       TAADLADPQLLREGREALDVLSQLLNLGS-VYPFQREGGGNG
ASTB_ECOLI       TAADLADPQLLREGREALDVLSQLLNLGS-VYPFQREGGGNG
ASTB_ECO57       TAADLADPQLLREGREALDVLSQLLNLGS-VYPFQREGGGNG
ASTB_SHIDS       TDADLADPQLLREGREALDVLSQLLNLGS-VYPFQREGGGNG
ASTB_ECOL6       TAADLADPQLLREGREALDTLTQLLDLGS-VYPFQREGGGNG
ASTB_ECOUT       TAADLADPQLLREGREALDTLTQLLDLGS-VYPFQREGGGNG
ASTB_ECOL5       TAADLADPQLLREGREALDTLTQLLDLGS-VYPFQREGGGNG
ASTB_SALPA       TAADLADPLLLREGREALDVLTRLLDLGS-VYPFQQTGAADG
ASTB_SALTI       TAADLADPLLLREGREALDVLTRLLDLGS-VYPFQQTGAADG
ASTB_SALTY       TAADLADPLLLREGREALDVLTRLLDLGS-VYPFQQTGAADG
ASTB_YERPA       QFKDLADPHLLQEGRQALDELTRILNLGP-VYPFQRN-----
ASTB_YERPE       QFKDLADPHLLQEGRQALDELTRILNLGP-VYPFQRN-----
ASTB_YERPS       QFKDLADPHLLQEGRQALDELTRILNLGP-VYPFQRN-----
ASTB_ACIAD       SHQDLADPALLIESRSALDELTQILNLGS-VYHFQQ------
ASTB_PHOLL       CASDLADPQLLCEVYTALDELTQILNLGS-IYEFQR------
ASTB_BURCA       APEDLADPALLDESRTALDELTQILRVGS-LYDFQR------
ASTB_BURL3       APEDLADPALLEESRTALDELTQILRVGS-LYDFQR------
ASTB_BURP1       SPVDLADPALLDESRTALDELTQILGLGS-LYDFQR------
ASTB_BURPS       SPVDLADPALLDESRTALDELTQILGLGS-LYDFQR------
ASTB_BURMA       SPVDLADPALLDESRTALDELTQILGLGS-LYDFQR------
ASTB_BURTA       SPADLADPALLEESRTALDELTQILGLGS-LYDFQR------
ASTB_PARXL       APADLTDPHLLAESRTALDELTQILGLGS-LYDFQR------
ASTB_PSE14       SENDLADPRLLIQCRTALDELTQILKLGA-VYPFQLN-----
ASTB_PSEU2       SESDLADPRLLSECRTALDELTQILKLGA-VYPFQLN-----
ASTB_PSESM       SENDLADPRLLTECRTALDELTQILKLGA-VYPFQLN-----
ASTB_PSEF5       SESDLADPQLLLECRTALDELTQILKLGA-VYPFQIN-----
ASTB_PSEPF       TESDLADPQLLLECRTALDELTQILKLGA-VYPFQIN-----
ASTB_PSEPK       GEADLADPQLLVECRTALDELTQILKLGS-VYPFQRQP----
ASTB_PSEAE       SETDLADPQLLLECRTALDELTQILKLGS-VYSFQLD-----
ASTB_CHRVO       APEDLADPQLLIECRGALDELTGILGLGS-VYPFQLA-----
ASTB_HAHCH       SQQDLADPQLLTECRTALDELTQLLQLGS-LYPFQLA-----
ASTB_IDILO       AVDDLRDPALLEESRTALDELTQIMKLGS-VYPFQQD-----
ASTB_PSEA6       SVDDLRDVALLNESRTALDELTQLLKLGS-VYPFQKV-----
ASTB_SHEDO       SVKDLADPQLIVESRTALDELTQILKLGS-VYQFQK------
ASTB_SHEFN       TVSDLADPQLIIESRTALDELTQILKLGS-VYLFQR------
ASTB_SHEON       STEDLADPQLVIESRTALDELTQIMKLGS-VYPFQR------
ASTB_PHOPR       TDADLADPQLVVESRAALDALTQILDLGS-VYAFQR------
ASTB_ALIF1       EDKDLADPQLLVESRAALDELTQIMHLGS-IYPFQK------
ASTB_PSET1       GAKDFADPALLSESYQALDELTQLLNLGS-VYDFQLEG----
ASTB_LEGPH       KIPDLADPQLLYECLDALDELTQILKLGS-IYPFQS------
ASTB_LEGPL       KISDLADPQLLYECLDALDELTQILKLGS-IYPFQS------
ASTB_LEGPA       KISDLADPQLLYECLDALDELTQILKLGS-IYPFQS------
ASTB_CHRSD       APEDLADPLLVRESLTALDELTQLLGIGA-VYPFQLN-----
ASTB_MYXXD       RPKDLQDPQLARETMTALDELTRILNLGS-VYDFQR------
ASTB_NITMU       SPTDLGDPALLQESRAALDELTTILGFGS-LYDFQRP-----
ASTB2_CAUVC      SPADLADAKLLTESREALDELTQILGLGDDFYPFQRTA----
ASTB1_CAUVC      APSDLTDPALWEAAMVAHAALETFLTAPTV------------
ASTB_ZYMMO       TPDDLVLPELWKTAVRAHWALTSWLG----------------
ASTB_NOVAD       DPADLGSDILAQTVHGARGALLAALELSELA-----------
ASTB_SPHAL       APADLASTTLLHDVRRARLALLDALDLSELG-----------
                    *:    *      *   *   :