CLUSTAL format seed alignment for MF_01174

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ASTD_SHIBS       --------------MTLWINGDWITGQGASRVKRNPVSGEVLWQGNDADAAQVEQACRAA
ASTD_SHIFL       --------------MTLWINGDWITGQGASRVKRNPVSGEVLWQGNDADAAQVEQACRAA
ASTD_ECO57       --------------MTLWINGDWITGQGASRVKRNPVSGEVLWQGNDADAAQVGQACRAA
ASTD_ECOLI       --------------MTLWINGDWITGQGASRVKRNPVSGEVLWQGNDADAAQVEQACRAA
ASTD_ECOL5       --------------MTLWINGDWVTGQGALRVKRNPVSGEVLWQGNDADAAQVGQACRAA
ASTD_ECOUT       --------------MTLWINGDWVTGQGALRVKRNPVSGEVLWQGNDADAAQVGQACRAA
ASTD_ECOL6       --------------MTLWINGDWVTGQGALRVKRNPVSGEVLWQGNDADAAQVGQACRAA
ASTD_SHIDS       --------------MTLWINGDWVTGQGALRVKRNPVSGEVLWQGNDADAAQVEQACRAA
ASTD_SALPA       --------------MTLWINGDWITGQGERRRKTNPVSAEILWQGNDANAAQVAEACQAA
ASTD_SALTY       --------------MTLWINGDWITGQGERRRKTNPVSAEILWQGNDANAAQVAEACQAA
ASTD_SALTI       --------------MTLWINGDWITGQGERRRKTNPVSEEILWQGNDADAAQVAEACQAA
ASTD_YERPA       MSQHVMFNAVLSSHPALFIQGEWRIGNGVSFEKQDPMSQQRLWQARAADHTDVTLACHAA
ASTD_YERPE       MSQHVMFNAVLSSHPALFIQGEWRIGNGVSFEKQDPMSQQRLWQARAADHTDVTLACHAA
ASTD_YERPS       MSQHVMFNAVLSSHPALFIQGEWRIGNGVSFEKQDPMSQQRLWQARAADHTDVTLACHAA
ASTD_ACIAD       -----------MSHANLWIDGNWVQGQGKSWNTCNPVSQQVVWQGNEATAQQVEQACEAA
ASTD_PHOLL       -----------MNYKAHYIGGRWIEGQGESITKFSPIDQQVLWQANSADASQVRAACHAA
ASTD_PSE14       -------------MSTLYIAGAWQAGQGELFHSLNPVSQQTLWSGQAATPEQVDYAVQAA
ASTD_PSESM       -------------MSTLYIAGAWQAGQGELFHSLNPVTLHVLWSGQGATAEQVDHAVQAA
ASTD_PSEU2       -------------MNSLYIAGVWQDGQGEVVNSLNPVTQQVLWSGRGASAAQVEQAVQAA
ASTD_PSEF5       -------------MSTLYIAGQWLAGQGEAFTSVNPVTQAVIWSGNGATAAQVESAVQAA
ASTD_PSEPF       -------------MNSLYIAGEWLAGQGEAFQSLNPVTQQVLWSGEGATAAQVESAVQAA
ASTD_PSEPK       -------------MTTHYIAGNWQAGQGETLQSLNPVTQAVIWQGQGADASQVDAAVQAA
ASTD_PSEAE       -------------MSTHYIAGQWLAGQGETLESLDPVGQGVVWSGRGADATQVDAAVCAA
ASTD_CHRVO       -------------MSSLFIDGKWLAGDGEAMAKTNPADNAPLWQGRAASAAQVDAAVRAA
ASTD_BURCA       -------------MTELFIDGAWVAGSGPVFASRNPGTDAVAWQGESASAADVDRAVASA
ASTD_BURL3       -------------MTELFIDGAWVAGSGPVFASRNPGTDEIAWQGESASAADVDRAVASA
ASTD_BURMA       -------------MTELFIDGAWRDGAGPVFASRNPGTGEPVWEGAGASADDVERAVASA
ASTD_BURP1       -------------MTELFIDGAWRDGAGPVFASRNPGTGEPVWEGAGASADDVERAVASA
ASTD_BURPS       -------------MTELFIDGAWRDGAGPVFASRNPGTGEPVWEGAGASADDVERAVASA
ASTD_BURTA       -------------MTELFIDGAWVDGAGPVFASRNPGTNERVWEGASASADDVERAVASA
ASTD_PARXL       -------------MSELFIGGEWAAGTGPAFASRNPGTGAAVWEGNSASADDVDRAVRSA
ASTD_HAHCH       ----------MTVRESAFVNGRWLAGGGVEFESLDPVTQDCLWKGAAASDDVVGQAVQAA
ASTD_COLP3       ---------MSHANPVQFINGQWQAGLGHDVSSSNPARNEVIWQGKTASKDQVNDAVLSA
ASTD_PSEA6       -----------MTQQTHFIAGQWHAGQGHDIESIDPAKKRQIWQAKSASSEQVNQAVSSA
ASTD2_PSEHT      -------------MNTQLINNQWQAGQGPAFASINPSNGETIWQGNGASAEQVNSAIKAA
ASTD1_SHEDO      ---MNQLEQLTPLTQTQFIAGQWLAGKGPSFSSVNPANGEVIWQGLGADAGQVDAAITSA
ASTD1_PSEHT      -----------MTHPAQFINGQWSQGQGTEFSSVNPANNNVIFQANSATAEQVDAAVSAA
ASTD_IDILO       -----------MTNSIQFIDGCWEAGEGQLFKSIDPARNEVIWSGEAASETQVEKAILAA
ASTD2_SHEDO      --------------MTQYINGQWFAGLGHQVSSINPATGQSIWNGVTATADQVNQAVDAA
ASTD_SHEFN       --------------MTQYIQGQWLAGEGHEINSKNPANGDVIWQGNTATATQVNAAVDAA
ASTD_SHEON       --------------MTHFIKGQWHTGKGHDVASSNPANGEIIWRGQTATAEQVNAAVDAA
ASTD_VIBVU       --------------MTQWIAGEWVEGLGEEFTSLSPYDNQVVWRGKGATAEQVEMAVKAA
ASTD_VIBVY       --------------MTQWIAGEWVEGLGEEFTSLSPYDNQVVWRGKGATAEQVEMAVKAA
ASTD_VIBPA       --------------MTHWIAGEWVQGQGEEFVSLSPYNQEVIWRGNGATAEQVDQAVAAA
ASTD_VIBCH       --------------MTHWIAGEWVAGTGEKLESHTPYSHELLWQGYSASGEQVDAAVKAA
ASTD_ALIF1       --------------MTHWIAGDWVLGEGETIQSLSPYNSEVVWKGESATEAQVESAVNAA
ASTD_PHOPR       --------------MTQWIAGNWLAGKGEAMNSLNPFSSEEIWQGDAATAEQVEQAVSAA
ASTD_CHRSD       ----------MQAKQQLLIDGAWVDGDAARFAKTDPVSGETLWTATAASATQVEHAVAAA
ASTD_LEGPA       -----MSKLQIIQSKGQYINGEWIKGNGLILESTNPASGTLLWQGNNATDEEITHACYIA
ASTD_LEGPL       -----MSKLQIIQSKGQYINGEWIKGNGLILESTNPASGTLLWQGNNATDEEIANACYVA
ASTD_LEGPH       ----MMSKLQIIQSKGQYINGEWIKGNGLILESTNPASGTLLWQGNNATDEEIANACYVA
ASTD2_CAUVC      ------------MSGGLFIDGKWRAGQGAGLSSTDPATGEDVWSAATATPADVADAVAAA
ASTD_NOVAD       -------------------------MARAEIVSHEPATGAEVWRGKVGD---VEEVVARA
ASTD_SPHAL       --------------------------MSEELLSFEPATGEQLWRGKVSD---VDAEVEIA
ASTD1_CAUVC      -------------------------MSASRLISRDPYTGEAIADFAVNDARSIDAACHSA
                                                 .  *                :      *

ASTD_SHIBS       RAAFPRWARLSLAERQVVVERFAGLLESNKAELTAIIARETGKLRWEAATEVTAMINKIA
ASTD_SHIFL       RAAFPRWARLSLAERQVVVERFAGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIA
ASTD_ECO57       RAAFPRWARLSFAERQAVVERFAGLLERNKGELTAIIARETGKPRWEAATELTAMINKIA
ASTD_ECOLI       RAAFPRWARLSFAERHAVVERFAALLESNKAELTAIIARETGKPRWEAATEVTAMINKIA
ASTD_ECOL5       RAAFPRWARLSFGDRQVRVERFAGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIA
ASTD_ECOUT       RAAFPRWARLSFGDRQVRVERFAGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIA
ASTD_ECOL6       RAAFPRWARLSFGDRQVRVERFAGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIA
ASTD_SHIDS       RAAYPRWARLSFGDRQVRVERFAGLLESNKAELTAIIARETGKPRWEAATEVTAMINKIA
ASTD_SALPA       RAAFPRWARQPFTARQAIVQKFAALLEAHKADLTEVIARETGKPRWEAATEVTAMINKIA
ASTD_SALTY       RAAFPRWARQPFAARQAIVEKFAALLEAHKAELTEVIARETGKPRWEAATEVTAMINKIA
ASTD_SALTI       RAAFPRWARQPFAARQAIVEKFSVLLEAHKADLTEVIARETGKPRWEAATEVTAMINKIA
ASTD_YERPA       RAAFPAWARASLEQRATVIQQFAALLEQHKQSLARTISLETSKPYWETLTEVQAMIGKVA
ASTD_YERPE       RAAFPAWARASLEQRATVIQQFAALLEQHKQSLARTISLETSKPYWETLTEVQAMIGKVA
ASTD_YERPS       RAAFPAWARASLEQRATVIQQFAALLEQHKQSLARTISLETSKPYWETLTEVQAMIGKVA
ASTD_ACIAD       RQAFPQWATTSLTDRIAIIERFALLLEQNKEALAKIISQETSKPLWETLTEVQSMVAKVA
ASTD_PHOLL       REAFYAWSHLPASERIKVIQTFAALLNEEKETLARVISQETSKPLWETRTEIQSMIGKAA
ASTD_PSE14       RQAFPGWAQRSLDQRIAVLEAFAASLKGRADELAHCIGEETGKPLWESATEVTSMVNKIA
ASTD_PSESM       RQAFPAWALLSLDQRIAVLDAFAVSLKAHADELANCIGEETGKPLWESATEVTSMVNKIA
ASTD_PSEU2       RQAFPGWALLSLDQRIAVLEAFAARLKHHADALAQCIGEETGKPLWESATEVTSMVNKIA
ASTD_PSEF5       RQAFPAWAKRSLEERISVLEAFAASLKSRADELARCIGEETGKPLWEAATEVTSMVNKIA
ASTD_PSEPF       RQAFPGWARRTLEDRISVLEAFAAALKNHADELARTIGEETGKPLWEAATEVTSMVNKIA
ASTD_PSEPK       RQAFPAWAQLSLEARIDVLEKFAAQLKVHAEAMAQCIGEETGKPLWESATEVTSMINKVA
ASTD_PSEAE       REAFPAWARRPLEQRIELLERFAATLKSRADELARVIGEETGKPLWESATEVTSMVNKVA
ASTD_CHRVO       RAAFPAWARMGLEERAKVVRRFGERLTERKAELARVIAQETGKPLWEATTEVTTMVGKID
ASTD_BURCA       RRAFAGWSALDFEARCEIVKRFAALLTERKEAIATAIGRETGKPLWEARTEVASMAAKVG
ASTD_BURL3       RRAFAGWSALDFESRCAIVKRFAALLNERKEAIAAAIGRETGKPLWEARTEVASMAAKVG
ASTD_BURMA       RRAFAAWSALDLDARCAIVKRFAALLVERKEALATMIGRETGKPLWEARTEVASMAAKVD
ASTD_BURP1       RRAFAAWSALDLDARCAIVKRFAALLVERKEALATMIGRETGKPLWEARTEVASMAAKVD
ASTD_BURPS       RRAFAAWSALDLDARCAIVKRFAALLVERKEALATMIGRETGKPLWEARTEVASMAAKVD
ASTD_BURTA       RRAFAAWSALDLDARCTIVKRFAALLVERKEALATMIGRETGKPLWEARTEVASMAAKVD
ASTD_PARXL       RRAFAAWSASSVDERCAVVRRFAALVTERKEALAEAIGRETGKPLWEARTEAASMAAKVE
ASTD_HAHCH       RQAFTSWGRLDVSRRIDIVKRFAELLEEDKERLADVIGKETSKPLWEARTEVASMVAKVG
ASTD_COLP3       RQAFESWANISLEARVAVVTKFAELLAENKDALATTIALETGKPKWETTGEAGAMVAKVA
ASTD_PSEA6       RKATVTWAACTFEQRLAYVKRFGELLAENKDMLALTIAQETGKPLWETATEVGAMMGKIG
ASTD2_PSEHT      RAAQLQWADTPLEQRITILENFAAQLKEHSEEFAVIIAQETGKPLWETRTEVGAMTGKVA
ASTD1_SHEDO      RAAFYTWSAMSLTERLVIVEAFAEQLKEHAELFARTIALETGKALWESRTEVGAMTGKIA
ASTD1_PSEHT      REAFYAWADKTFAERLEIVKAFAAQLKENSEELAITIAQETGKPLWETRTEAGAMVGKIA
ASTD_IDILO       RAAFPDWSGRSVEERLAICQKFSELLEENKEHLARTMAKETGKPVWETRTEVGAMMGKVA
ASTD2_SHEDO      RAAQFDWFMLGFEARLSIVEAYRSELEANKAQLAEVIAQETGKPQWETATEVGAMIGKIA
ASTD_SHEFN       RAAQFDWFMLGYEARLAIVEAYRAQLEANKAEIAETIAQETGKPQWETATEVGAMIGKIA
ASTD_SHEON       REAQFDWFILGFDARLKIVEAYRSQLEANKAELAETIAQETGKPQWETATEVAAMIGKIG
ASTD_VIBVU       RQAFVGWKTLSVAEREAVVLAFAEQVKENSEEIAQVIAKETGKPLWETRTEAAAMAGKIA
ASTD_VIBVY       RQAFVGWKKLSVAEREAMVLAFAEQVKENSEEIAQVIAKETGKPLWETRTEAAAMAGKIA
ASTD_VIBPA       RAAFVEWKKRPFAEREAIVLAFAEKVKENSEKIAEVIAKETGKPIWETRTEAAAMAGKIA
ASTD_VIBCH       RRAFLDWKKRPFAEREQKVLAFAELVKANSEQIAQVIAKETGKPLWETRTEAASIAGKIA
ASTD_ALIF1       RNAFIEWKKLPFENRQAIVERFAELVKENADSIAEVIAKETGKPFWETKTEAGAMVGKIA
ASTD_PHOPR       REALTTWRKTDLSERQAVVEKFAELVKEHSEHIAHTIAEETGKPLWETRTEAGAMVGKIA
ASTD_CHRSD       RQAFPDWARRSFAERQAVVERFRECLETHREHLATAIAQETGKPLWEARTEVGAMIGKVA
ASTD_LEGPA       HCALKSWANTSFEERARYTIAFVEQVEKNRDQLARLISLETGKPLWESQTEVSSVIGKVN
ASTD_LEGPL       HRALKSWANTSFEERARYTKAFVEQVEKNRDQLARLISLETGKPLWESQTEVSSVIGKVN
ASTD_LEGPH       HRALKSWANTSFEERARYTKAFVEQVEKNREQLARLISLETGKPLWESQTEVSSVIGKVN
ASTD2_CAUVC      RKAFPAWADRPREERIAILRRYKDILVERAAPYAEALSRETGKALWETRAELASMAGKVD
ASTD_NOVAD       RRAWPAWAAQPLATRIELVRRFANEVRKDADNLATMISRETGKPLWEARTEVDSVVNKVE
ASTD_SPHAL       RRAWPEWAAKPVTFRTETLRRFADRVKAESEAFADLIARETGKPLWEARTEVESVANKVD
ASTD1_CAUVC      RAAFAEWAMTPLAERRAIALRFAETVRARREEIATLIARETGKPMWEALTEADSVAAKVA
                 : *   *       *      :   :       :  :. **.*  **:  *  ::  *  

ASTD_SHIBS       ISIKAYHVRTGEQ-RSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTI
ASTD_SHIFL       ISIKAYHVRTGEQ-RSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTI
ASTD_ECO57       ISIKAYHVRTGEQ-RSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTI
ASTD_ECOLI       ISIKAYHVRTGEQ-RSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTI
ASTD_ECOL5       ISIKAYHVRTGEQ-RSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTI
ASTD_ECOUT       ISIKAYHVRTGEQ-RSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTI
ASTD_ECOL6       ISIKAYHVRTGEQ-RSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTI
ASTD_SHIDS       ISIKAYHVRTGEQ-RSEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTI
ASTD_SALPA       ISIKAYHARTGEQ-KSELVDGAATLRHRPHGVLAVFGPYNFPGHLPNGHIVSALLAGNTL
ASTD_SALTY       ISIKAYHARTGAQ-KSELVDGAATLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTL
ASTD_SALTI       ISIKAYHARTGEQ-KSELVDGAATLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTL
ASTD_YERPA       ISLQAYQTRTGHS-QTPMGDSMSVLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTV
ASTD_YERPE       ISLQAYQTRTGHS-QTPMGDSMSVLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTV
ASTD_YERPS       ISLQAYQTRTGHS-QTPMGDSMSVLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTV
ASTD_ACIAD       ISIRAYHQRTGKS-ITEMADGAASLRHRPHGVMAVFGPYNFPGHLPNGHIVPALIAGNVV
ASTD_PHOLL       ISIEAWEQRTGES-ETIMPDGRALLRHRPHGVMAVFGPYNFPGHLPNGHIIPALIAGNTL
ASTD_PSE14       ISVQSYRERTGEK-SGPLGDATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNTV
ASTD_PSESM       ISVQSYRERTGEK-SAPLGDATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNTV
ASTD_PSEU2       ISVQSYRERTGEK-SGPLGDATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNVV
ASTD_PSEF5       ISVQSYRERTGEK-SGPLGDATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNSV
ASTD_PSEPF       ISVQSYRERTGEK-SGPLGDATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNSV
ASTD_PSEPK       ISVQSYRERTGEK-SGPLADATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNCV
ASTD_PSEAE       ISVQAFRERTGEK-SGPLADATAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNCV
ASTD_CHRVO       ISLKALAERTGER-AAAMGDAQAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNSV
ASTD_BURCA       ISIQAYQERTGEK-RQDMADGVAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAGNTV
ASTD_BURL3       ISIQAYQERTGEK-RQDMADGVAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAGNAV
ASTD_BURMA       VSIAAYHERTGER-RSPTADGVAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAGNTV
ASTD_BURP1       VSIAAYHERTGER-RSPTADGVAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAGNTV
ASTD_BURPS       VSIAAYHERTGER-RSPTADGVAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAGNTV
ASTD_BURTA       ISITAYHERTGEK-RAPMADGVAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAGNTV
ASTD_PARXL       ISIQAYNERTGEK-RSAMADGTAVLRHRPHGVVAVFGPYNFPGHLPNGHIVPALIAGNAV
ASTD_HAHCH       ISIQAFNERTGVS-EQDVAAGHAVLKHRPHGVLAVFGPYNFPGHLPNGHIVPALIAGNTI
ASTD_COLP3       ISLKAYNERTGTV-ENPMPGAKAFIRHKPHGVVAIFGPYNFPGHLPNGHIVPALIAGNTI
ASTD_PSEA6       ISERAYQERTGLV-ENPMPVGKAFIRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNCI
ASTD2_PSEHT      ISVKAYNERTGTT-ENPMPGAKAFIRHKPHGVVAIFGPYNFPGHLPNGHIVPAILAGNTV
ASTD1_SHEDO      ISIKANAERTGTV-ENPMPGAKAFIRHKPHGVVAVFGPYNFPGHLPNGHIVPALIAGNTV
ASTD1_PSEHT      ISEKAFLERTGDV-ENAMPLGRAMIRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNTV
ASTD_IDILO       ISERAYHERTGTV-ENDMPGAKAFIRHKPHGVVAVYGPYNFPGHLPNGHIVPALIAGNTV
ASTD2_SHEDO      LSAAAHDKRTGTE-TNELAAGRAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNTV
ASTD_SHEFN       LSAKAHDKRTGTE-TNDLPAGRAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNTV
ASTD_SHEON       LSASAYNKRTGTE-TNDTPAGRAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNSV
ASTD_VIBVU       ISIRAYHERTGES-QKEAAGNQIVLRHRPLGVMAVFGPYNFPGHLPNGHIVPALLAGNTV
ASTD_VIBVY       ISIRAYHERTGES-QKEAAGNQIVLRHRPLGVMAVFGPYNFPGHLPNGHIVPALLAGNTV
ASTD_VIBPA       ISIRAYHDRTGEA-TREAAGNQIVLRHRPLGVMAVFGPYNFPGHLPNGHIVPALLAGNTV
ASTD_VIBCH       ISIRAYHERTGET-VREAAGNQLVLRHRPLGVMAVFGPYNFPGHLPNGHIVPALLAGNTV
ASTD_ALIF1       ISIRAYHERTPYK-EREAAGNKIVLRHRPLGVMAVFGPYNFPGHLPNGHIVPALLAGNTV
ASTD_PHOPR       ISLRAYHERTGEK-QKDIAGTAAVLRHRPLGVMAVFGPYNFPGHLPNGHIVPALLSGNTV
ASTD_CHRSD       ISITAYHERTGER-ARDIGDARAVLRHRPHGVLAVYGPYNFPGHLPNGHIVPALLAGNAV
ASTD_LEGPA       LSIQAYQERTWPK-QTETAEANACLRFKPHGVVVVLGAFNFPAHLSNGHIVPALLAGNTV
ASTD_LEGPL       LSIQAYQERTWPK-QTETAEANACLRFKPHGVVVVLGAFNFPAHLSNGHIVPALLAGNTV
ASTD_LEGPH       LSIQAYQERTWPK-QTETAEANACLRFKPHGIVVVLGAFNFPAHLSNGHIVPALLAGNTV
ASTD2_CAUVC      LSIRAYDERTGVT-ENAMPFGRAVLRHRAHGVMAVLGPFNFPGHLPNGHIVPALLAGDTV
ASTD_NOVAD       ISIRAYADRTSQRKLDSALQGTAALRHKPHGVLAVLGPYNFPAHLPNGHIVPALIAGNAV
ASTD_SPHAL       ISVKAYAERTPNRRIEGAMGLRSAVRHKPHGALAVLGPYNFPAHLPNGHIVPALIAGNSV
ASTD1_CAUVC      ISIRAQDERAGER-SEPMADATARLAHRPHGVLAVIGPFNFPMHLANGHIVPALLAGNAV
                 :*  :   *:              : .:. * :.: *.:*** **.****:.*:::*: :

ASTD_SHIBS       IFKPSELTPWSGEAVMRLWQQAGLPPGVLNLVQGGRETGQALSALEDLDGLLFTGRANTG
ASTD_SHIFL       IFKPSELTPWSGEAVMRLWQQAGLPPGVLNLVQGGRETGQALSALEDLDGLLFTGSANTG
ASTD_ECO57       IFKPSELTPWSGEAVMRLWQQAGLPPGVLNLVQGGCETGQALSALEDLDGLLFTGSANTG
ASTD_ECOLI       IFKPSELTPWSGEAVMRLWQQAGLPPGVLNLVQGGRETGQALSALEDLDGLLFTGSANTG
ASTD_ECOL5       IFKPSELTPWSGDAVMRLWQQAGLPPGVLNLVQGGRATGQALSALEDLDGLLFTGSANTG
ASTD_ECOUT       IFKPSELTPWSGDAVMRLWQQAGLPPGVLNLVQGGRETGQALSALEDLDGLLFTGSANTG
ASTD_ECOL6       IFKPSELTPWSGEAVMRLWQQAGLPPGVLNLVQGGRATGQALSALEDLDGLLFTGSANTG
ASTD_SHIDS       IFKPSELTPWSGEAVMRLWQQAGLPPGVLNLVQGGRETGQALSALEDLDGLLFTGSANTG
ASTD_SALPA       IFKPSELTPWTGETVIKLWERAGLPAGVLNLVQGGRETGQALSSLDDLDGLLFTGSASTG
ASTD_SALTY       IFKPSELTPWTGETVIKLWERAGLPAGVLNLVQGGRETGQALSSLDDLDGLLFTGSASTG
ASTD_SALTI       IFKPSELTPWTGETVIKLWERAGLPAGVLNLVQGGRETGQALSSLDDLDGLLFTGSASTG
ASTD_YERPA       VFKPSELTPWTAEETVKLWQQAGIPDGVLNLVQGGRETGEALAAQPDIDGLLFTGSAHTG
ASTD_YERPE       VFKPSELTPWTAEETVKLWQQAGIPDGVLNLVQGGRETGEALAAQPDIDGLLFTGSAHTG
ASTD_YERPS       VFKPSELTPWTAEETVKLWQEAGIPDGVLNLVQGGRETGEALAAQPDIDGLLFTGSAHTG
ASTD_ACIAD       VFKPSELTPWTAEATVKLWQQAGLPNAVLNLLQGSRETGIALAQSEHIDGVLFTGSASTG
ASTD_PHOLL       VFKPSELTPMTAEETVKLWEKAGLPAGVLNLVQGARSTGTALLEDKQIDGVLFTGSANTG
ASTD_PSE14       VFKPSELTPKVAELTVKCWIEAGLPAGVLNLLQGGRETGIALAANPGIDGLFFTGSSRTG
ASTD_PSESM       LFKPSELTPKVAELTVKCWIEAGLPAGVLNLLQGGRETGIALAANPGIDGLFFTGSSRTG
ASTD_PSEU2       LFKPSELTPKVAELTVKCWIEAGLPAGVLNLLQGGRETGIALAANPGIDGLFFTGSSRTG
ASTD_PSEF5       LFKPSELTPKVAELTVQCWIEAGLPAGVLNLLQGARETGIALAANPGIDGLFFTGSSRTG
ASTD_PSEPF       LFKPSELTPKVAELTVKCWIEAGLPAGVLNLLQGARETGIALAANPGIDGLFFTGSSRTG
ASTD_PSEPK       VFKPSELTPKVAELTVNCWIAAGLPAGVLNLVQGARETGVALAANPGIDGLFFTGSSRTG
ASTD_PSEAE       VFKPSELTPKVAELTLKAWIQAGLPAGVLNLVQGGRETGVALAAHRGLDGLFFTGSSRTG
ASTD_CHRVO       IFKPSELTPWTAEETVKLWAEAGLPAGVIGLVQGAKDTGVALAGHEGLDGLFFTGSSATG
ASTD_BURCA       VFKPSELAPGVARATVEVWQEAGLPAGVLNLVQGEKDTGIALANHRQIDGLFFTGSSDTG
ASTD_BURL3       VFKPSELAPGVARATVEVWKEAGLPDGVLNLVQGEKDTGIALANHRQIDGLFFTGSSDTG
ASTD_BURMA       VFKPSELAPGVARATVEIWRDAGLPAGVLNLVQGEKDTGVALANHRQIDGLFFTGSSDTG
ASTD_BURP1       VFKPSELAPGVARATVEIWRDAGLPAGVLNLVQGEKDTGVALANHRQIDGLFFTGSSDTG
ASTD_BURPS       VFKPSELAPGVARATVEIWRDAGLPAGVLNLVQGEKDTGVALANHRQIDGLFFTGSSDTG
ASTD_BURTA       VFKPSELAPGVARATVEIWRDAGLPAGVLNLVQGEKDTGVALANHRQIDGLFFTGSSDTG
ASTD_PARXL       VFKPSELAPGVAALTVQIWRDAGLPAGVLNLVQGEKDTGIALANHRQIDGLFFTGSSDTG
ASTD_HAHCH       VFKPSELTPWFAEETVRIWAKAGLPDGVLNLVQGARETGVALAANDGIDGLLFTGSSPTG
ASTD_COLP3       VFKPSELTPRVAQEMLKLWEQAGLPNGVINLVQGEVETGKALASHKLIDGLFFTGSSNTG
ASTD_PSEA6       VFKPSDLTPLVAERTVQLWEKAGLPKGVLNLVQGEVETGKALAAHPDLDGLFFTGSSRTG
ASTD2_PSEHT      VFKPSELTPHVAQFTLSLWLKAGLPAGVINLVQGEIETGKALAAHQDIDGLFFTGSSNTG
ASTD1_SHEDO      LFKPSELTPKVAELTMQLWQQAGLPNGVLNLLQGEIATGKALASHKGIDGLFFTGSSNTG
ASTD1_PSEHT      IFKPSELTPKVAELTLKLWEKAGLPAGVINLVQGEVATGKALAAHKGIDGLFFTGSSRTG
ASTD_IDILO       VFKPSELTPMVAQETVKLWEKAGIPAGVLNLVQGEVDTGKALSAHPQIDGLYFTGSSNTG
ASTD2_SHEDO      VFKPSELTPKVAEEMLKLWDKAGLPKGVINLVQGEVETGKALASHPQIDGLFFTGSSRTG
ASTD_SHEFN       VFKPSELTPKVAELMLKCWDKAGLPQGVVNLVQGEVETGKALASHPQIDGLFFTGSSRTG
ASTD_SHEON       VFKPSELTPKVAELMVTLWEKSGLPAGVLNLVQGEVDTGKALASHPQLDGLFFTGSSRTG
ASTD_VIBVU       VFKPSEQTPWTGELAMKLWQAAGLPQGVINLVQGGKETGIALAESKGIDGLLFTGSANTG
ASTD_VIBVY       VFKPSEQTPWTGELAMKLWQAAGLPQGVINLVQGGKETGIALAESKGIDGLLFTGSANTG
ASTD_VIBPA       VFKPSEQTPWTGELAMKLWEEAGLPKGVINLVQGAKETGIALADAKGIDGILFTGSANTG
ASTD_VIBCH       VFKPSEQTPWTGEVLMQLWQQAGLPAGVINLVQGSKETGIALAQSRGIDGLLFTGSANTG
ASTD_ALIF1       VLKPSEQTPWTSEVIMKLWQKSGLPKGVINLVQGARATGEALANTKGIDGLLFTGSANTG
ASTD_PHOPR       VFKPSELTPKVAQETMKLWEQAGLPKGVLNMVQGARPTGEALAGSKGIDGLLFTGSANTG
ASTD_CHRSD       VFKPSEQTPMTADLTLQCWLEAGLPAGVINLVQGAAEVGQALAGSADIDGLLFTGSAKVG
ASTD_LEGPA       LYKPSEHTPAVAELIIQCWHNSGLPPGVINCLQGNANCGNTLLS-QDIQGVYFTGSYATG
ASTD_LEGPL       LYKPSEHTPAVAELIIQCWHDSGLPPGVINCLQGNANCGNTLLS-QDIQGVYFTGSYATG
ASTD_LEGPH       LYKPSEHTPAVAELIIQCWHDSGLPPGVINCLQGNANCGNTLLS-QDIQGVYFTGSYATG
ASTD2_CAUVC      VFKPSEETPLAGQLMVEALEAAGAPAGVVNLVQGGRETGQALIA-QDIDGLLFTGSAAAG
ASTD_NOVAD       VFKPSEKTPATGEMLAQCFHRAGIPAAVVQVLIGGPEEGQALVAHDGIDGVLFTGSAHAG
ASTD_SPHAL       VFKPSEKTPAVGAKLVELLHSAGVPQEVLRLVVGGPDTGKALAAHPGIDGLLFTGSARTG
ASTD1_CAUVC      VFKPSEKTPACGQLMGELWRAAGLPDHVLTIVIGGGEAGEALVRHEALDGVLFTGGVQAG
                 : ***: :*  .         :* *  *:  : *    * :*     ::*: ***   .*

ASTD_SHIBS       YQLHRQLSGQPEKILALEMGGNNPLIIDE-VADIDAAVHLTIQSAFVTAGQRCTCARRLL
ASTD_SHIFL       YQLHRQLSGQPEKILALEMGGNNPLIIDE-VADIDAAVHLTIQSAFVTAGQRCTCARRLL
ASTD_ECO57       YQLHRQLSGQPEKILALEMGGNNPLIIDE-VADIDAAVHLTIQSAFVTAGQRCTCARRVL
ASTD_ECOLI       YQLHRQLSGQPEKILALEMGGNNPLIIDE-VADIDAAVHLTIQSAFVTAGQRCTCARRLL
ASTD_ECOL5       YQLHRQLSGQPEKILALEMGGNNPLIIDE-VADIDAAVHLTIQSAFVTAGQRCTCARRLF
ASTD_ECOUT       YQLHRQLSGQPEKILALEMGGNNPLIIDE-VADIDAAVHLTIQSAFVTAGQRCTCARRLF
ASTD_ECOL6       YQLHRQLSGQPEKILALEMGGNNPLIIDE-VADIDAAVHLTIQSAFVTAGQRCTCARRLF
ASTD_SHIDS       YQLHRQLSGQPEKILALEMGGNNPLIIDE-VADIDAAVHLTIQSAFVTAGQRCTCARRLL
ASTD_SALPA       YQLHRQLSGQPEKILALEMGGNNPLIIED-VANIDAAVHLTLQSAFITAGQRCTCARRLL
ASTD_SALTY       YQLHRQLSGQPEKILALEMGGNNPLIIED-AANIDAAVHLTLQSAFITAGQRCTCARRLL
ASTD_SALTI       YQLHRQLSGQPEKILALEMGGNNPLIIED-ATNMDAAVHLTLQSAFITAGQRCTCARRLL
ASTD_YERPA       YHLHRQLAGQPEKMLALEMGGNNALIVEQ-VKDRDAVVNLAIQSAFISAGQRCTCSRRLL
ASTD_YERPE       YHLHRQLAGQPEKMLALEMGGNNALIVEQ-VKDRDAVVNLAIQSAFISAGQRCTCSRRLL
ASTD_YERPS       YHLHRQLAGQPEKMLALEMGGNNALIVEQ-VKDRDAVVNLAIQSAFISAGQRCTCSRRLL
ASTD_ACIAD       YQLHRQLAGAPEKILALEMGGNNALIIED-IDDIDAVVHLAIQSAFISAGQRCTCARRLI
ASTD_PHOLL       FHFHRMLGGQPEKMLALEMGGNNALIVDA-YDDIDAAVYTIVQSAFISAGQRCTCARRLL
ASTD_PSE14       DALHQQFAGRPDKILALEMGGNNPLIVDQ-VQDIEAAVYNIIQSAFISAGQRCTCARRLL
ASTD_PSESM       NALHQQFAGRPDKILALEMGGNNPLVVDQ-VQDIDAAVYTIIQSAFISAGQRCTCARRLL
ASTD_PSEU2       NALHQQFAGRPDKILALEMGGNNPLIVDQ-VQDIDAAVYTIIQSAFISAGQRCTCARRLL
ASTD_PSEF5       NHLHQQFAGRPDKILALEMGGNNPLVVEQ-VADLDAAVYTIIQSAFISAGQRCTCARRLL
ASTD_PSEPF       NHLHQQFAGRPDKILALEMGGNNPLVVDQ-VADIDAAVYTIIQSAFISAGQRCTCARRLL
ASTD_PSEPK       NLLHQQFAGRPDKILALEMGGNNPLVVDE-VKDLDAAVYTIIQSAFISAGQRCTCARRLL
ASTD_PSEAE       NLLHSQFGGQPQKILALEMGGNNPLVVEE-VADLDAAVYTIIQSAFISAGQRCTCARRLL
ASTD_CHRVO       ALLHKQFSGRPDKILALEMGGNNPLIVGE-VADVDGAVHHVIQSAFVSAGQRCTCARRLL
ASTD_BURCA       TLLHKQFGGRPEIVLALEMGGNNPLVIGE-VEDIDAAVHHTIQSAFLSAGQRCTCARRIF
ASTD_BURL3       TLLHKQFGGRPEIVLALEMGGNNPLVIGE-VEDIDAAVHHTIQSAFLSAGQRCTCARRIF
ASTD_BURMA       TLLHRQFGGRPEIVLALEMGGNNPLVVAD-VEDIDAAVHHAIQSAFLSAGQRCTCARRIL
ASTD_BURP1       TLLHRQFGGRPEIVLALEMGGNNPLVVAD-VEDIDAAVHHAIQSAFLSAGQRCTCARRIL
ASTD_BURPS       TLLHRQFGGRPEIVLALEMGGNNPLVVAD-VEDIDAAVHHAIQSAFLSAGQRCTCARRIL
ASTD_BURTA       TLLHKQFGGRPEIVLALEMGGNNPLVVAE-VEDIDAAVHHAIQSAFLSAGQRCTCARRIL
ASTD_PARXL       TLLHKQFGGRPEIVLALEMGGNNPLVIGP-VADVDAAVHHTIQSAFLSAGQRCTCARRIF
ASTD_HAHCH       HSLHRQFGGRPEKILALEMGGNNPLIIAP-PYDLKGAVHHTLFSAFVSAGQRCTCARRLL
ASTD_COLP3       HILHEQFAGQPGKILALEMGGNNPLVVKD-VSDIDAVVHDIVQSAFVTTGQRCTCARRLF
ASTD_PSEA6       KILHEQYAGHPGKILALEMGGNNPLIVKD-ISDIDATVHDIIQSAFVTSGQRCTCARKLF
ASTD2_PSEHT      HLLHKQFAGHPGKILALEMGGNNPLIIKD-VNDVSAAVHDIIQSGFITSGQRCTCARRVF
ASTD1_SHEDO      HLLHQQYAGQPGKILALEMGGNNPLIITE-VANVDAAVHDIIQSAFISSGQRCTCARRLF
ASTD1_PSEHT      HILHEQFAGQPGKILALEMGGNNPLIITD-VEDTKAVVHDIIQSAFISSGQRCTCARKLF
ASTD_IDILO       HLLHKQFGGRPDKILALEMGGNNPLLVTN-VADVDAAVHNIVQSAFITSGQRCTCARRLF
ASTD2_SHEDO      HILHQQYAGHPGKILALEMGGNNPLIVKG-VSDTKAAVHDIIQSAYISSGQRCTCARRLY
ASTD_SHEFN       HILHEQYAGLPGKILALEMGGNNPLIVKG-VTDTKAAVHDIIQSAYISSGQRCTCARRLY
ASTD_SHEON       HLLHQQYAGHPGKILALEMGGNNPLIIKG-VADIKAAVHDILQSAYISSGQRCTCARRLY
ASTD_VIBVU       HLLHRQFAGQPGKMLALEMGGNNPMVITDHYGDLDATVYTIIQSAFISAGQRCTCARRLY
ASTD_VIBVY       HLLHRQFAGQPGKMLALEMGGNNPMVITDHYGDLDATVYTIIQSAFISAGQRCTCARRLY
ASTD_VIBPA       HILHRQFAGQPGKMLALEMGGNNPMVISDNYGDLDATVYTIIQSAFISAGQRCTCARRLY
ASTD_VIBCH       HLLHRQFAGQPDKMLALEMGGNNPMVISEHYGDLDATVYTIIQSAFISSGQRCTCVRRLY
ASTD_ALIF1       HILHRQFAGDTGKMLALEMGGNNPMVISKAFGDLDATVYTIVQSAFISAGQRCTCARRLY
ASTD_PHOPR       HILHRQYAGQPGKMLALEMGGNNPMVISKSYGELDATVYTIIQSAFISAGQRCTCARRLY
ASTD_CHRSD       GLLHRQFGGQVDKILALELGGNNPLVVKD-VPDREAAVLSILQSAFASGGQRCTCARRLI
ASTD_LEGPA       LRIHQQFCNRPEVILALEMGGNNPLVIDE-VKDINAAVYHTMLSTMITAGQRCTCARRII
ASTD_LEGPL       LRIHQQFCNRPEIILALEMGGNNPLVIDE-VKDIDAAVYHTMLSTMITAGQRCTCARRII
ASTD_LEGPH       LRIHQQFCNRPEVILALEMGGNNPLVIDE-VKDIDAAVYHTILSTMITAGQRCTCARRII
ASTD2_CAUVC      TYFRRYFADRPDVILALELGGNNPLVVWNADDAPEAVAALIVQSAFITTGQRCSCARRLI
ASTD_NOVAD       IAINRKLASNPGKIVALEMGGNNPIVVWD-TPKIEDAATLIVQSAFTSAGQRCTAARRLI
ASTD_SPHAL       LALNRQFAGQPGKMLALEMGGNNPIVAWD-TADIRTAAILIVQSAFLSAGQRCSNARRLI
ASTD1_CAUVC      RAIHRALADAPHKILALELGGNAPLVVWD-VADIEAAAHLIVQSAYVTAGQRCTCARRLI
                   :.    .    ::***:*** .::          ..   : *   : ****:  *:: 

ASTD_SHIBS       LKSGAQGDAFLARLVAVSQRLTPGNWDDEPQPFIGGLISEQAAQQVVTAWQQLEAMGGRT
ASTD_SHIFL       LKSGAQGDAFLASLVAVSQRLTPGNWDDEPQPFIGGLISEQAAQQVVTAWQQLEAMGGRT
ASTD_ECO57       LKSGAQGDAFLARLVAVSQRLTPGNWDDEPQPFIGGLISEQAAQQVFTAWQQLEAMGGRT
ASTD_ECOLI       LKSGAQGDAFLARLVAVSQRLTPGNWDDEPQPFIGGLISEQAAQQVVTAWQQLEAMGGRP
ASTD_ECOL5       LKSGTQGDAFLARLVAVSQRLTPGTWDDEPQPFIGGLISEQAAQQVVTAWQELEAMGGRT
ASTD_ECOUT       LKSGTQGDAFLARLVAVSQRLTPGTWDDEPQPFIGGLISEQAAQQVVTAWQELEAMGGRT
ASTD_ECOL6       LKSGTQGDAFLARMVAVSQRLTPGTWDDEPQPFIGGLISEQAAQQVVTAWQELEAMGGRT
ASTD_SHIDS       LKSGAQGDAFLARLVAVSQRLTPGNWDDEPQPFIGGLISEQAAQQVVTAWQQLEAMGGRT
ASTD_SALPA       VKQGAQGDAFLARLVDVAGRLQPGRWDDDPQSFIGGLISAQAAQHVMEAWRQREALGGRT
ASTD_SALTY       VKQGAQGDAFLARLVDVAGRLQPGRWDDDPQPFIGGLISAQAAQHVMEAWRQREALGGRT
ASTD_SALTI       VKQGAQGDAFLARLVDVAGRLQPGRWDDDPQPFIGGLISAQAAQHVMEAWRQREALGGRT
ASTD_YERPA       VKTGAEGDAFLLRFTAVAQALRIGRWDEQPAPFMGAVISSQAAERMLAAQQHLLLLGGES
ASTD_YERPE       VKTGAEGDAFLLRFTAVAQALRIGRWDEQPAPFMGAVISSQAAERMLAAQQHLLLLGGES
ASTD_YERPS       VKTGAEGDAFLLRFTAVAQALRIGRWDEQPAPFMGAVISSQAAERMLAAQQHLLLLGGES
ASTD_ACIAD       IKNGQAGDAFIQRFIEVARDLVIGDWDAEPQPFMGGVISVKAAEALLKAQQNLIDLGARS
ASTD_PHOLL       VKNGAHGDAVIKRLVEVTERIVPSHWDAQPQPFIGGVISLQAVQNLLEAQDRLQKLGGIS
ASTD_PSE14       VPEGDWGDALLARLVAVSATIEVGAFDQQPSPFMGSVISLEAAHALLDAQRNLLANGAVT
ASTD_PSESM       VPEGDWGDALLARLVAVSATLDVGAFDQQPAPFMGSVISLEAARALLDAQRHLLANGAVT
ASTD_PSEU2       VPEGDWGDALLARLVGVSATIEAGAFDQQPAPFMGSVISLEAARALLDAQRNLLANGALT
ASTD_PSEF5       VPQGAWGDTLLARLVAVSATIEVGAFDQQPAPFMGSVISLGAARALMDAQQQLLANGAVA
ASTD_PSEPF       VPEGAWGDSLLKRLVEVSSTIEVGAFDQQPAPFMGSVVSLGAAKALMDAQAHLLANGAVS
ASTD_PSEPK       VPQGAWGDALIARLVEVCKTITVGAFDEQPAPFMGSVISLQAARALLAAQVELAAKGGVK
ASTD_PSEAE       VPQGAWGDALLARLVAVSATLRVGRFDEQPAPFMGAVISLSAAEHLLKAQEHLIGKGAQP
ASTD_CHRVO       VPQGEWGDAFVARLVEVAGKLRVGKFDAEPAPFLGAVISNAAADALLKAQDDLVAAGGTP
ASTD_BURCA       VPQGAFGDRFLARFADVTSKITADVFDADPQPFMGAVISARAAAKLVDAQARLVEQGAKP
ASTD_BURL3       VPQGAFGDRFLARLTDVTSKITADVFDADPQPFMGAVISARAAAKLVDAQSRLIEQGAKP
ASTD_BURMA       VPRGAFGDRFLERFADVASRITADVYDADPQPFMGAVISARAASRLVAAQAKLLELGAAP
ASTD_BURP1       VPRGAFGDRFLERFADVASRITADVYDADPQPFMGAVISARAASRLVAAQAKLLELGAAP
ASTD_BURPS       VPRGAFGDRFLERFADVASRITADVYDADPQPFMGAVISARAASRLVAAQAKLLELGAAP
ASTD_BURTA       VPRGAFGDRFVARLADVASKITASVFDADPQPFMGAVISARAASRLVAAQARLVGLGASP
ASTD_PARXL       VPNDAAGDRFLERFTEVTSRITVGEYNADPQPFMGAVISVRAASRLVAAQERLLADGAKA
ASTD_HAHCH       VPDTAEGQAFLDELIAAAANLQVGRYDADPQPFMGGVISLRARDQMLAAQNKLAAEGGRI
ASTD_COLP3       IEANEQGDAILARLIEVTKNLTIGYYDDEAQPFMGSMISEKAALSLVDAQAKLLALGAKS
ASTD_PSEA6       LENNTQGDAILARLIEVTKNIKVGDYDADEQPFMGAMISKNAAHAMVMAQQQLLDLGATS
ASTD2_PSEHT      IENSSNGDAILAKLISATKNIVVDDSFATEQPFMGAMISEKAALGMVAAQNELVAKGAEV
ASTD1_SHEDO      IPKTANGDAILAKLLTSTAKIALGDPFAETQPFFGAMISDKAAAGMVKAQADIQAAGGVS
ASTD1_PSEHT      LPTGSKGDVILERLITATKAIKVGNYDDADQPFMGSMISSAAAAGMVKAQNELVELGAQV
ASTD_IDILO       IEDSEQGRAVLERLIEVTENILVDDYEADPQPFMGAMISAKAAGEMVDAQNELLHKGAKS
ASTD2_SHEDO      IEQGAAGDELIAQLITAVNNIQVGAWNSQPQPFMGSMISETAARGMVAAQATLQALGGVS
ASTD_SHEFN       IEEGAQGDALIAELVKAIKQIKVGAWNVQPQPFMGSMISETAARGMVAAQATLQSLGGVS
ASTD_SHEON       VEQGEQGDALVAKLVEAVKQIKVGPWNAQPQPFMGSMISEAAAKGMVAAQANLLSLGGVP
ASTD_VIBVU       IPLGEKGDALITRLVEATKKLRVDQPFAEPAPFMGPQISVAAANFILAAQANLQSLGGES
ASTD_VIBVY       IPLGEKGDALITRLVEATKKLRVDQPFAEPAPFMGPQISEAAANFILAAQANLQSLGGES
ASTD_VIBPA       VPFGEKGDALITKLVEATKNIRMDQPFAEPAPFMGPQISVAAAKFILDAQANLQSLGGES
ASTD_VIBCH       VPQGTKGDALLDKLVSVTAKLRIDQPFAEPAPFMGPLVSEAAAQAILKAQADLQALGGKS
ASTD_ALIF1       VPEGKQGDALLARLVDVTKNIHVDQPFSETTPFMGPQISIAAAEFILNAQKKLQALGGES
ASTD_PHOPR       LPQGIEGDAILNRLVEATAKIRIGGPFAEPQPFMGPQISERAADGIIAAQANLVSLGGEV
ASTD_CHRSD       VPHGAVGDDLIDALTSAIAELRVAAPFSEPAPFYAGLTSVEAADGLLAAQDDLVARGGRP
ASTD_LEGPA       IPDSQTGDLFLERFAKACKLMRIGSFDSQPEPFIGPVINHVQALKHLHAQKQLIEIGGEI
ASTD_LEGPL       VPDSQTGDLFLERFAKACKLMRIGSFDSQPEPFIGPVISHVQALKHLHAQKQLVEMGGEI
ASTD_LEGPH       IPDSQTGDLFLERFAKACKLMRIGSFDSQPEPFIGPVISHVQALKHLHAQKQLIEMGGEI
ASTD2_CAUVC      VPDDASGAAIIEATVALAERLVIGAWNAENEPFMGPLISGRAAKAAREVAS--ATPGKTI
ASTD_NOVAD       I-KASMFDEVIDHVKRLADRIIVGAPFDDPAPFMGPVIDNRTADGLTESFVYLLSSGGRP
ASTD_SPHAL       V-KDSLADALIAEVRELANRLIVDHPHADPAPYMGPVIDNEAADGLTESFLVLMSNGGQV
ASTD1_CAUVC      LPEGARGDALLEALTMLMDRLVIGGPFQSPAPFMGPVIDAHAAAQVLAAQDRMTADGGRP
                 :        .:         :          .: .   .                 *   

ASTD_SHIBS       LLAPRLLQLETSLLTPGIIEMTG-VAGVPDEEVFGPLLRVWRYDSFEEAILMANNTRFGL
ASTD_SHIFL       LLAPRLLQAGTSLLTPGIIEMTG-VGGVPDEEVFGPFLRVWRYDTFDEAIRMANNTRFGL
ASTD_ECO57       LLAPRLLQAGTSLLTPGIIEMTG-VAGVPDEEVFGPLLRVWRYDSFEEAIRMANNTRFGL
ASTD_ECOLI       LLAPRLLQAGTSLLTPGIIEMTG-VAGVPDEEVFGPLLRVWRYDTFDEAIRMANNTRFGL
ASTD_ECOL5       LLAPRLLQAGTSLLTPGIIEMTG-VTGLPDEEVFGPLLRVWRYDTFDEAIRMANNTRFGL
ASTD_ECOUT       LLAPRLLQAGTSLLTPGIIEMTG-VTGLPDEEVFGPLLRVWRYDNFDEAIRMANNTRFGL
ASTD_ECOL6       LLAPRLLQAGTSLLTPGIIEMTG-VTGVPDEEVFGPLLRVWRYDNFDEAIRMANNTRFGL
ASTD_SHIDS       LLAPRLFQAETSLLTPGIIEMTG-VAGVPDEEVFGPLLRVWRCDTFDEAIRMANNTRFGL
ASTD_SALPA       LLASRKVKEGTSLLTPGIIELTG-VADVPDEEVFGPLLNVWRYAHFDEAIRLANNTRFGL
ASTD_SALTY       LLAPRKVKEGTSLLTPGIIELTG-VADVPDEEVFGPLLNVWRYAHFDEAIRLANNTRFGL
ASTD_SALTI       LLAPRKVKEGTSLLTPGIIELTG-VADVPDEEVFGPLLNVWRYAHFDEAIRLANNTRFGL
ASTD_YERPA       LLNMTRPDSQSALLTPGIIDITN-ISEVPDEEYFGPLVSVIRYTDFTEALKIANQTRFGL
ASTD_YERPE       LLNMTRPDSQSALLTPGIIDITN-ISEVPDEEYFGPLVSVIRYTDFTEALKIANQTRFGL
ASTD_YERPS       LLNMTRPDSQSALLTPGIIDITN-ISEVPDEEYFGPLVSVIRYTDFTEALKIANQTRFGL
ASTD_ACIAD       LLEMKQLRENSALVSPAILDVTA-VPDIPDEEYFGPLTCIYRYDDFDEALKLANSTRFGL
ASTD_PHOLL       LVSLEQCQPQSTLLTPGIIDVSQ-VADVPDEEYFGPLLMLMRYDTFDEALAIANNTRFGL
ASTD_PSE14       LLEMRQPQAGAALLTPGIINVSA-VAERPDEELFGPLLQVIRYAGFDAAIAEANATRYGL
ASTD_PSESM       LLEMRQPQPGAALLTPGIVDVSA-VANRPDVELFGPLLQVVRYAGFDAAIAEANATQYGL
ASTD_PSEU2       LLEMRQPQPGAALLTPGIIDVSA-VPERPDEELFGPLLQVIRYAGFDAAIAEANATRYGL
ASTD_PSEF5       LLEMTQPQAQAALLTPGILDVSA-VAERPDEELFGPLLQVIRYADFDDAIAEANNTQYGL
ASTD_PSEPF       LLAMTQPQAQSALLTPGIVDVTA-VADRSDEELFGPLLQVIRYADFAAAIAEANDTAFGL
ASTD_PSEPK       LLEMTQPQADAALLTPGIVDVTA-VADRPDEEFFGPLLQVIRYADFDAAIDEANNTQYGL
ASTD_PSEAE       LLAMTQPIDGAALLTPGILDVSA-VAERPDEEFFGPLLQVIRYSDFAAAIREANATQYGL
ASTD_CHRVO       LLAMRRLEEGAAMLTPGIIDTTA-AV-RPDEEFFGPLLQVIRYADFDQAIAIANDTRFGL
ASTD_BURCA       IVAMAQRDPRLGFVNAAIVDVTG-VANLPDEEHFGPLAQVVRYATFDEAIERANDTAFGL
ASTD_BURL3       IIAMTQRDPRLGFVNAAIVDVTG-VANLPDEEHFGPLAQIVRYATFDDAIERANDTAFGL
ASTD_BURMA       IIEMRQRDPALGFVNASILDVTP-VRELPDEEHFGPLAQIVRYTDLDDAIARANDTAFGL
ASTD_BURP1       IIEMRQRDPALGFVNASILDVTP-VRELPDEEHFGPLAQIVRYTDLDDAIARANDTAFGL
ASTD_BURPS       IIEMRQRDPALGFVNASILDVTP-VRELPDEEHFGPLAQIVRYTDLDDAIARANDTAFGL
ASTD_BURTA       IIEMKQRDPALGFVNAAILDVTN-VRELPDEEHFGPLAQIVRYTDLDDAIARANDTAFGL
ASTD_PARXL       LLKMEQRDPKLGFVTPAILDVTN-VANRPDEEHFGPLAQIIRYGSFNEALEQANDTEFGL
ASTD_HAHCH       LLEMRSLEENASLLSPGVIDVTD-VQELPDEEHFGPMLQVLRYRDFDHALELANKTGFGL
ASTD_COLP3       VLDLKHLEVGTGFVSPGIIDVSDIIADIPDEEYFGPLVKLYRYNDFDKAIDEANNTGFGL
ASTD_PSEA6       LVELTHLDPESGFVSPGIIDVTAMVEQMPDDEHFGPLLKVVRFDDFDRAISLGNNTKFGL
ASTD2_PSEHT      LVELKQLKPGTGFVSPGIIDVTN-VNDMPDEEHFGPLIKIYRYSDFDSAINEANNTSFGL
ASTD1_SHEDO      LIELTQVTPGLGFVTPGIIDVTD-ASPLADEEHFGPLLKVYRYTDFDAAIDEANNTSFGL
ASTD1_PSEHT      LVELEH-TVNTGFVTPGIIECTN-ISDFPDEEHFGPLLKVFRFDDFDQAIDKANDTSFGL
ASTD_IDILO       LVRMKQTDSKKGFVTPGIVDVTG-VEDLPDEEHFGPLLKVYRFKDIDAAIKEANNTRYGL
ASTD2_SHEDO      LVELAQVEAGTGLVSPGLIDVTQ-IAELPDEEYFGPLLQLVRYTDFDEAIRLANATRYGL
ASTD_SHEFN       LVELVQVEAGTGLVTPGLIDVTK-VAELPDEEYFGPLLQLVRYSDFDQAIHLANATRYGL
ASTD_SHEON       LVELMHLQAGTGLVSPGLIDVTA-VSELPDEEYFGPLLQLVRYSDFDQAIKLANQTRYGL
ASTD_VIBVU       LIEAKA--GEAAFVTPGIIDVTN-IAELPDEEYFGPLLQVVRYQTLEQAVELANDTRFGL
ASTD_VIBVY       LIEAKA--GEAAFVTPGIIDVTN-IAELPDEEYFGPLLQVVRYQTLEQAVELANDTRFGL
ASTD_VIBPA       LIEAKA--GEAAFVSPGIIDVTN-IAELPDEEYFGPLLQVVRYEGLDKAVELANDTRFGL
ASTD_VIBCH       LLEARA--LHAAFITPAIIDVTA-IERLPDDEYFGPLLQVVRYQTLAQAVELANDTRFGL
ASTD_ALIF1       LLEARS--LGHAFVSPGIIDATN-VAELPDEEYFGPLLQVIRYTTLAQAVELANDTRYGL
ASTD_PHOPR       LLEAIR--GQGAIVSPAIIEVSN-VAELPDEEYFGPLLQVVRYQDLPDAVELANDTRYGL
ASTD_CHRSD       LSRMRRLQAGTSLLSPGLIDVTG--CDVPDEEHFGPLLKVHRYRDWDEAIALANDTRYGL
ASTD_LEGPA       ILPMSLLVEYTGLISPGIIDMTR-AKNPPDEEIFAPFAQIYRYNHFDEAIQLANQTRYGL
ASTD_LEGPL       ILPMSLLVEYTGLISPGIIDMTR-AKNPPDEEIFAPFAQIYRYNHFDEAIQLANQTRYGL
ASTD_LEGPH       ILPMSLLLEYTGLVSPGIIDMTR-AKNPPDEEIFAPFAQIYRYNHFDEAIQLANQTRYGL
ASTD2_CAUVC      LALDGVAGLGDAFLKPGIVDVTG--LETPDEELFAPLLQVRRVSSFDEALAAANATRYGL
ASTD_NOVAD       IKHMVRLQEDRPFLSPAIIDVTA-VADRPDVELFGPLLQVVRVDDFDEAIAEANNTRFGL
ASTD_SPHAL       IRHMTRPVAGRPFLTPGIIDVTT-MAERPDVELFGPLLQVIRVETFEAAIAEANNTAFGL
ASTD1_CAUVC      LRLAAVREARSALLSPGLIELTD-APLR-DEEIFGPLLQVRRAADFDAALALANATRFGL
                 :           ::...::: :       * * *.*:  : *      *:  .* * :**

ASTD_SHIBS       SCGLVSPEREKFDQLLLEARAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYAADYCA
ASTD_SHIFL       FCGLVSPEREKFDQLLLEARAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYAADYCA
ASTD_ECO57       SCGLVSPEREKFDQLLLEARAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYAADYCA
ASTD_ECOLI       SCGLVSPEREKFDQLLLEARAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYAADYCA
ASTD_ECOL5       SCGLVSPEREKFDQLLLEARAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYAADYCA
ASTD_ECOUT       SCGLVSPEREKFDQLLLEARAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYAADYCA
ASTD_ECOL6       SCGLVSPEREKFDQLLLGARAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYAADYCA
ASTD_SHIDS       SCGLVSSEREKFDQLLLEARAGIVNWKKPLTGAASTAPFGGIGASGNHRPSAWYAADYCA
ASTD_SALPA       SCGLVSTDRAQFEQLLLEARAGIVNWNKPLTGAASTAPFGGVGASGNHRPSAWYAADYCA
ASTD_SALTY       SCGLVSTDRAQFEQLLLEARAGIVNWNKPLTGAASTAPFGGVGASGNHRPSAWYAADYCA
ASTD_SALTI       SCGLVSTDRAQFEQLLLEARAGIVNWNKPLTGAASTAPFGGVGASGNHRPSAWYAADYCA
ASTD_YERPA       AVGLVSEDRQQFEQLLLEARAGIVNWNKPLTGASSAAPFGGVGASGNHRPSAFYAADYCA
ASTD_YERPE       AVGLVSEDRQQFEQLLLEARAGIVNWNKPLTGASSAAPFGGVGASGNHRPSAFYAADYCA
ASTD_YERPS       AVGLVSEDRQQFEQLLLEARAGIVNWNKPLTGASSAAPFGGVGASGNHRPSAFYAADYCA
ASTD_ACIAD       SVGLVSPKRALFERMLIEARAGIVNWNKPLTGASSAAPFGGVGASGNHRASAFYAADYCA
ASTD_PHOLL       ATGLISPDAALFQRLSEDARAGIVNWNKPLTGASSKAPFGGIGASGNYRPSAYYAADYCA
ASTD_PSE14       AAGLLSDSEARYQQFWLHSRAGIVNWNKQLTGAASSAPFGGVGASGNHRASAYYAADYCA
ASTD_PSESM       AAGLLSDSEARYQQFWLQSRAGIVNWNKQLTGAASSAPFGGVGASGNHRASAYYAADYCA
ASTD_PSEU2       AAGLLSDSEARYQQFWLHSRAGIVNWNKPLTGAASSAPFGGVGASGNHRASAYYAADYCA
ASTD_PSEF5       AAGLLSDSAERYQQFWLESRAGIVNWNKQLTGAASSAPFGGVGASGNHRASAYYAADYCA
ASTD_PSEPF       AAGLLSDSEERYQQFWLESRAGIVNWNKQLTGAASSAPFGGVGASGNHRASAYYAADYCA
ASTD_PSEPK       AAGLLSDSRARYQYFWLRSRAGIVNWNKQLTGAASSAPFGGVGASGNHRASAYYAADYCA
ASTD_PSEAE       AAGLLSDSRERFEQFLVESRAGIVNWNKQLTGAASSAPFGGIGASGNHRPSAYYAADYCA
ASTD_CHRVO       AGGVLSDSRELYDRYWLESRAGVVNWNKPLTGASSAAPFGGIGASGNHRPSAYYAADYCA
ASTD_BURCA       SAGLLADDAKVWEHFRRTIRAGIVNWNRPTNGASSAAPFGGTGRSGNHRPSAYYAADYCA
ASTD_BURL3       SAGLLADDAKTWEHFRRTIRAGIVNWNRPTNGASSAAPFGGTGRSGNHRPSAYYAADYCA
ASTD_BURMA       SAGLLADDETVWNTFRRTIRAGIVNWNRPTNGASSAAPFGGAGRSGNHRPSAYYAADYCA
ASTD_BURP1       SAGLLADDETVWNTFRRAIRAGIVNWNRPTNGASSAAPFGGAGRSGNHRPSAYYAADYCA
ASTD_BURPS       SAGLLADDETVWNTFRRAIRAGIVNWNRPTNGASSAAPFGGAGRSGNHRPSAYYAADYCA
ASTD_BURTA       SAGLLADDEQAWHTFRRAIRAGIVNWNRPTNGASSAAPFGGAGRSGNHRPSAYYAADYCA
ASTD_PARXL       SAGLLADDEALWAHFQRTIRAGIVNWNRPTNGASSGAPFGGPGRSGNHRPSAYYAADYCA
ASTD_HAHCH       AAGLISDSRDLYDRFWLEVRAGIVNWNKPLTGASSAAPFGGVGASGNHRPSAYYAADYCA
ASTD_COLP3       SAGLLSDSEASYNHFFTRIRAGIVNWNKPITGASSAAPFGGIGASGNHRASAFYAADYCA
ASTD_PSEA6       SAGLLSDSEDLYQHFYQRIRAGIVNWNRPITGASGAAPFGGVGESGNHRASAYYAADYCA
ASTD2_PSEHT      SAGLLADSENDYNHFLKRIRAGIVNWNRPITGASSAAPFGGIGASGNHRASAYYAADYCA
ASTD1_SHEDO      SAGLLADSETDYQHFYRRIRAGIVNWNKPITGASSAAPFGGIGASGNHRASAYYAADYCA
ASTD1_PSEHT      SAGLLSDSAADYEHFLRRIRAGIVNWNRPITGASSAAPFGGIGASGNHRASAYYAADYCA
ASTD_IDILO       SAGVLCDDEQTYRYFFKHIRAGIVNWNKPITGASSAAPFGGIGASGNHRASAYYAADYCA
ASTD2_SHEDO      SAGLLADNRDDYDYFLARIRAGIVNWNKQITGASGAAPFGGVGASGNHRASAFYAADYCA
ASTD_SHEFN       SAGLLADSREDYDYFLARIRAGIVNWNKQITGASGAAPFGGVGASGNHRASAFYAADYCA
ASTD_SHEON       SAGILADSREDYEYFLARIRAGIVNWNKQITGASGAAPFGGVGASGNHRASAFYAADYCA
ASTD_VIBVU       SAGLVSTDDGEWQYFVDHIRAGIVNRNRQLTGASGDAPFGGPGASGNLRPSAYYAADYCA
ASTD_VIBVY       SAGLVSTDDGEWQYFVDHIRAGIVNRNRQLTGASGDAPFGGPGASGNLRPSAYYAADYCA
ASTD_VIBPA       SAGLVSTDDQEWEYFVDHIRAGIVNRNRQLTGASGDAPFGGPGASGNLRPSAYYAADYCA
ASTD_VIBCH       SAGLVSTDDGEWDYFVEHIRAGIVNRNRQLTGASGDAPFGGPGASGNLRPSAFYAADYCA
ASTD_ALIF1       SAGLVSTDDSEWDYFVEHIRSGIVNRNRQLTGASGDAPFGGPGASGNLKPSAYYAADYCA
ASTD_PHOPR       SAGLVSTDDSEWQYFIDNIRAGIVNRNRQLTGASGDAPFGGPGASGNLRPSAYYAADYCA
ASTD_CHRSD       SAGLIGGERADWDDFLLRIRAGIVNWNRQTTGASSDAPFGGIGDSGNHRPSAYYAADYCA
ASTD_LEGPA       SAGLLSDNKDHYLQFYQHIRAGLINWNRPTTGAASSLPFGGVGCSGNHRPSAYFAADYCA
ASTD_LEGPL       SAGLLSDNKDHYLQFYQHIRAGLINWNRPTTGAASSLPFGGVGCSGNHRPSAYFAADYCA
ASTD_LEGPH       SAGLLSDNKDHYQQFYQNIRAGLINWNRPTTGAASSLPFGGVGCSGNHRPSAYFAADYCA
ASTD2_CAUVC      SAGLISNESELWDKFLSRIRAGVVNWNRPTTGAAGSMPFGGLGASGNHRPSAYYAADYCA
ASTD_NOVAD       SASLIGGDPQDYNRFWANIRAGVVNWNRPTNGASSAAPFGGVGLSGNHRPSAYYAADYCA
ASTD_SPHAL       SAALIGGTPQLYDQFWANARAGVINWNRPTNGASSAAPFGGVGLSGNHRPSAFYAADYCA
ASTD1_CAUVC      AAGLISDDEALYRRFWTSVRAGIVNWNRPTTGASSAAPFGGVGGSGNHRPSAYYAADYSA
                   .::      :       *:*::* ::  .**:.  **** * *** :.**::****.*

ASTD_SHIBS       WPMASLESDSLTLPATLNPGLDFSDEVVR------
ASTD_SHIFL       WPMASLESDSLTLPATLNPGLDFSDEVVR------
ASTD_ECO57       WPMASLESDSLTLPATLNPGLDFSDEVVR------
ASTD_ECOLI       WPMASLESDSLTLPATLNPGLDFSDEVVR------
ASTD_ECOL5       WPMASLESDSLTLPATLNPGLDFSDEVVR------
ASTD_ECOUT       WPMASLESDSLTLPATLNPGLDFSDEVVR------
ASTD_ECOL6       WPMASLESDSLTLPATLNPGLDFSDEVVR------
ASTD_SHIDS       WPMASLESDSLTLLAMLNPGLDFSDEV--------
ASTD_SALPA       WPMASLESPELTLPATLSPGLDFSRREAV------
ASTD_SALTY       WPMASLESPELTLPATLSPGLDFSRREAV------
ASTD_SALTI       WPMASLESPELTLPATLSPGLDFSRREAV------
ASTD_YERPA       WPMASLECEHLTLPATLSPGISFDLPKV-------
ASTD_YERPE       WPMASLECEHLTLPATLSPGISFDLPKV-------
ASTD_YERPS       WPMASLECEHLTLPATLSPGISFDLPKV-------
ASTD_ACIAD       WPMASLESEQLSLPEKLSPGIVL------------
ASTD_PHOLL       WPMASLVADELTLPETLAPGLHFPD----------
ASTD_PSE14       YPVASLEAGSLTLPSTLTPGIRLS-----------
ASTD_PSESM       YPVASLETGSLTLPATLTPGVRLS-----------
ASTD_PSEU2       YPVASLEAGSLTLPATLTPGIRLS-----------
ASTD_PSEF5       YPVASLETPSLVLPSALTPGVRLS-----------
ASTD_PSEPF       YPVASLETPSLVLPAALTPGVKMA-----------
ASTD_PSEPK       YPVASLETASLALPATLTPGVTL------------
ASTD_PSEAE       YPVASLESPSVSLPATLTPGISL------------
ASTD_CHRVO       YPVASLECDSLALPAQLSPGIVL------------
ASTD_BURCA       YPMASVESTQLTLPASLSPGLHF------------
ASTD_BURL3       YPMASVESTQLTLPASLSPGLHF------------
ASTD_BURMA       YPMASVESAQLQMPANLSPGLHF------------
ASTD_BURP1       YPMASVESAQLQMPANLSPGLHF------------
ASTD_BURPS       YPMASVESAQLQMPANLSPGLHF------------
ASTD_BURTA       YPMASVESAQLQMPASLSPGLHF------------
ASTD_PARXL       FPMASVESAQLQMPASVSPGLQF------------
ASTD_HAHCH       YPVATLEADQAQAPAQLSPGMSL------------
ASTD_COLP3       YPIASVEAEKVSLPETLTPGMKF------------
ASTD_PSEA6       YPVASVELEKVTLPGNLNPGLNF------------
ASTD2_PSEHT      YPVASVESDKVTLPQTLAPGLIIE-----------
ASTD1_SHEDO      YPVSSVEAQAVSLPASLSPGLVIE-----------
ASTD1_PSEHT      YPVASVELEKVAMPATLSPGLKID-----------
ASTD_IDILO       YPVASVEADSMSLPESLAPGLKF------------
ASTD2_SHEDO      YPVASMEADSVSMPASLSPGLSI------------
ASTD_SHEFN       YPVASMEADAVSLPATLSPGLSI------------
ASTD_SHEON       YPVASVEADAVSLPATLSPGLTLS-----------
ASTD_VIBVU       YPMASMEGEETSLPATLSPGVEL------------
ASTD_VIBVY       YPMASMEGEETLLPATLSPGVEL------------
ASTD_VIBPA       YPMASMEGQETELPATLSPGVTL------------
ASTD_VIBCH       YPMASMEGDTTLLPATLSPGVEL------------
ASTD_ALIF1       YPMASMEGDACEIPEQLSPGLTL------------
ASTD_PHOPR       YPMASMEGEQTELPAQLSPGIAL------------
ASTD_CHRSD       YPVASMEAETLVLPETLPPGVVL------------
ASTD_LEGPA       YPVASMEQPLLTTPAQRLPGLVLE-----------
ASTD_LEGPL       YPVASMEQPLLTTPAQRLPGLVLE-----------
ASTD_LEGPH       YPVASMEQPLLTTPVQRLPGLVLE-----------
ASTD2_CAUVC      YPVASFEASMVVDTLKDIKGLKA------------
ASTD_NOVAD       YPVASTEVD--QPRASIGVGLRSD-----------
ASTD_SPHAL       YPVASAESD--ALRASIGVGLRDPEGSQLVTKKYL
ASTD1_CAUVC      YPVAGLESP--SPVYRLPIGLNP------------
                 :*::               *: