CLUSTAL format seed alignment for MF_01183

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SURA_ECOLI      -------MKNWKTLLLGIAMI--ANTSFAAPQV---------------------------
SURA_SHISS      -------MKNWKTLLLGIAMI--ANTSFAAPQV---------------------------
SURA_SHIBS      -------MKNWKTLLLGIAMI--ANTSFAAPQV---------------------------
SURA_SHIFL      -------MKNWKTLLLGIAMI--ANTSFAAPQV---------------------------
SURA_ECO57      -------MKNWKTLLLGIAMI--ANTSFAAPQV---------------------------
SURA_ECOL6      -------MKNWKTLLLGIAMI--ANTSFAAPQV---------------------------
SURA_ECOUT      -------MKNWKTLLLGIAMI--ANTSFAAPQV---------------------------
SURA_SHIDS      -------MKNWKTLLLGIAMI--ANTSFAAPQV---------------------------
SURA_SALPA      -------MKNWKTLLLGIAMI--ANTSFAAPQV---------------------------
SURA_SALTI      -------MKNWKTLLLGIAMI--ANTSFAAPQV---------------------------
SURA_SALTY      -------MKNWKTLLLGIAMI--ANTSFAAPQV---------------------------
SURA_SALCH      -------MKNWKTLLLGIAMI--ANTSFAAPQV---------------------------
SURA_YERPE      -------MKNWRTLILGLVIC--ANTAFAAPQE---------------------------
SURA_YERPN      -------MKNWRTLILGLVIC--ANTAFAAPQE---------------------------
SURA_YERPS      -------MKNWRTLILGLVIC--ANTAFAAPQE---------------------------
SURA_YERPA      -------MKNWRTLILGLVIC--ANTAFAAPQE---------------------------
SURA_PECAS      -------MKNWRTLILGLALS--ASTAFAAPQV---------------------------
SURA_SODGM      -------MKNWRTFILGLALC--ANGALAAPQV---------------------------
SURA_PHOLL      -------MKNWRTLIFGLMFS--VSTAFAAPQQ---------------------------
SURA_VIBVU      -------MNIWKTLLLGMLVT---GSAVSAPVE---------------------------
SURA_VIBVY      -------MNIWKTLLLGMLVT---GSAVSAPVE---------------------------
SURA_VIBPA      -------MKIWKSILFTTLLS---CGAVAAPVE---------------------------
SURA_VIBCH      -------MKLWKPTLISVLSALTLFNAHAEPKQ---------------------------
SURA_ALIF1      -------MKNWKFPLISTLLLLLTINVHAAPVE---------------------------
SURA_PHOPR      -------MKKWKSSLLGIAIWSLAASSMAAPKE---------------------------
SURA_COLP3      --MKYRIKALLLASSLIITTI---TSVQAKEEL---------------------------
SURA_PSEA6      ------MKLTVVTFALLAFIS---FNTFAKQVR---------------------------
SURA_PSEHT      ----MNLKKLLTSAVLSISLC---QSAFAAPVE---------------------------
SURA_SHEDO      ----MKHSKKIVTALLALAMS---QTVMAAPVA---------------------------
SURA_SHEFN      ----MKHSKKIIFALLALAMS---NTSMAAPMP---------------------------
SURA_SHESM      ----MKPSKHLIFALFALAIS---QPTMAAPQP---------------------------
SURA_SHESR      ----MKPSKHLIFALFALAIS---QPTMAAPQP---------------------------
SURA_SHEON      ----MKPSKHLIFALFALAIS---QPTMAAPQP---------------------------
SURA_IDILO      ----MKKIASFCSAAVLIASSFLLNNTVQAQQI---------------------------
SURA_ALKEH      ---MTAITRITLTGALLAAALLL--AALQPARA---------------------------
SURA_METCA      ----MKISSFRKGRWLGALALFA--VVCWSMAD---------------------------
SURA_NITOC      -----------MGRVLVTIFVLF--WPIGSFAA---------------------------
SURA_PSE14      --------------MLGALLL----SGAVHAAV---------------------------
SURA_PSEU2      --------------MLGALLL----SGAVHAAV---------------------------
SURA_PSESM      --------------MLGALLL----SGAVHAAV---------------------------
SURA_PSEF5      --------------MLGALFL----STAASAAV---------------------------
SURA_PSEPF      --------------MLGALFL----GTAANAAV---------------------------
SURA_PSEPK      --------------MLGVALL----SGAVHAAV---------------------------
SURA_PSEAE      ---------------MGAALL----CSFAHAEV---------------------------
SURA_HAHCH      MKTLRLNFRSAILKALGALLLLQ--GCLAHAQV---------------------------
SURA_ALCBS      MINKTLHTKHTLLGLLAMAVLMI--PVWSQAKV---------------------------
SURA_CHRSD      -------MRLRSFAFLGFMLLVAMAPSMASAQP---------------------------
SURA_SACD2      ----MQIIKTTIATFTAIAFTGA--ASFTSAEV---------------------------
SURA_XANAC      ---MTKPFSVVLASLLAITSTVSPLASAQQS-----------------------------
SURA_XANC5      ---MTKPFSVVLASLLAITSTVSPLASAQQS-----------------------------
SURA_XANOM      ---MTKPFSVVLASLLAITSTISPLASAQQS-----------------------------
SURA_XANOR      ---MTKPFSVVLASLLAITSTISPLASAQQS-----------------------------
SURA_XANC8      ---MTKPFSVLLASLLVITSTVSPLASAQQS-----------------------------
SURA_XANCP      ---MTKPFSVLLASLLVITSTVSPLASAQQS-----------------------------
SURA_XYLFA      ---MTRYFSIVLSLLLAVSCVFLPVASARQQQH---------------------------
SURA_XYLFT      ---MTRYFSIVLSLLLAVSCVFLPVASARQQQH---------------------------
SURA_AROAE      --------------MRRISSRLSLVLFAALSCATALFPAHAAN-----------------
SURA_DECAR      --------------MKTMNPYIRHLILLICCLGGMLAQPLSAA-----------------
SURA_THIDA      -----------MKFFQRPERRLKQWGLALLLAASALLPARAD------------------
SURA_NITEU      ------MIQFSSDRQLKFRKYWLIYAVFATMLAADVFAQSSYS-----------------
SURA_NITMU      -------------MGTKLSSRSPFSLPFLTLLAGMAIAQQPA------------------
SURA_METFK      -----------------MHNHVFKTIARHGLIALFFFFSISAM-----------------
SURA_CHRVO      ----------------------MKKTLLALLIASVMQSALAAP-----------------
SURA_BURCA      -----------------MKKTLRFAAVVSSLAASAALLVAAPAAAQALG-----------
SURA_BURL3      -----------------MKKTLRFAAVVSSLAAASALLAAAPAAAQALG-----------
SURA_BURP1      -----------------MKKTLRFAAVASGLVA-SLITVAPSASAQALR-----------
SURA_BURPS      -----------------MKKILRFAAVASGLVA-SLITVAPSASAQALR-----------
SURA_BURMA      -----------------MKKTLRFAAVASGLVA-SLITVAPSASAQALR-----------
SURA_BURTA      -----------------MKKTLRFAAVAAGLVA-SLITVAPSASAQALR-----------
SURA_PARXL      ------------------MKKLRLATLAAGLAAAASFLSVAPVQAQALS-----------
SURA_CUPPJ      -MKRQEFALFSLTLMLSPWRRVLLPAVLAAMAGPALAQLKAPSQASRAT-----GIFVPQ
SURA_CUPMC      -MKRQAFSLLS---RLNPWQQLLLSAVLVTLAAPAAAQLRAP--GTRTQ-----GIFTQQ
SURA_RALSO      -MACKSTAVRSATRVAPTRRLGMVTGALVALMAGAALLPAAHAQQTQKKSAPLRGIFTTP
SURA_BORBR      -------------MMRSLHSLRRMSGTVLALMLAAGLPLSAAQAQPAK------------
SURA_BORPE      -------------MMRSLHSLRRMSGTVLALMLAAGLPLSAAQAQPAK------------
SURA_BORPA      -------------MMRSLHSLRRMSGTVLALMLAAGLPLSAAQAQPAK------------
SURA_BORA1      -------------MMRRLHSSRRFSGSLLALALGLALPLAHAADKPAA------------
SURA_POLSJ      -----MTNDRLFAGIARVLSVRPLAAALALLLTLPLIGVQAQSLRPSSG-----------
SURA_RHOFT      ------------------MNHRLVALSVASLALLAPLTVPAQGLRPSS------------
SURA_HYDCU      ---MKKIIPTNLFKLISILFILTPFFAWSAPQE---------------------------
SURA_LEGPA      -------------MFKRIALVCALFSGICFAEG---------------------------
SURA_LEGPH      -------------MFKRIALVCALFSGVCFAEG---------------------------
SURA_LEGPL      -------------MFKRIALVCALFSGVCFAEG---------------------------
SURA_BAUCH      -----MDGIKLLLSIIILYFYTYINCAIAEPNL---------------------------
SURA_BLOPB      ---------MKFWKIFILIFTLKTNIVLGALKT---------------------------
SURA_BUCAP      -------MKVYFFLILYVFLSFFSITYSKELE----------------------------
                                                                            

SURA_ECOLI      --------------------------------VDKVAAVVNNGVVLESDVDGLMQSVKLN
SURA_SHISS      --------------------------------VDKVAAVVNNGVVLESDVDGLMQSVKLN
SURA_SHIBS      --------------------------------VDKVAAVVNNGVVLESDVDGLMQSVKLN
SURA_SHIFL      --------------------------------VDKVAAVVNNGVVLESDVDGLMQSVKLN
SURA_ECO57      --------------------------------VDKVAAVVNNGVVLESDVDGLMQSVKLN
SURA_ECOL6      --------------------------------VDKVAAVVNNGVVLESDVDGLMQSVKLN
SURA_ECOUT      --------------------------------VDKVAAVVNNGVVLESDVDGLMQSVKLN
SURA_SHIDS      --------------------------------VDKVAAVVNNGVVLESDVDGLMQSVKLN
SURA_SALPA      --------------------------------VDKVAAVVNNGVVLESDVDGLMQSVKLN
SURA_SALTI      --------------------------------VDKVAAVVNNGVVLESDVDGLMQSVKLN
SURA_SALTY      --------------------------------VDKVAAVVNNGVVLESDVDGLMQSVKLN
SURA_SALCH      --------------------------------VDKVAAIVNNGVVLESDVDGLMQSVKLN
SURA_YERPE      --------------------------------VDKVAAVVDNGVVLQSDIDGLLQSVKMN
SURA_YERPN      --------------------------------VDKVAAVVDNGVVLQSDIDGLLQSVKMN
SURA_YERPS      --------------------------------VDKVAAVVDNGVVLQSDIDGLLQSVKMN
SURA_YERPA      --------------------------------VDKVAAVVDNGVVLQSDIDGLLQSVKMN
SURA_PECAS      --------------------------------VDKVAAVVDNSVVLESDVNSLLQSVKLN
SURA_SODGM      --------------------------------VDKVAAVVDNGIVLESEVDNMLSTVKHG
SURA_PHOLL      --------------------------------MDKIAAVVNNGVVLESDINNRLQSVKRD
SURA_VIBVU      --------------------------------LDKVAVIVNDGVILQSDIDTATKTLRAN
SURA_VIBVY      --------------------------------LDKVAVIVNDGVILQSDIDTATKTLRAN
SURA_VIBPA      --------------------------------LDKVAVIVNDGVILQSDINTAMKTLQAN
SURA_VIBCH      --------------------------------LDSVAVIVNSGVILQSDVDSALKTIKAN
SURA_ALIF1      --------------------------------LDRVVAIVDEGVVLQSDIDTSLKTVKIN
SURA_PHOPR      --------------------------------LDKVVTLVNDSVILQSDVNAMLQTVRIN
SURA_COLP3      --------------------------------LDRVAAIVNTGVVLESEVNDLLVNIKQQ
SURA_PSEA6      --------------------------------LDNVAVIVDQGVVLESQIEELVNTVKRN
SURA_PSEHT      --------------------------------IDKVIGIVNQGVILKSEVDTIVNRVKKQ
SURA_SHEDO      --------------------------------LDRVSVQINDGIILESEIGNMLATVRAN
SURA_SHEFN      --------------------------------LDRVSVQINDGIILESEITNMVSTVKAN
SURA_SHESM      --------------------------------IDRVAVQINDGIVLESEITNMIDTVKAN
SURA_SHESR      --------------------------------IDRVAVQINDGIVLESEITNMIDTVKAN
SURA_SHEON      --------------------------------LDRVAVQINDGIVLESEITNMIDTVKAN
SURA_IDILO      --------------------------------LDRVVVVVDDGVVLQSQIDQLIQQVKNG
SURA_ALKEH      ------------------------------ETLDRIVAVVDDQVVLASELERELATIANQ
SURA_METCA      ------------------------------AAVDRIVAVVDDGVILESELVRKVDEIKRS
SURA_NITOC      ------------------------------INLDRIVAVVNEDIVLESELEQMVRTVQDQ
SURA_PSE14      ------------------------------QPLESVVAIVDNDVIMKSQMDQRVREVQQT
SURA_PSEU2      ------------------------------QPLDSVVAIVDNDVIMKSQMDQRVREVQQT
SURA_PSESM      ------------------------------QPLDSVVAIVDNDVIMKSQMDQRVREVQQT
SURA_PSEF5      ------------------------------QSIDKVVAIVDNDVVMQSQLDQRVHEVQQT
SURA_PSEPF      ------------------------------QSIDRVVAIVDNDVVMQSQLDQRVHEVQQT
SURA_PSEPK      ------------------------------QPLDRVVAIVDNDVVMQSQLDQRVHEVQQT
SURA_PSEAE      ------------------------------VPLDRVVAIVDNDVIMQSQLDQRLREVHQT
SURA_HAHCH      ------------------------------QELDRVVAVVNDDIVLYSELQDRASRIKDK
SURA_ALCBS      ------------------------------QMLDRIVAVVNDGAIMASELDERINTIALQ
SURA_CHRSD      ------------------------------QPLDRIVAVVNKDAIMQSRLEDRVTQVRRQ
SURA_SACD2      ------------------------------VPLDRVVAVVDNRAITQTELDSRVQDVQVR
SURA_XANAC      ------------------------------QPLDRIAAIVDEDVVLQSELDRAVRNVKSQ
SURA_XANC5      ------------------------------QPLDRIAAIVDEDVVLQSELDRAVRNVKSQ
SURA_XANOM      ------------------------------QPLDRIAAIVDEDVVLQSELDRAVRNVKSQ
SURA_XANOR      ------------------------------QPLDRIAAIVDEDVVLQSELDRAVRNVKSQ
SURA_XANC8      ------------------------------QPLDRIAAIVDEDVVLQSELDRAVRNVKSQ
SURA_XANCP      ------------------------------QPLDRIAAIVDEDVVLQSELDRAVRNVKSQ
SURA_XYLFA      ------------------------------QPLDRIVAVVDDNVVLKSELDRAIHNVKSQ
SURA_XYLFT      ------------------------------QPLDRIVAVVDDNVVLKSELDRAIHNVKSQ
SURA_AROAE      --------------------------PRS-VEVDHIAAVVNNEVITARELRERVEQAIHQ
SURA_DECAR      --------------------------PQDPVEADRIVAVVGSDVITYFELRTRLTAALKQ
SURA_THIDA      -----------------------------VVPLNHIVAVVNDEVITRQELAKRYDEVVRN
SURA_NITEU      --------------------------REDIKPIDRIVAVVNEEVITQQEINEVLQNTVQQ
SURA_NITMU      --------------------------HSGVETIDHIVAVVNENVITRHELDEMLGAMLKQ
SURA_METFK      --------------------------AAEVAKMDRIVAIVDQGVITEKELEDRIQTVIAQ
SURA_CHRVO      --------------------------ATPVREVDRIVAVVNKNVITWQELQARVNEAIKQ
SURA_BURCA      --------------------------SQGAQLADEVVAVVNNDVITGRELDQRVGLIARR
SURA_BURL3      --------------------------SQGAQLADEVVAVVNNDVITGRELDQRAGLIARR
SURA_BURP1      --------------------------AQGASLADEVVAVVNNDVITGRELDQRVGLIARR
SURA_BURPS      --------------------------AQGASLADEVVAVVNNDVITGRELDQRVGLIARR
SURA_BURMA      --------------------------AQGASLADEVVAVVNNDVITGRELDQRVGLIARR
SURA_BURTA      --------------------------AQGASLADEVVAVVNNDVITGRELDQRVGLIARR
SURA_PARXL      --------------------------GSGGQTVDTIAAVVNNGVITRRELDERMGLITRR
SURA_CUPPJ      SSD-----VAVPSSQPQLGVPQPSSGGKRSQLVDEVVAVVNNSVITRRELLDRADEIEAQ
SURA_CUPMC      GSQSASQGSTVAPSQPMMGVPQPSSQ-PRSQLVDEVVAVVNNSVITRRELLDRADEIESQ
SURA_RALSO      DAS-----PSQPLLRGTLPGPSTASGAARSQLVDEVVAVVNTDIITRRELLDRADLVERT
SURA_BORBR      -------------PAPKGDQKPAT-PAPSEQFVDGIAAIVNKDVITLREVREASKLASAD
SURA_BORPE      -------------PAPKGDQKPAT-PAPSEQFVDGIAAIVNKDVITLREVREASKLASAD
SURA_BORPA      -------------PAPKGDQKPAT-PAPSEQFVDGIAAIVNKDVITLREVREASKLASAD
SURA_BORA1      -------------GKPAASQPAASKPQGGEQFVDGIAAIVNKDVITMREVQDGVKRAKVD
SURA_POLSJ      ----------LRLPTPAASAGAAAGSASGQRQADFIVAVVNSEPITNSEVRTKLVRTEQQ
SURA_RHOFT      ------------ATVGAGVLAPARVPAATGLAADYIVAVVNSEPITNNEVRAALQRVLQQ
SURA_HYDCU      ------------------------------TLIDRVVAVVNDNIILKSELDAEVNLAKQD
SURA_LEGPA      -----------------------------KQLLDKVVAIVNDNVITSSELNAQVELSKKQ
SURA_LEGPH      -----------------------------KQLLDKVVAIVNDNVITSSELNAQVELSKKQ
SURA_LEGPL      -----------------------------KQLLDKVVAIVNDNVITSSELNAQVELSKKQ
SURA_BAUCH      --------------------------------IDQVVAIVNNDIILESELKILRDSIQNY
SURA_BLOPB      --------------------------------VDKIVALVNHNIILDSDIRHNIYMIQDN
SURA_BUCAP      --------------------------------IDKIIAIVNNQIILNSDVNQVLFSLKEE
                                                 : :   :.   :    :          

SURA_ECOLI      AAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLD
SURA_SHISS      AAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLD
SURA_SHIBS      AAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLD
SURA_SHIFL      AAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLD
SURA_ECO57      AAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLD
SURA_ECOL6      AAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLD
SURA_ECOUT      AAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLD
SURA_SHIDS      AAQARQQLPDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLN
SURA_SALPA      AGQAGQQLPDDATLRHQILERLIMDQIILQMGQKMGVKITDEQLDQAIANIAKQNNMTMD
SURA_SALTI      AGQAGQQLPDDATLRHQILERLIMDQIILQMGQKMGVKITDEQLDQAIANIAKQNNMTMD
SURA_SALTY      AGQAGQQLPDDATLRHQILERLIMDQIILQMGQKMGVKITDEQLDQAIANIAKQNNMTMD
SURA_SALCH      AGQAGQQLPDDATLRHQILERLIMDQIILQMGQKMGVKITDEQLDQAIANIAKQNNMTMD
SURA_YERPE      AQQSGQQVPDDSTLRHQILERLIMDNIQLQMAKKMGITITDQALDKAIADIAAQNRMTLA
SURA_YERPN      AQQSGQQVPDDSTLRHQILERLIMDNIQLQMAKKMGITITDQALDKAIADIAAQNRMTLA
SURA_YERPS      AQQSGQQVPDDSTLRHQILERLIMDNIQLQMAKKMGITITDQALDKAIADIAAQNRMTLA
SURA_YERPA      AQQSGLQVPDDSTLRHQILERLIMDNIQLQMAKKMGITITDQALDKAIADIAAQNRMTLA
SURA_PECAS      AQQAGQQLPDDATLRHQITDRLIMDNIILQMAQKMGIQVTDEQLDQAITNIAAQNRMSID
SURA_SODGM      AQEANQQLPDDTTLRRQILDRLIMDNIILQLAQRTNITISDEQLDQAIGNIAAQNHMSLD
SURA_PHOLL      AQHAGQQIPDEQTLRHQILERLIIDNILLQMAKQMGITIPDQALDSTIANIAAQNHITVD
SURA_VIBVU      AKKSGQALPDADVLNEQIVDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTID
SURA_VIBVY      AKKSGQALPDADVLNEQIVDKLIIDTLQTQEADRIGVRIDDTRLNQAIEEIARNNNQTID
SURA_VIBPA      ARQSGKSLPSASVLKEQVVEKLIIDTLQGQEADRIGVRIDDNRLNQAIAEIARNNNQSVE
SURA_VIBCH      AKQNKQPLPQETVLREQVLEKLIIDTLQQQEADRIGVKIDDNRLNEAIKEIAKNNQQTQE
SURA_ALIF1      AQEKGQPLPDEAVLREQVLEKLIVDTIQSQQAEKMGIRIDDTRLEAALNDIAKENNMTLA
SURA_PHOPR      AAEQNQPLPDDALLTEQVMEKLIIETLQLQQAEQFGIRIDDTRLDQAVAEIAKERELTIP
SURA_COLP3      AKKNNQSLPSDKALRIQVMDKLINDSLLSQMGQRMGIQISDAQLDQTLNNMAREDKLTLA
SURA_PSEA6      ALTNNQTLPSDRVLRTQAIERLIVDSLQNQMAERMGIQISDPQLDQTIDNIAREDGTTVE
SURA_PSEHT      AEEQSQELPKDETLRVQAVERLVNQTLMMQMAERMGLEISDSQLDQTLASMAKEQGGSIA
SURA_SHEDO      ANKSNQTLPSEQALRTQVIERLILTRLQLQMAERIGLQIGDLQLDQTIESIAKDQKLTVS
SURA_SHEFN      AKAANQTLPSDDALRTQVIERLILTHLQMQMAERIGLQIGDLQLDQTIENIAKEQKVTVA
SURA_SHESM      ARAANQSLPSDSALRTQVIERLILTRLQLQMADRIGLHIGDLQLDQAIENIAREQKMTVA
SURA_SHESR      ARAANQSLPSDSALRTQVIERLILTRLQLQMADRIGLHIGDLQLDQAIENIAREQKMTVA
SURA_SHEON      AKAANQSLPSDSALRTQVIERLILTRLQLQMADRIGLHIGDLQLDQAIENIAREQKMTVA
SURA_IDILO      QNFNSSNAPSDEVLETQAIERLILQEIQLQMANRMGIEIDDNQLEQAINEIANNQDLTTA
SURA_ALKEH      LRSRGQRLPPRDVFQRQVLERLITQRVQLSRAQRVGITVDDATLDAAMQRMARQNNMTLG
SURA_METCA      LRASRASLPPDSVLVRQVLERMIVDKIQIQMAEKMGIQVDDDTLRMAVSQIAQRNNLTPD
SURA_NITOC      LAAQGTSLPPGYVLERQVLERLVMEQLQLQLAARTGIQVGDETLNEALGRIAQDNGLTLS
SURA_PSE14      IAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDNELNQAIGTIAQRNNMSVE
SURA_PSEU2      IAKRGSGVPPAEALQPQVLDRLILENLQLQMGERSGIRVSDEELNQAIGTIAQRNNMSVE
SURA_PSESM      IAKRGSGVPPAADLQPQVLDRLILENLQLQMGERSGIRVSDDELNQAIGTIAQRNNMSVE
SURA_PSEF5      IAKRGGGVPPTSVLEQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNSMSIE
SURA_PSEPF      IAKRGGGLPPPGVLDQQVLERLIVENLQLQIGERSGIRITDEELNQAVGTIAQRNNMTPE
SURA_PSEPK      IAKRGGGVPPTSALEQQVLERLIVENLQLQIGERSGIRITDEELNQAIGTIAQRNGMSLD
SURA_PSEAE      LLKRGAPLPPEHVLTQQVLERLIIENIQQQIGDRSGIRISDEELNQAMGTIAQRNGMSLE
SURA_HAHCH      LRQQKTPLPPEAVLHEKVLDQLVLESIQMQMADRGGIRVSDSQLNQTMQNIAKQNGMTLD
SURA_ALCBS      FQEKGQQLPSPAILREQVLDRMILERLQLQLAERAGIKVDEASLNEALAGIARQNDMSLE
SURA_CHRSD      MASRNVPAPNEADLRRQVLDRMILEQIQLQMAERANLSIDDTQLNATVRGIAEDNGMSMD
SURA_SACD2      SQAAGMRLPEADILNKQIIDQLISETLQLEMADRYGVQVSDQEVNASIGNIIQNAQMTEQ
SURA_XANAC      YAGRENQLPPDDVLQRQVLERLVLVKLQVSRADGNGIRVSDEELNRAIASIAQQNGTTVD
SURA_XANC5      YAGRENQLPPDDVLQRQVLERLVLVKLQVSRADGNGIRVSDEELNRAIASIAQQNGTTVD
SURA_XANOM      YAGRENQLPPDDVLQRQVLERLILVKLQVGRADGSGIRVSDEELNRAIASIAQQNGTTVD
SURA_XANOR      YAGRENQLPPDDVLQRQVLERLILVKLQVGRADGSGIRVSDEELNRAIASIAQQNGTTVD
SURA_XANC8      YAGRDNQLPPDDVLQRQVLERLVLVKLQVGRAEGSGIRVSDEELNRAIASIAQQNGTSVD
SURA_XANCP      YAGRDNQLPPDDVLQRQVLERLVLVKLQVGRAEGSGIRVSDEELNRAIASIAQQNGTSVD
SURA_XYLFA      YVGHEGQLPPDEVLQRQVLERLILIKLQVARAQTNGIRVSDDELNQAISSIAENNKTSVD
SURA_XYLFT      YVGHEGQLPPDEVLQRQVLERLILIKLQVARAQTNGIRVSDDELNQAISSIAENNKTSVD
SURA_AROAE      LNRQGTPQPPADVLERQLLERLVLERAQLQLARETSLQVDEATLERAIARIAESNRLTIA
SURA_DECAR      LQKQGTPLPPQDVLERQMLERLIMERAQLQYGRETGMKIDDTQLDLAIGRIAAGNKMTVP
SURA_THIDA      LSRQNTPLPPRNVLEKQLLERMVTELALQQHARNTGVRADPTLVERALQRIAAQNKLDMA
SURA_NITEU      LQRQNTQLPRMEILEKQLLERLILKRIQLQRAKEIGLTVSDNDLDQTLRRIIQDNHLTMD
SURA_NITMU      LQKQGVQPPPPAVLEKQLLERIILNRVQLQLANETGLTVSDAELDQTLRRIAQENKMSLQ
SURA_METFK      LEKQGTQLPPRDVLQKQILERLINDRLQLQYAAQTGLRVDDAQLDKTIERIAEQNKLSTG
SURA_CHRVO      LEAQKVAPPPREVLERQVLEQMITEEVQLQYAASGGLRIEDAAVDQAVANLAKQNKLSEA
SURA_BURCA      LQQQNAPVPPADQLRAQVLNQMVLERIQVQKAKDDGIRIDDATVQATLQRLAQANGMTLD
SURA_BURL3      LQQQNAPVPPTDQLRAQVLNQMVLERIQVQKAKDDGIRIDDATVQSTLQRLAQANGMTLE
SURA_BURP1      LQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQANGMQLD
SURA_BURPS      LQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQANGMQLD
SURA_BURMA      LQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQANGMQLD
SURA_BURTA      LQQQKAPVPPTDQLRAQVLNQMVLERIQVQRAKDDGIVVDNATVQATLGRLAQANGMPLD
SURA_PARXL      LNQQNAPVPPMDQLRQQVLNQMVLERIQLQKAKEDGITIDDATVQKTLERLAAANNLTLD
SURA_CUPPJ      LRTANRPAPPRADLLGEVLERLIMERVQTQAAQDAGIKVTDQELDRAIESVAQQNRLSAT
SURA_CUPMC      LRAAKREVPPRPDLLGEVLERLVMERVQTQAAQEAGIKVTDQEVDRAIESVAQQNKMSAT
SURA_RALSO      LQSQNRQVPVRADLLGEVLEQLILERVQAQTAKESGIRVSDADVDRAVESVAQRNNLSVS
SURA_BORBR      LQKRGIQVPDERTLQKQVLQRLIMERLERQEADRMGIRVDEAQVDQAINMIASRNKITPA
SURA_BORPE      LQKRGIQVPDERTLQKQVLQRLIMERLERQEADRMGIRVDEAQVDQAINMIASRNKITPA
SURA_BORPA      LQKRGIQVPDERTLQKQVLQRLIMERLERQEVDRMGIRVDEAQVDQAINMIASRNKITPA
SURA_BORA1      LKERGIQLPDDNVLQKQVLQRLIFDRLERQEADRLGIRVDDAQVTQAINMVASRNKLTPQ
SURA_POLSJ      IIQQGSPLPPRRELVPQVLERLISDKAQLQLARSAGMRVDDNAVEAAVQTVARQNQISVD
SURA_RHOFT      LAQQGNPQVDSKTLVRQVLERLINEKAQLQLARESGIAADEAAIDQAEQNIARQNQLTVA
SURA_HYDCU      LQARNIPVTNPEELASKVLDKIILERLQLQRINQLGIKIADDELFSQIQEIAKQNNLTVI
SURA_LEGPA      IIAQNMQMPDESVLRKQVLQHLIDVDLEMQMAKQNGITIENAEIDEAIEKIAASNHLNLS
SURA_LEGPH      IIAQNMQMPDESVLRKQVLQHLIDVDLEMQMAKQNGITIENAEIDEAIEKIAASNHLNLS
SURA_LEGPL      IIAQNMQMPDESVLRKQVLQHLIDVDLEMQMAKQNGITIENAEIDEAIEKIAASNHLNLS
SURA_BAUCH      AKLNYQEQLEDNQLNKHIIDRLIIKKIIQQQAKLSHITIAETKLNKIIHDLTSSQNLSIA
SURA_BLOPB      ILNGNDNILQDISHYQKILDQLIIDNLIFQISDQQKINIDHTQLNQMINCILNLYDMTFD
SURA_BUCAP      DQRVKIPL-KINFLRNKIIKKLITETLILEEAKKFNIVVTDDQVNNVLSKYALKKNITIE
                                .  .:::             :      :                

SURA_ECOLI      QMRSRLAYDGL----NYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQN
SURA_SHISS      QMRSRLAYDGL----NYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQN
SURA_SHIBS      QMRSRLAYDGL----NYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQN
SURA_SHIFL      QMRSRLAYDGL----NYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQN
SURA_ECO57      QMRSRLAYDGL----NYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQN
SURA_ECOL6      QMRSRLAYDGL----NYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQN
SURA_ECOUT      QMRSRLAYDGL----NYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQN
SURA_SHIDS      QMRSRLAYDGL----NYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQN
SURA_SALPA      QMRSRLAYDGL----NYSTYRNQIRKEMIISEVRNNEVRRRITVLPQEVDALAKQIGTQN
SURA_SALTI      QMRSRLAYDGL----NYSTYRNQIRKEMIISEVRNNEVRRRITVLPQEVDALAKQIGTQN
SURA_SALTY      QMRSRLAYDGL----NYSTYRNQIRKEMIISEVRNNEVRRRITVLPQEVDALAKQIGTQN
SURA_SALCH      QMRSRLAYDGL----NYSTYRNQIRKEMIISEVRNNEVRRRITVLPQEVDALAKQIGTQN
SURA_YERPE      QMRSRLAADGL----SYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQMGNQV
SURA_YERPN      QMRSRLAADGL----SYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQMGNQV
SURA_YERPS      QMRSRLAADGL----SYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQMGNQV
SURA_YERPA      QMRSRLAADGL----SYDTYREQIRKEMLTSEVRNNEVRRRITILPQEVESLAKQMGNQV
SURA_PECAS      QLKSQLANEGL----NYNTYRSQIRKEMLISEVRNNEVRRRVTVLPQEVDTLAKQIANQT
SURA_SODGM      QLRSRLPYDGI----DYNTYRTQIRKEMLIAEVRNGEVRRRVTILPQEVESLAQQIAAQT
SURA_PHOLL      QMKHRIAADGM----NFDTYRDQIRKEMLIAEVRNNEVRRRVTILPQEIDALVKQISNQN
SURA_VIBVU      ELSAAIASEGV----SYAEFREQIRKEMAASEARNALVRRRINILPAEVDNLAELLSKET
SURA_VIBVY      ELSAAIASEGV----SYEEFREQIRKEMAASEARNALVRRRINILPAEVDNLAELLSKET
SURA_VIBPA      ELAASVQAEGL----SYPEFREQIRKEIAASEARNALVRRRINILPAEVDSLADQLAKET
SURA_VIBCH      QLIASVAQEGL----TYPEFREQVRKEMAASDARNALVRRRINILPAEVDTLAELLAQET
SURA_ALIF1      QLQQKTAAQGL----PYANFREQIRKEIAASEARNAQVRRRINILPQEVESLAQLLAEET
SURA_PHOPR      QLQKELEKSGI----SYSIFREQMRRDMTASEARTIQVRRRINILPQEVEMLAEQLNKQT
SURA_COLP3      QFRQQVIDEGT----SYEKYRENVRIELVSGEVSRNSVRRRIFVSPQEVDNLLKVMKEQS
SURA_PSEA6      DLRKNLASEGV----SFEVYREQVRKELVTGEVRRANVRRRIYITPQEISNLVTLIDEQG
SURA_PSEHT      DLRRTIEGSGE----SFQAYREEIRKEITTQQVMRANVDRRVYVSEQEVDNLLKIMESQG
SURA_SHEDO      QLQQQLENDGL----SFSQYREQLREEITLGEIQRIQVQRRIQVSPQEISGLVKLMQEQG
SURA_SHEFN      QMQQTIESEGT----SFSQYREQLRQEVTLGEIQRIQVQRRIQVSPQEISGLVKLIQEQG
SURA_SHESM      QMQQKIESEGL----SFGQYREQLREEITLGEIQRIQVQRRIQVSPQEITGLVKLIQEQG
SURA_SHESR      QMQQKIESEGL----SFGQYREQLREEITLGEIQRIQVQRRIQVSPQEITGLVKLIQEQG
SURA_SHEON      QMQQKIASEGI----SFSQYREQLREEITLGEIQRIQVQRRIQVSPQEITGLVKLIQEQG
SURA_IDILO      ELRENMVSSGM----SWAAYRENIRNELVIQQVQRAAVQQRVSITPQEINNLVKLIESNQ
SURA_ALKEH      QFRQAVEQEGF----EYNYFREGIREEIAISRLRQAQVEEQVTVTPQEVEEVLETLDD--
SURA_METCA      QFRRSLAREGI----DYGDFLDQVRSEIAMGRLRASQINNQIKISDREVEHYLEAQGGSG
SURA_NITOC      QFRNVLEQDGY----DFPAFRENIRKELIISQLHKREVNDRVSVSKAEIDNFLTNQKKRG
SURA_PSE14      QFRAALAHDGL----SYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDQGKA
SURA_PSEU2      QFRAALAHDGL----SYNDAREQVRREMIISRVRQRRVAERIQVSQQEVKNFLASDMGKA
SURA_PSESM      QFRAALAHDGL----SYEDAREQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDQGKA
SURA_PSEF5      QFRAALAHDGL----SYEDARDQVRREMIISRVRQRRVAERIQVSEQEVKNFLASDLGKM
SURA_PSEPF      QFRIALSRDGL----SYEDAREQIRREMVISRVRQRRVAERIQVSEQEVKNFLASDLGKM
SURA_PSEPK      QFRAALARDGL----SFDDAREQVKREMIISRVRQRRVAERIQVSEQEVKNFLASDLGKM
SURA_PSEAE      QFQTALTRDGL----SYADAREQVRREMVISRVRQRRVAERIQVSEQEVKNFLASDMGKI
SURA_HAHCH      QFQQALSEEGV----TYQSAREQIRREMIISRVQQRSVDSRVRVTEKEVNDFLKSASAKE
SURA_ALCBS      DFAATLREDGY----SWTQFREQIRQDMVISRLQQRSVASRIQITDREVDRFLSSELGKQ
SURA_CHRSD      EFADALEEDGM----SLASMREQVRREMLLRQVQQSQVASRVNVTDREVERYLDQQ--GE
SURA_SACD2      QFVQQLASEGV----SINEFRASIRRQLTMRSITEGLVSRRIRISEQEVDNFLKSADAQF
SURA_XANAC      GLRQKLAADGM----GYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALAQQAATG
SURA_XANC5      GLRQKLAADGM----GYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALAQQAATG
SURA_XANOM      GLRQKLAADGM----GYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALTQQAATG
SURA_XANOR      GLRQKLAADGM----GYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALTQQAATG
SURA_XANC8      GLRQKLAADGM----GYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALAQQATTG
SURA_XANCP      GLRQKLAADGM----GYADFRASVRDEIIVQRLRQSFAQSRISVSEGEVDTALAQQATTG
SURA_XYLFA      GLRQKLVAEGI----SFPEFRQSVRDEITVHHLRQGFAQSRIVVSEGEVDTALAQ-ASSG
SURA_XYLFT      GLRQKLVAEGI----SFPEFRQSVRDEITVHHLRQGFAQSRIVVSEGEVDTALAQ-ANSG
SURA_AROAE      QLQAALEKDGV----SWSRFRDNIRTEILLTRLREREVDNRIVVTDAEVDNFLANNAD--
SURA_DECAR      QFRAALEKDGV----QYAQFREEIRNEMVTVRLREREVDSKLVISEGEIDNYLANQTA--
SURA_THIDA      GLQAALEKEGQ----TLDGMRNTIRNELLIARARERDVDNRISVSDAEIDGYLQTQAQ--
SURA_NITEU      EFRQVLLQEGT----DMNRFREEIRGEILMSRLKEQEVNSRVNVTENEIDNFLQNQAN--
SURA_NITMU      EFDRALAEDGV----SFSKFRDEIRDEIILVRLKEREVSNRVSVTEGEVDHFLETQED--
SURA_METFK      EFRKALEAEGI----PYRKFREDIRNEIILARLREREVDNRVNVTESEIDNFLTTQSS--
SURA_CHRVO      GLKAQLAKDGI----TLDRLRADIRRELTISRLRDSEVASRVNVSDSEVDQAMKSAQS--
SURA_BURCA      QYRGRLEAQGV----PWSIFTNDARTELMLSKLREREVDGKITVSDAEVANYIASQRGPN
SURA_BURL3      QYRGRLEAQGV----PWSVFTSDARTELMLSKLREREVDGKITVSDAEVANYIASQRGPN
SURA_BURP1      QYKARIEAQGV----PWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRGPN
SURA_BURPS      QYKARIEAQGV----PWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRGPN
SURA_BURMA      QYKARIEAQGV----PWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRGPN
SURA_BURTA      QYKARIEAQGV----PWDLFVRDARTELMLSKLREKEVDSKITVSDAEVASYIASQRGPN
SURA_PARXL      VYRSRIEAQGV----PWTTFTSDARTELTLSRLREKEVDSKVTVSDAEVANYIASQRGPN
SURA_CUPPJ      ELRRRVEASGM----TWTKYRDELRKQVQVIRLREREVDSKVQVYDGEIDNYLAARGGQG
SURA_CUPMC      ELRSRVEASGM----SWTKYRDELRKQVQVIRLREREVDSKVQVYDGEIDNYLAARNGGQ
SURA_RALSO      QLKSKLAQSGL----AYDKYREDLRQEILLARLRDREVDSKVQVFDGEIDNFLAQQGG-S
SURA_BORBR      AMRAEIEKSGV----TWEQYRKSLRDDIRMDRLRQRAVDANIIISDAEVDAFLKDQERNP
SURA_BORPE      AMRAEIEKSGV----TWEQYRKSLRDDIRMDRLRQRAVDANIIISDAEVDAFLKDQERNP
SURA_BORPA      AMRAEIEKSGV----TWEQYRKSLRDDIRMDRLRQRAVDANIIISDAEVDAFLKDQERNP
SURA_BORA1      QLRAEVEKNGL----SWDDYRKSLREEIRTDRLRQRTIDNHIIITDAEVDAYLKDQARNP
SURA_POLSJ      ELRRRLKADGI----AYSQFESDLRDELLVSRLRQREVDLRVTVTEQDIDQFLREQEGG-
SURA_RHOFT      ELRRRLTQEGG----VPGQFRNQLRDQILLTRLREREVEPRARVSELEIDQFLREQQS--
SURA_HYDCU      ELRDRLNMSQKN---GFESFRERIRQQMLFQKLREVEVLSKTQVTEDEVSNFIQRQALVQ
SURA_LEGPA      QMRDEITKQGI----SWQEYRQNIRKEMLISRVQQKAVGKDIIVTNEQVEQYLKNAGRIE
SURA_LEGPH      QMRDEITKQGI----SWQEYRQNIRKEMLISRVQQKAVGKDIIVTNEQVEQYLKTSGRIE
SURA_LEGPL      QMRDEITKQGI----SWQEYRQNIRKEMLISRVQQKAVGKDIIVTNEQVDQYLKTAGRIE
SURA_BAUCH      KLRHLMYSNRN----IYDIYRAQLRQDLLIAEVLNSALHRRITILPQEVEFLAKKIAIRK
SURA_BLOPB      KFRAYLYDIGL----NYEKFYFQQYQHMLKKQICDHVMHDRAHILTNEINKIVKKSNIID
SURA_BUCAP      ELKRNILMNNTNTSFSYNDYFNKIKNSLKVKIIQDYVLHNRVHISEKEVDLFLNKLINTQ
                                           :               :   ::           

SURA_ECOLI      D-----------------------ASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQ
SURA_SHISS      D-----------------------ASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQ
SURA_SHIBS      D-----------------------ASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQ
SURA_SHIFL      D-----------------------ASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQ
SURA_ECO57      D-----------------------ASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQ
SURA_ECOL6      D-----------------------ASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQ
SURA_ECOUT      D-----------------------ASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQ
SURA_SHIDS      D-----------------------ASTELNLSHILIPLPENPTSDQVNEAESQARAIVDQ
SURA_SALPA      D-----------------------ASTELNLSHILIALPENPTSEQVNDAQRQAESIVEE
SURA_SALTI      D-----------------------ASTELNLSHILIALPENPTSEQVNDAQRQAESIVEE
SURA_SALTY      D-----------------------ASTELNLSHILIALPENPTSEQVNDAQRQAESIVEE
SURA_SALCH      D-----------------------ASTELNLRHILIALPENPTSEQVNDAQRQAESIVEE
SURA_YERPE      S-----------------------GDTELNLSHILIPLPENPTQQQVDQAEDLANKLVAD
SURA_YERPN      S-----------------------GDTELNLSHILIPLPENPTQQQVDQAEDLANKLVAD
SURA_YERPS      S-----------------------GDTELNLSHILIPLPENPTQQQVDQAEDLANKLVAD
SURA_YERPA      S-----------------------GDTELNLSHILIPLPENPTQQQVDQAEDLANKLVAD
SURA_PECAS      G-----------------------ENDELNLSHILLPLPENPTQQQVDEAENLATSLVKQ
SURA_SODGM      G-----------------------NGAEFNLSHILIPLPENPTQDQLDKAEELATSIVEQ
SURA_PHOLL      T-----------------------NDTELNISHILIPLPENPDQAQMEKAMTVVQKIMSE
SURA_VIBVU      N-----------------------ASVEYRIGHIQLRFTDGQ---DKSALEAQAKELVEK
SURA_VIBVY      N-----------------------ASVEYRIGHIQLRFTDGQ---DKSALEAQAKELVEK
SURA_VIBPA      N-----------------------ATVQYKIGHIQLRFTDGQ---DKSEVEAQAKALVKK
SURA_VIBCH      D-----------------------ATVQYKISHIQLRVDDGQ---DKSTAETLANKLVND
SURA_ALIF1      Q-----------------------ATVQYKISHIQLRVEDGATQADKEALEKQAEDLTER
SURA_PHOPR      L-----------------------QTVQFNISHIQLRVEEGATKEQREETQQQAQQIVDE
SURA_COLP3      S-----------------------NNVEYHLGHILIEFPADASQEDLAAAKTRATKVVEL
SURA_PSEA6      G-----------------------QQAEYHLGHILIGFPPEPTDEDVSKAKDTAEKVLEL
SURA_PSEHT      Q-----------------------NAEEYDIGHILIDIPSDASADEIASAKTRADKVIEL
SURA_SHEDO      L-----------------------KEVEFQIGHILIDVPSEPSSEQLEASSKRANIVLKR
SURA_SHEFN      L-----------------------KDVEFQIGHILIEVPSNPTSEQLEGASRRAEIVLKR
SURA_SHESM      M-----------------------KDVEYQIGHILIDVPNNPNSEQLEASSKRANAVLER
SURA_SHESR      M-----------------------KDVEYQIGHILIDVPNNPNSEQLEASSKRANAVLER
SURA_SHEON      M-----------------------KDVEYQIGHILIDVPNNPTSEQLEASSKRANAVLER
SURA_IDILO      E-----------------------VQTEYRLAQILISADSNSSQAELEKAKERANTVLNL
SURA_ALKEH      ------------------------ENQEYRLGHILVATPEAASTAQLEEARERIEQLREQ
SURA_METCA      AV----------------------ADREYRLGHILIATPREASPDEVKKARERADRVVKE
SURA_NITOC      N-----------------------QDAQYHLAHILITVPEAASPEQVQAAKAKAEQVLQQ
SURA_PSE14      Q-----------------------LSEEFHLANILIATPDSASSDAIQAAAVKAKGIYDQ
SURA_PSEU2      Q-----------------------LSEEFHLANILIATPDSASSDAIQAAAVKAKGIYDQ
SURA_PSESM      Q-----------------------LSEEFHLANILIATPDSASSDAIQAAAVKAKSIYDQ
SURA_PSEF5      Q-----------------------LSEELHLANILIPTPESANSEAIQSAARQAMEVYQQ
SURA_PSEPF      Q-----------------------LSEELHLANILIPTPESANSEAIQSAARKAMEVYQQ
SURA_PSEPK      Q-----------------------MSEEYRLANILIPTPEAANSDDIQKAARKVGDVYQQ
SURA_PSEAE      Q-----------------------LSEEYRLANILIPVPEAASSDVIQAAARQAQELYQQ
SURA_HAHCH      Q-----------------------RAEEYHLAHILIALPENPSDAQRKEAESKVEKIRSQ
SURA_ALCBS      M-----------------------FQEDFRLGHILIRVPSEARPQQISQARAKAKEIIER
SURA_CHRSD      T-----------------------ADTAYHLAHILVSVPESPTPEQVEQAQAKVRDLYRQ
SURA_SACD2      W-----------------------VSPDYHLGHILVALPSSPSSEAIVEAEEKANALYEK
SURA_XANAC      S--------------------------QYHLAHILIGLPEGANAEQIATGQKKVDGVKAL
SURA_XANC5      S--------------------------QYHLAHILIGLPEGATAEQIATGQKKVDGVKAL
SURA_XANOM      S--------------------------KYHLAHILIGLPEGATAEQIATGQKKVDGVKTL
SURA_XANOR      S--------------------------KYHLAHILIGLPEGATAEQIATGQKKVDGVKAL
SURA_XANC8      S--------------------------QYHLAHILVGLPEGATAEQIATGQKKVDGVKAL
SURA_XANCP      S--------------------------QYHLAHILVGLPEGATAEQIATGQKKVDGVKAL
SURA_XYLFA      A--------------------------QYHLQHILVAVPDGATSQQIAIAQKKIDGIKSV
SURA_XYLFT      A--------------------------QYHLQHILVSLPDGATSEQIAIAQKKINGIKSV
SURA_AROAE      ---------------------ALS-GEEFELAHILIRVPEAATQQQMAGLVARAETAKQR
SURA_DECAR      ---------------------TGS-EEEYQLAHILLRAPESATPEQLQKLRQRGEQALKR
SURA_THIDA      ---------------------QGA-ETEYNFSHILVSVPENASPEQIRERRARAEDILAQ
SURA_NITEU      ---------------------SPAGNEEYRIAHILVQISEQMDEAQIEARHKRAETAYES
SURA_NITMU      ---------------------SPSQSDEYRIAHILIQVSEGADPLKRDAARQRAESALAK
SURA_METFK      ---------------------RNDIQDEFEVAHILIRAPEESTPEELQKLKAKAEAALKE
SURA_CHRVO      ---------------------ANR--TEYHLASILVAVPERADAKQIDQLSQKVHKAQAD
SURA_BURCA      A--------------------SQQ--QDLRFQHIFIKAPTNAPQADIEAAQKKADALLQQ
SURA_BURL3      A--------------------SQQ--QDLRFQHIFIKAPTNAPQADIEAAQKKADALLQQ
SURA_BURP1      A--------------------GSQ--QDLRLEHIFVKAPANAPQADIDVAQKKAEGLLQQ
SURA_BURPS      A--------------------GSQ--QDLRLEHIFVKAPANAPQADIDVAQKKAEGLLQQ
SURA_BURMA      A--------------------GSQ--QDLRLEHIFVKAPANAPQADIDVAQKKAEGLLQQ
SURA_BURTA      A--------------------GAQ--QDLRLEHIFVKAPTNAPQADIDAAQKKAEGLLQQ
SURA_PARXL      A--------------------GLT--SDLHLQHIFLKAPLNASETDIEAAQRKAQALLAE
SURA_CUPPJ      A--------------------AATGPTEFNVSQILVRVPENASDAQKQELQKKAEQLLKQ
SURA_CUPMC      A--------------------AASGPTEFNVAQILVRVPEDASDAQKAQLKTKAEGLLKQ
SURA_RALSO      A--------------------ASSGVQEYNVAQILVPVAEDASAEQKAAARGKAESLLKQ
SURA_BORBR      AAAQATRAPAPQQPQPQPRQPAQSGPAMLVLAQILVRVPEGSSPDQVAALRKKAEGLLAR
SURA_BORPE      AAAQATRAPAPQQPQPQPRQPAQSGPAMLVLAQILVRVPEGSSPDQVAALRKKAEGLLAR
SURA_BORPA      AAAQATRAPAPQQPQPQPRQPAQSGPAMLVLAQILVRVPEGSSPDQVAALRKKAEGLLAR
SURA_BORA1      ALQPQS-AQAPVQEAP----AAATGPVMLALGQILVRVPEGASPDTVASLRKKAEDILAR
SURA_POLSJ      ---------------------TELSSLALNLAQILVAVPENATPGQVAALQAKAQQVMDK
SURA_RHOFT      ---------------------STPAVQQINLAQVLVSVPDTATPVQVTALQARAQRALAR
SURA_HYDCU      S------------------------DVEYHLGHIMVSLPESATPDQRDASKQKAQEILQK
SURA_LEGPA      N-----------------------SNLTYHLKNIVIPLSEEPTTKQLQRAKIEAENLLNK
SURA_LEGPH      N-----------------------SNLTYHLKNIVIPLSEEPTTKQLQRAKIEAENLLNK
SURA_LEGPL      N-----------------------SNLTYHLKNIVIPLSEEPTTRQLQRAKIEAENLLNK
SURA_BAUCH      N-------------------------TTFNLSHMLIPLPEKPSRKQKNEAEALALFLMAQ
SURA_BLOPB      I------------------------NKQFKLRHITFSLPIQPTPSQIDRIEYFARLLIKK
SURA_BUCAP      N-----------------------ELKKIDINCIFLPFIKEKNKIFIKNTKILADHFAKK
                                              .  : .                        

SURA_ECOLI      A-RNGADFGKLAIAHSADQ---QALNGGQMGWGRIQELPGIFAQALS-TAKKGDIVGPIR
SURA_SHISS      A-RNGADFGKLAIAHSADQ---QALNGGQMGWGRIQELPGIFAQALS-TAKKGDIVGPIR
SURA_SHIBS      A-RNGADFGKLAIAHSADQ---QALNGGQMGWGRIQELPGIFAQALS-TAKKGDIVGPIR
SURA_SHIFL      A-RNGADFGKLAIAHSADQ---QALNGGQMGWGRIQELPGIFAQALS-TAKKGDIVGPIR
SURA_ECO57      A-RNGADFGKLAIAHSADQ---QALNGGQMGWGRIQELPGIFAQALS-TAKKGDIVGPIR
SURA_ECOL6      A-RNGADFGKLAIAHSADQ---QALNGGQMGWGRIQELPGIFAQALS-TAKKGDIVGPIR
SURA_ECOUT      A-RNGADFGKLAIAHSADQ---QALNGGQMGWGRIQELPGIFAQALS-TAKKGDIVGPIR
SURA_SHIDS      A-RNGADFGKLAIAHSADQ---QALNGGQMGWGRIQELPGIFAQALS-TAKKGDIVGPIR
SURA_SALPA      A-RNGADFGKLAITYSADQ---QALKGGQMGWGRIQELPGIFAQALS-TAKKGDIVGPIR
SURA_SALTI      A-RNGADFGKLAITYSADQ---QALKGGQMGWGRIQELPGIFAQALS-TAKKGDIVGPIR
SURA_SALTY      A-RNGADFGKLAITYSADQ---QALKGGQMGWGRIQELPGIFAQALS-TAKKGDIVGPIR
SURA_SALCH      A-RNGADFGKLAITYSADQ---QALKGGQMGWGRIQELPGIFAQALS-TAKKGDIVGPIR
SURA_YERPE      I-KGGADFGKLAIANSADS---QALKGGQMGWGKLQELPSLFAERLQ-SAHKGEIVGPIR
SURA_YERPN      I-KGGADFGKLAIANSADS---QALKGGQMGWGKLQELPSLFAERLQ-SAHKGEIVGPIR
SURA_YERPS      I-KGGADFGKLAIANSADS---QALKGGQMGWGKLQELPSLFAERLQ-SAHKGEIVGPIR
SURA_YERPA      I-KGGADFGKLAIANSADS---QALKGGQMGWGKLQELPSLFAERLQ-SAHKGEIVGPIR
SURA_PECAS      I-SEGADFGKLAITYSSDS---QALKGGQMGWGKLQEIPTLFAERLT-QVQKGQVVGPIR
SURA_SODGM      S-KSGADFGKLAITYSADA---QALKGGQMGWGKLEELPSLFAARLQ-GAQKGSIVGPIR
SURA_PHOLL      L-KHGVDFGKLAIAYSADP---QALKGGNMGWSRLQELPTLFAEQLQ-LAQKGAVVGPIR
SURA_VIBVU      L-KQGADFSTMAYTYSKGP---KALQGGDWGWMRKEEMPTIFADQIK-MQNKGSIIGPFR
SURA_VIBVY      L-KQGADFSTMAYTYSKGP---KALQGGDWGWMRKEEMPTIFADQIK-MQNKGSIIGPFR
SURA_VIBPA      L-NDGADFTEMAYTYSKGP---KALQGGDWGWMRKEEMPTIFADQIK-MQNKGSIIGPFR
SURA_VIBCH      L-RNGADFAQMAYAYSKGP---KALQGGDWGWMRKEEMPTIFADQIK-MQNKGSIIGPFR
SURA_ALIF1      L-KQGADFATMAYTYSKGP---KALQGGDWGWMRKEEMPTIFADQIT-GQGKNSIIGPFR
SURA_PHOPR      L-KNGADFANLAYSYSKGP---KALQGGEWGWMRQEEMPTIFADQIK-SNGKGAIIGPFR
SURA_COLP3      L-NDGSDFAKIAITSSGDA---NALKGGDLGWKNINEMPTLFSELIN-DKPKDTIVGPIR
SURA_PSEA6      L-NNGSEFAKIATASSSGS---KALEGGDLGWMNINSMPTLFAEAVQ-GTSKDDLIGPIR
SURA_PSEHT      L-NDEQEFKRIAISSSSGS---QALEGGQLGWMGINEMPSLFAEAVK-GKKQGAIIGPLR
SURA_SHEDO      L-NEGEDFRSTAIASSSGP---KALEGGIWDYMNINEMPTLFAEVVN-GAKVGDIIGPIK
SURA_SHEFN      L-NNGDDFRSTAIASSSGP---KALEGGIWDFMNINEMPTLFAEVIS-NAKKGDIIGPIK
SURA_SHESM      L-KSGEDFRRTAIASSSGP---KALEGGIWDYMNINEMPTLFAEVIN-GAKKGDIIGPIK
SURA_SHESR      L-KSGEDFRRTAIASSSGP---KALEGGIWDYMNINEMPTLFAEVIN-GAKKGDIIGPIK
SURA_SHEON      L-KSGEDFRRTAIASSSGP---KALEGGIWDYMNINEMPTLFAEVIN-GAKKGDIIGPIK
SURA_IDILO      L-DKGSDFADLAVRSSSGS---AALDGGDLGWMTVNGMPTLFAEAVD-GKSVGDVVGPIR
SURA_ALKEH      IIAGETDFEGAATAFSDAA---SAMEGGDLGWRLHSQLPSLFAEAIDEGLQAGEVSGVLQ
SURA_METCA      LKAG-LDFKDASIRYSDDP---QALEGGDLGWRKLSEIPSHIAEVVG-GMKDGEVSDPIR
SURA_NITOC      LREG-ADFQKVAVTYSDGQ---QALEGGDLGWRKMGQLPTLFVDVVP-QLQAGDISKLIR
SURA_PSE14      LKKG-ADFTRLAATTSSSE---NALEGGDMGWRKAAQLPPPFGDMLS-AMPVGDVTPPAR
SURA_PSEU2      LKKG-ADFTRLAATSSSSE---NALEGGDMGWRKAAQLPPPFGDMLS-SMPVGDVTPPAR
SURA_PSESM      LKKG-ADFAKIAATTSSSE---NALEGGDMGWRKAAQLPPPFGDMLS-SMPIGDVTPPAR
SURA_PSEF5      LKQG-ADFAQLAIARSGSD---NALEGGDMGWRKAAQLPPPFDRELS-AMAVGDITQPAR
SURA_PSEPF      LKQG-ADFGQMAVANSASD---NALEGGDMGWRKAAQLPPPFDRELS-SMATGDITQPAR
SURA_PSEPK      LRQG-ADFGQMAIANSASE---NALEGGEMGWRKAGQLPPDFAKMLS-SMPVGEITQPIR
SURA_PSEAE      LKQG-ADFGQLAISRSAGD---NALEGGEIGWRKAAQLPQPFDSMIG-SLAVGDVTEPVR
SURA_HAHCH      LDQG-VDFKQLAITYSDAS---TATQGGDLGWRKPDQVPSLFADVAP-KLAPGQTSEPIR
SURA_ALCBS      LEAG-SDFQQLAIALSDGP---NALEGGDLGWRPAAQWPTLFAENAI-NLKKGEFSQPLR
SURA_CHRSD      LQNG-ANFAQLATAESDGQ---QALSGGDLGWRRGDQLPSLFADVVP-TLSNGEVSEPIR
SURA_SACD2      LKAG-ANFAEVAIAESNGP---SALQGGDLGWRKSAELPTLFAELLP-SLNNGDVTKPTR
SURA_XANAC      IDKGELDFSAAAVRYSDSP---NALEGGDLGWRSLDEIPNAFAQLIR-DMQPGQVAGPLR
SURA_XANC5      IDKGELDFSAAAVRYSDSP---NALEGGDLGWRSLDEIPNAFAQLIR-DMQPGQVAGPLR
SURA_XANOM      IDKGELDFPAAAVRYSDSP---NALEGGDLGWRSLDEIPNAFAQLIR-DMKPGQVAGPLR
SURA_XANOR      IDKGELDFPAAAVRYSDSP---NALEGGDLGWRSLDEIPNAFAQLIR-DMKPGQVAGPLR
SURA_XANC8      IDKGELDFSAAAVRYSDSP---NALEGGDLGWRSLDEIPNAFAQLIR-DMQPGQVAGPLR
SURA_XANCP      IDKGELDFSAAAVRYSDSP---NALEGGDLGWRSLDEIPNAFAQLIR-DMQPGQVAGPLR
SURA_XYLFA      IDKGELAFSAAAVRYSDSP---NALESGDLGWRSLDEIPEAFAQMVQ-TMKPGQIVGPLR
SURA_XYLFT      IDKGELAFSAAAVRYSDSP---NALESGDLGWRSLDEIPEAFAQMVQ-TMKPGQIVGPLR
SURA_AROAE      L-NSGDDFARVAASYSDAP---DAMNGGALGWRSRDRLPPLFAEAVRELSPG-SVSPVLR
SURA_DECAR      A-RAGENFAQLTAAFSDAP---DALQGGDLGWRPLARLPALYAEAGSRLQSG-EVSDLLR
SURA_THIDA      L-AAGADFAQLSASHSDAP---DALKGGNFGWRASGKLPALFVEALKPMQPG-EISPLLR
SURA_NITEU      L-RQGADFVRVSAEFSDAP---DAMQGGELGWRPLGQLGSPFTEMLVNMQPG-EVTPVVR
SURA_NITMU      L-KAGTEFAQVAAEFSDAP---DAMEGGLLNWRPAAQLTKKFAEILTPMKPG-EITGIIP
SURA_METFK      L-QSGADFAQVSAGYSDAP---NALEGGILGWKASSQLPSLFVDALQALQPG-QLSPVLR
SURA_CHRVO      L-AAGQPFAKVSAAYSDAP---NALKGGDMGWRSATSLPQEFVQLLEQMKVG-ADTDVIR
SURA_BURCA      A-KSGADFERLAKNNSEAN---DAKKGGDLGFKSPSALPADVVDAASKLRPGQVNPTLIR
SURA_BURL3      A-KSGADFEKLAKNNSEAN---DAKKGGDLGFKAPSALPADVVDAASKLRPGQVNPTLIR
SURA_BURP1      ALASGANFERLAKNQSEAD---DAKKGGDLGFKSPASLPSDVVDAVSKLRPGEVNPTLIR
SURA_BURPS      ALASGANFERLAKNQSEAD---DAKKGGDLGFKSPASLPSDVVDAVSKLRPGEVNPTLIR
SURA_BURMA      ALASGANFERLAKNQSEAD---DAKKGGDLGFKSPASLPSDVVDAVSKLRPGEVNPTLIR
SURA_BURTA      ALASGTNFERLAKSQSEAD---DAKKGGDLGFKAPSSLPSDVVDAVSKLRPGEVNPTLIR
SURA_PARXL      A-KGGANFEKLAKSNSQAP---DASKGGDTGFVSPSKLPPEFVKAASALRPGEVNPDLIR
SURA_CUPPJ      A-QGGADFAQLAQANSQGP---EAAQGGAIGFREIGRLPALFANAVVDLQPGAVAPEVVE
SURA_CUPMC      V-QGGADFAELAKANSEAP---EASQGGSLGFREIGRLPAVFANAVVDLQPGAVVPEVLE
SURA_RALSO      V-QGGADFAKLARDSSGAP---EAAQGGELGLRPIGRLPAQFANAVVDLKPGQVVDQVIE
SURA_BORBR      A-KKGDDFASLAAANSDGP---EALQGGMMGARPLDGWPDLFVKAAGSLSAG-QVSGLVQ
SURA_BORPE      A-KKGDDFASLAAANSDGP---EALQGGMMGARPLDGWPDLFVKAAGSLSAG-QVSGLVQ
SURA_BORPA      A-KKGDDFASLAAANSDGP---EALQGGMMGARPLDGWPDLFVKAAGSLSAG-QVSGLVQ
SURA_BORA1      L-KRGDDFASVAAASSDGP---EALEGGVMGVRPIDGWPDLFVKAVSNVPAG-QVSGIIQ
SURA_POLSJ      A-RGGADFAALANEFSDSP---TRGTGGLMGLREADRYPPLFVESTKSLKVG-GLAGPIR
SURA_RHOFT      A-RAGEDFVTLVREFSDASDKASLANGGELGLRTADRYPPLFLEATHNLAVG-EISALVR
SURA_HYDCU      I-RTGGDFSQMAVRYSEGS---KALQGGDLGWLGIDQIPTFFNDALN-QLEIGETSDVIR
SURA_LEGPA      IKKG-EDFSRLAIEESSGE---FALEGGDLGERHLAELPEVFAKEVV-HMKVGQVAGPIR
SURA_LEGPH      IKKG-EDFSRLAIEESSGE---FALEGGDLGERHLAELPEVFAKEVV-HMKVGQVAGPIR
SURA_LEGPL      IKKG-EDFSRLAIEESSGE---FALEGGDLGERHLAELPEVFAKEVV-HMKVGQVAGPIR
SURA_BAUCH      S-EKQNDFRELAIKYSTDT---QMLNSFSMIGIQHTKLPLILAKHLY-GAQKGSVIGPIY
SURA_BLOPB      K-EFNNNIKELIRTYSNKN-IIQIIKVHETEWVSWKDIPIIFDKYLQ-TINKGDVIGPII
SURA_BUCAP      I-KKDASFNYYYEYFKKNN---NIFLSKEIRSKSLKYLKKIFLNKLK-IIKKNQILGPIL
                       :       .                                            

SURA_ECOLI      SGVGFHILKVNDLRGES-----------------------------------KNISVTEV
SURA_SHISS      SGVGFHILKVNDLRGES-----------------------------------KNISVTEV
SURA_SHIBS      SGVGFHILKVNDLRGES-----------------------------------KNISVTEV
SURA_SHIFL      SGVGFHILKVNDLRGES-----------------------------------KNISVTEV
SURA_ECO57      SGVGFHILKVNDLRGES-----------------------------------KNISVTEV
SURA_ECOL6      SGVGFHILKVNDLRGES-----------------------------------KNISVTEV
SURA_ECOUT      SGVGFHILKVNDLRGES-----------------------------------KNISVTEV
SURA_SHIDS      SGVGFHILKVNDLRGES-----------------------------------KNISVTEV
SURA_SALPA      SGVGFHILKVNDLRGQS-----------------------------------QSISVTEV
SURA_SALTI      SGVGFHILKVNDLRGQS-----------------------------------QSISVTEV
SURA_SALTY      SGVGFHILKVNDLRGQS-----------------------------------QSISVTEV
SURA_SALCH      SGVGFHILKVNDLRGQS-----------------------------------QSISVTEV
SURA_YERPE      SGVGFHILKVNDMRGAD-----------------------------------QTISVTEV
SURA_YERPN      SGVGFHILKVNDMRGAD-----------------------------------QTISVTEV
SURA_YERPS      SGVGFHILKVNDMRGAD-----------------------------------QTISVTEV
SURA_YERPA      SGVGFHILKVNDMRGAD-----------------------------------QTISVTEV
SURA_PECAS      SGVGFHILKVNDIRGGN-----------------------------------KSVSVTET
SURA_SODGM      SGVGFHILKVNDIRGGD-----------------------------------QKVAVTEV
SURA_PHOLL      SGVGFHILKVNDIRGGN-----------------------------------PTIAVTEV
SURA_VIBVU      SGVGFHILKIEDVKGL------------------------------------ETVAVTEV
SURA_VIBVY      SGVGFHILKIEDVKGL------------------------------------ETVAVTEV
SURA_VIBPA      SGVGFHILKIEDVKGL------------------------------------ETVAVTEV
SURA_VIBCH      SGVGFHILKIDDVKGL------------------------------------ETVAVTEV
SURA_ALIF1      SGVGFHILKIDDVKGL------------------------------------ETVAVTEV
SURA_PHOPR      SGVGYHIIKVNDVKGL------------------------------------ETVSVTEV
SURA_COLP3      TGLGYSIVKVLDIRGR------------------------------------KVVEVEEV
SURA_PSEA6      SGAGFHVLKIIDFRGI------------------------------------EKVEVAEL
SURA_PSEHT      SGAGFHIIKVQDVRGR------------------------------------QVVETTET
SURA_SHEDO      SGSGFHIIKVMDARGL------------------------------------QTKEVEEV
SURA_SHEFN      SGSGFHIIKVVDTRGL------------------------------------QTQEVEEV
SURA_SHESM      SGAGFHIIKIMDARGL------------------------------------QTKEIEEV
SURA_SHESR      SGAGFHIIKIMDARGL------------------------------------QTKEIEEV
SURA_SHEON      TGAGFHIIKIMDARGL------------------------------------QTKEIEEV
SURA_IDILO      SGIGFHILKVQDKRGE------------------------------------QTVEVQEV
SURA_ALKEH      NSSGFHLVKLMDQRTQ--GGE----------------------------------RVTET
SURA_METCA      SPGGYHIVKMLAMRGV--GEA----------------------------------KLTKT
SURA_NITOC      SPSGFHIVKLLDYRGE--GQQQ---------------------------------LVTQT
SURA_PSE14      TPGGFIILKLLEKRGGQG-QAQ---------------------------------MRDEV
SURA_PSEU2      TPGGFIILKLLEKRGGQG-QAQ---------------------------------MRDEV
SURA_PSESM      TPGGFIILKLLEKRGGQG-QAQ---------------------------------MRDEV
SURA_PSEF5      TPGGFIILKLLDKRGG---GNQ---------------------------------VRDEV
SURA_PSEPF      TPGGFIILKLLEKRGG---ESQ---------------------------------MRDEV
SURA_PSEPK      IPNGFIILKLEEKRGGS--ENV---------------------------------LRDEV
SURA_PSEAE      TPGGFIILKLEEKRGG---SKM---------------------------------VRDEV
SURA_HAHCH      NSSGVHFVAMLEKRGG---VSK---------------------------------VVEQS
SURA_ALCBS      SGAGFHILKMIDRKGG---AEK---------------------------------VVTQY
SURA_CHRSD      SPSGFHLVKLIDTRGQQGEQKR---------------------------------VVTEN
SURA_SACD2      SQAGFHIIKLYESRGG---QKQ---------------------------------IVNQT
SURA_XANAC      GPSGFQLLKLVEMRDANAGGE--------------------------------KKMVTEY
SURA_XANC5      GPSGFQLLKLVEMRDANAGGE--------------------------------KKMVTEY
SURA_XANOM      GPSGFQLLKLMEMRDANAGGE--------------------------------KKMVTEY
SURA_XANOR      GPSGFQLLKLMEMRDANAGGE--------------------------------KKMVTEY
SURA_XANC8      GPSGFQLLKLVEMRDANAGGE--------------------------------KKVLTEY
SURA_XANCP      GPSGFQLLKLVEMRDANAGGE--------------------------------KKVLTEY
SURA_XYLFA      GTSGFQLLKLVEVRDSAAAAAGP------------------------------RQMATEY
SURA_XYLFT      GTSGFQLLKLVEVRDSTAAAG-P------------------------------RQMATEY
SURA_AROAE      SSAGLHIVKLLDRR-------GGAAAG--------------------------PQQLEQT
SURA_DECAR      SSAGFHIVKLVSKR-------GGSA----------------------------PASVQQT
SURA_THIDA      SGNGFHILKLVDKR-------GLDA----------------------------TLSVTQT
SURA_NITEU      SPVGFHILKLLERR-------QQEQK---------------------------VTIIEQT
SURA_NITMU      SPNGFHILKLVERR-------NQDTV---------------------------TTMIDQT
SURA_METFK      SPNGYHILKLLNRR-------GGSS----------------------------PLVVDQT
SURA_CHRVO      TQQGFFIFKLVDKR-------SGGA----------------------------PMMVEQY
SURA_BURCA      VPDGFEIVRLVDRR-----QSQGASAA--------------------------APKIVQT
SURA_BURL3      VPDGFEIVRLVDRR-----QSQGATAA--------------------------APKIVQT
SURA_BURP1      VPDGFEIVRLVERR-----ASQ-NPAA--------------------------SPKIVQT
SURA_BURPS      VPDGFEIVRLVERR-----ASQ-NPAA--------------------------SPKIVQT
SURA_BURMA      VPDGFEIVRLVERR-----ASQ-NPAA--------------------------SPKIVQT
SURA_BURTA      VPDGFEIVRLVDRR-----ASQ-NPAA--------------------------SPKIVQT
SURA_PARXL      TSDGFEIVRLVDRR-----AGQGTSSD--------------------------APKLVQT
SURA_CUPPJ      SANGFHILKLTAKRVAPASTSASSPAA--------------------------ASRITQT
SURA_CUPMC      SANGFHVVKLVSKR-----TAAAQPAA--------------------------SDRIAQT
SURA_RALSO      SPAGFHVLKLVDKR-------AQGTAI--------------------------TAKVAQT
SURA_BORBR      SGNGFHILKVVDRA-----GGGQPAQAARPAPAPAPQQPSSFQEGPSVAAPQGPVRVTQT
SURA_BORPE      SGNGFHILKVVDRA-----GGGQPAQAARPAPAPAPQQPSSFQEGPSVAAPQGPVRVTQT
SURA_BORPA      SGNGFHILKVVDRA-----GGGQPAQAARPAPAPAPQQPSSFQEGPSVAAPQGPVRVTQT
SURA_BORA1      SGNGFHILKVLQRG-----QAGAPAPARAAAPMPAP---------AAGRAAQGPVQVTQT
SURA_POLSJ      SGAGFHILKVIEKR-----QAGMPGSV-----------------------------ITQT
SURA_RHOFT      SGAGFHILKVLEKK-----SAALPAMT-----------------------------VTQS
SURA_HYDCU      SPVGFHIIQLQGKRNK-------------------------------------NSQIVKQ
SURA_LEGPA      AGNGFHLIKLVAVGGENQ-----------------------------------RHVITQT
SURA_LEGPH      AGNGFHLIKLVAVGGENQ-----------------------------------RHVITQT
SURA_LEGPL      AGNGFHLIKLVAVGGENQ-----------------------------------RHVITQT
SURA_BAUCH      SDIGIHILKVHDMIRTHM----------------------------------SNIPITEV
SURA_BLOPB      SCDGIHIVEIQDIRYKQI-----------------------------------MLPVTKV
SURA_BUCAP      GLKGFYILKINKIENEN-----------------------------------KENLTTEF
                   *  .. :                                                : 

SURA_ECOLI      HARHILLKPS-PIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWA
SURA_SHISS      HARHILLKPS-PIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWA
SURA_SHIBS      HARHILLKPS-PIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWA
SURA_SHIFL      HARHILLKPS-PIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWA
SURA_ECO57      HARHILLKPS-PIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWA
SURA_ECOL6      HARHILLKPS-PIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWA
SURA_ECOUT      HARHILLKPS-PIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWA
SURA_SHIDS      HARHILLKPS-PIMTDEQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWA
SURA_SALPA      HARHILLKPS-PIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGDLGWA
SURA_SALTI      HARHILLKPS-PIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGDLGWA
SURA_SALTY      HARHILLKPS-PIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGDLGWA
SURA_SALCH      HARHILLKPS-PIMNDQQARLKLEEIAADIKSGKTTFAAAAKEYSQDPGSANQGGDLGWA
SURA_YERPE      NARHILLKPS-PMMTDEQARAKLEAAAAEIKSGKTSFATIAKEISQDPGSAMQGGELGWA
SURA_YERPN      NARHILLKPS-PMMTDEQARAKLEAAAAEIKSGKTSFATIAKEISQDPGSAMQGGELGWA
SURA_YERPS      NARHILLKPS-PMMTDEQARAKLEAAAAEIKSGKTSFATIAKEISQDPGSAMQGGELGWA
SURA_YERPA      NARHILLKPS-PMMTDEQARAKLEAAAAEIKSGKTSFATIAKEISQDPGSAMQGGELGWA
SURA_PECAS      HARHILIKPS-VVMTDSQAQAKLADVAQQIKNGSTDFAAQAKLLSQDPGSANQGGDLGWA
SURA_SODGM      HARHIMLRTS-VVMTDQQARAKLEDIAAQIKSGRISFAAAAKQLSEDPGSANQGGDLGWS
SURA_PHOLL      HARHILLRTS-PVMTDDQARTKLQQIASDIRSGKTDFADAAKEFSDDPGSALRGGDLGWT
SURA_VIBVU      NARHILLKPT-VILSDEGAQRELNEFIRRIRAGEATFGELAQQYSQDPGSAAQDGELGYQ
SURA_VIBVY      NARHILLKPT-VILSDEGAQRELNEFIRRIRAGEATFGELAQQYSQDPGSAAQDGELGYQ
SURA_VIBPA      NARHILIKPT-VILSDEGAKKQLNEFVRRIKAGEATFAQLASQYSQDPGSAAQDGELGYQ
SURA_VIBCH      NARHILIKPT-IILSDEGAQKQLNEFVQRIKNGEVTFAELAQQYSQDPGSAAQKGELGYQ
SURA_ALIF1      NARHILIKTS-VIMSDEGAQRLLNTIIDDIKSGKETFADMAQRYSQDPGSAANDGELGFQ
SURA_PHOPR      NARHILIKTS-VILSDDGAKRQLEKARQDILAGRQTFADEAQKLSSDPGSAANGGELGWQ
SURA_COLP3      KASHILIKPS-IILSDEKAKSLLQGFLNQIDAGEATFEELAKEHSEGP-TSVRGGDLGWA
SURA_PSEA6      KSRHILIKPS-VILSDEKAEKMLTEFRKELLAGEADFAELAKEHSADPGSALRGGDLGWA
SURA_PSEHT      RSRHILIKPS-IILSEEKARSMLAGFVKDLRADKADFAKLAKEYSEDPGSALKGGEYDWA
SURA_SHEDO      KSRHILLKPS-PILSEERAKAMLVNFQKQILSGEADFAELARQYSEDPGSAAKGGELGWS
SURA_SHEFN      KSRHILLKPS-PILSEDRAKAMLANFLAQVRAGDADFAKLATQYSEDPGSAAKGGELGWA
SURA_SHESM      RARHILLKPS-PILSEDRAKAMLEQFLKQIRSGEAKFEDLARQYSEDPGSAAKGGELGWA
SURA_SHESR      RARHILLKPS-PILSEDRAKAMLEQFLKQIRSGEAKFEDLARQYSEDPGSATKGGELGWA
SURA_SHEON      RARHILLKPS-PILSEDRAKAMLEQFLKQIRSGEAKFEDLARQYSEDPGSATKGGELGWA
SURA_IDILO      KARHILIKPS-VILSDNKAKEMLNKYREQIASGEKTFAELAREHSADPGSASRGGDLGWA
SURA_ALKEH      RARHILIRTDGDVITDEDARLRLRSLLERIEAGE-SFAELAEAYSEDPGSAARGGDLGWT
SURA_METCA      HVRHILIRPN-EVLSDEDAKNKLLALKTRIENGD-DFAELARGHSDDKGSAIKGGDLGWV
SURA_NITOC      QARHILLRAD-ELASEREVQLRLSQLRQRILSGD-DFSELAQAHSDDKASALKGGDLGWV
SURA_PSE14      HVRHILIKPS-EIRNEEETKRLAEKIYDRIQNGE-DFAELAKSFSEDPGSALNGGDLNWV
SURA_PSEU2      HVRHILIKPS-EIRNEEETKRLAQKIYDRIENGE-DFAELAKSFSEDPGSALNGGDLNWV
SURA_PSESM      HVRHILIKPS-EIRSEEATKLLAQKIYERIENGE-DFATLAKSFSEDPGSALNGGDLNWV
SURA_PSEF5      HVRHILIKPS-EIRSEEETKRLAQKLYDRIEAGE-DFAELAKSYSEDPGSALNGGDLNWI
SURA_PSEPF      HVRHILVKPS-PVRDEAKTKELAQSLYNRIEAGE-DFAELAKKYSEDPGSALNGGDLNWI
SURA_PSEPK      HVRHILIKPS-EIRSEAATEQLAERLYDRIKNGE-DFGELAKSFSEDPGSALNGGDLNWV
SURA_PSEAE      HVRHILLKPS-EIRSEAETEKLAQKLYERIQSGE-DFGELAKSFSEDPGSALNGGDLNWI
SURA_HAHCH      KVRHILVQQN-ELRDEIAAKKLIEEIYGKVQAGE-DFAELAKAYSDDAVSAAAGGSLDWV
SURA_ALCBS      HVRHVLIKAD-ALTSAEQAQQRAIRLHDEVAAGKRQFKETAAEFSDDPGSARNGGELGWV
SURA_CHRSD      RVRHILIGTN-PNRNDQQAEALARDIRQRIANGE-SFAALAQEYSDDDGSALDGGELGWT
SURA_SACD2      RARHILVKTS-EILNDAKAEAKLKDIRQQILDGA-DFAELAKTHSEDIGSRMSGGDLGWA
SURA_XANAC      HARHILVRIG-DNQTEAQAKAKIDTIRARIVGGA-DFQATAKESSEDTNSRGQGGDLGWF
SURA_XANC5      HARHILVRIG-ENQTEAQAKAKIDTIRARIVGGA-DFQATAKESSEDTNSRGQGGDLGWF
SURA_XANOM      NARHILVRVG-DNQTEAQAKAKIDTIRARIVGGA-DFQATAKESSEDTNSRGQGGDLGWF
SURA_XANOR      NARHILVRVG-DNQTEAQAKAKIDTIRARIVGGA-DFQATAKESSEDTNSRGQGGDLGWF
SURA_XANC8      NARHILVRIG-DNQTEAQAKAKIDTLRARIVGGA-DFQATAKESSEDTNSRGQGGDLGWF
SURA_XANCP      NARHILVRIG-DNQTEAQAKAKIDTLRARIVGGA-DFQATAKESSEDTNSRGQGGDLGWF
SURA_XYLFA      HARHILVRIT-EKQKEAEAKAKIDTLRARIAGGA-DFQTVARESSEDANNSNQGGDLGWF
SURA_XYLFT      HARHILVRIT-DKQKEAQAKAKIDTLRARIAGGA-DFQTVARESSEDANNSNQGGDLGWF
SURA_AROAE      RARHILIRTS-EILNDSEAESRLLGLRERVVNG-ASFAELAKAHSAD-LSSAKGGDLGWL
SURA_DECAR      HARHILIRSS-EVLSEAEATRKLEAVRERIANG-VDFAEQARLYSQD-GSAAKGGELGWL
SURA_THIDA      HARHILIKTN-EITSEADARNRLLQLKERIDNG-VKFDELARLHSED-ASASKGGDLGWI
SURA_NITEU      HAQHILIKVS-ELVSEEDAHQLINQLMERIHNG-ADFMDVAKAHSED-ASASAGGDLGWV
SURA_NITMU      HARHILIKIS-ELTSEADAHRRVTELKERLDNG-SKFEELAKLHSED-ASAPTGGDLGWI
SURA_METFK      HVRHILIKLS-EVVSELEAEQKINSIKERLDHG-ADFAELARQYSED-ASANNGGDLGWT
SURA_CHRVO      HPRHILIRTN-EAVSEADAKARIDQVRDRIMRG-AKFADMAKLYSED-GSNAKGGDLGWV
SURA_BURCA      HVRHILLRVG-EGKSEGQARQQLVDIRNQVEAG-GDFAKFARTYSQD-GSASQGGDLGWI
SURA_BURL3      HVRHILLRVG-EGKSEGQARQQLADIRNQVEAG-GDFAKFARTYSQD-GSASQGGDLGWI
SURA_BURP1      HVRHILLRVG-EGKSESQARQQLIDIRRQIESG-GDFEKFARTYSQD-GSASQGGDLGWI
SURA_BURPS      HVRHILLRVG-EGKSESQARQQLIDIRRQIESG-GDFEKFARTYSQD-GSASQGGDLGWI
SURA_BURMA      HVRHILLRVG-EGKSESQARQQLIDIRRQIESG-GDFEKFARTYSQD-GSASQGGDLGWI
SURA_BURTA      HVRHILLRVG-EGKSESQARQQLIDIRRQIEAG-GDFEKFARTYSQD-GSASQGGDLGWI
SURA_PARXL      HVRHILLRVG-DGMSEPQARQKLLEIKNEIAAG-GDFAKFAHTYSQD-GSSSQGGDLGWI
SURA_CUPPJ      QVRHILIRTG-PNMPEAEARRQLGTLRDRITHG-GDFADAAKRFSQD-GSAQAGGELGWV
SURA_CUPMC      QVRHILIRTG-PNMPEAEAKRQMATIRDRITHG-VDFADAARRYSQD-GSASQGGELGWV
SURA_RALSO      QVRHILIKTG-PTMSADDARRQLAGLRDRIVHG-YDFGDAARRYSQD-TSASAGGELGWV
SURA_BORBR      HARHILIKTS-TVMTDDQARQRLEQIRERLQGGAVKFEDMARQYSQD-STAPQGGDLGWV
SURA_BORPE      HARHILIKTS-TVMTDDQARQRLEQIRERLQGGAVKFEDMARQYSQD-STAPQGGDLGWV
SURA_BORPA      HARHILIKTS-TVMTDDQARQRLEQIRERLQGGAVKFEDMARQYSQD-STAPQGGDLGWV
SURA_BORA1      HARHILIKTS-AVMSDQQARQRLEQVRQRLESGSAKFEDMARQYSQD-ATAPQGGDLGWV
SURA_POLSJ      HARHILLRLS-PKQGETAATEKLAALRKRILAGQADFAALARENSED-ASAKQGGDLGWA
SURA_RHOFT      RARHILLRVS-PQLTESAARDKLNEFKKRVAAGQADFAALARDHSQD-GSAAQGGDLGWA
SURA_HYDCU      YHLYRFILLSEDAQNKQQPSPTLVKLAESLNSLE-SFKQLNEKYSDIPASVNANGNLGWQ
SURA_LEGPA      HVRHILLKPD-ASMVPSEAIKQVNNIYRQIQSGK-DFALMAKQYSLDAASAVKGGDLGWV
SURA_LEGPH      HVRHILLKPD-ASMVPSEAIKQVNNIYRQIQSGK-DFALMAKQYSLDAASAVKGGDLGWV
SURA_LEGPL      HVRHILLKPD-ASMVPSEAIKQVNNIYRQIQSGK-DFALMAKQYSLDAASAVKGGDLGWV
SURA_BAUCH      YARHILLRTS-VKRNDNQARVQLLNIARKINIGDISFSIVAKQISEDIISSQQGGDLGWN
SURA_BLOPB      TAKIFGIQNS---CENISIVEQLLQIKENMEKSNTAFNMMIKEKSKDICFNHYEENTICK
SURA_BUCAP      HIQHCLIRPS-VILDDKQAKNSIYYIYNNIKNKKYSFDYAVQKLSHDVYSSHKKGDLGWI
                      :                      :      *       *          .    

SURA_ECOLI      TPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLMNR
SURA_SHISS      TPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLMNR
SURA_SHIBS      TPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLMNR
SURA_SHIFL      TPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLMNR
SURA_ECO57      TPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLMNR
SURA_ECOL6      TPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLMNR
SURA_ECOUT      TPDIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLMNR
SURA_SHIDS      TADIFDPAFRDALTRLNKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLMNR
SURA_SALPA      TPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKVDKTDAAQKDRAYRMLMNR
SURA_SALTI      TPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKVDKTDAAQKDRAYRMLMNR
SURA_SALTY      TPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKVDKTDAAQKDRAYRMLMNR
SURA_SALCH      TPDIFDPAFRDALTKLHKGQISAPVHSSFGWHLIELLDTRKVDKTDAAQKDRAYRMLMNR
SURA_YERPE      SPDIYDPAFRDALMKLKKGEISAPVHSSFGWHLIQLVDTRQVDKTDAAQKERAYRMLFNR
SURA_YERPN      SPDIYDPAFRDALMKLKKGEISAPVHSSFGWHLIQLVDTRQVDKTDAAQKERAYRMLFNR
SURA_YERPS      SPDIYDPAFRDALMKLKKGEISAPVHSSFGWHLIQLVDTRQVDKTDAAQKERAYRMLFNR
SURA_YERPA      SPDIYDPAFRDALMKLKKGEISAPVHSSFGWHLIQLVDTRQVDKTDAAQKERAYRMLFNR
SURA_PECAS      SPDMYDPAFRDALLKLKKGEISQPIHSSFGWHLIQLLDTRQVDKTDAAQKEQAYRMIFNR
SURA_SODGM      SADAFDPAFRNALMHLKKGEISTPVHSSFGWHLIQLIDTRQVDRTDAAQKDRAYRLLFNR
SURA_PHOLL      APDIYDPAFRDALMRLNKGEISQPVHSSFGWHLIQLLDTRKVDKTDVAQKDRAYRMLFNR
SURA_VIBVU      TPDLYVPEFKHQVETLPVGTISEPFKTVHGWHIVEVLDRREVDRTDSAMKNKAYRILFNR
SURA_VIBVY      TPDLYVPEFKHQVETLPVGTISEPFKTVHGWHIVEVLDRREVDRTDSAMKNKAYRILFNR
SURA_VIBPA      TPDLYVPEFKHQVETLPVGSISEPFKTVHGWHIVEVLDRRQVDRTDSAMKNKAYRILFNR
SURA_VIBCH      TPDLYVPEFKHQIETLPVGQISEPFKTVHGWHIVEVLDRREVDRTDSALKNKAYRILFNR
SURA_ALIF1      TPDLYVPEFKHQVETLPVGQISAPFKTVHGWHIAEVLERRQVDRTDAAMKNKAYRILLNR
SURA_PHOPR      TPDLYVPEFKDKIETLPKGTISEPFKTVHGWHIVEVLDRRNVDRTDAAMKNRAYRILFSR
SURA_COLP3      DPKNYDPAFTEALATMKKGGYHKPFRSSFGWHIIKLEDRRMVDATSQLNENRAYQILFNR
SURA_PSEA6      DPNVYVPAFRDTLQSLEVGEISQPVRSTHGWHLMQLMDKRVQDATEKRKEDKAYQLLFQR
SURA_PSEHT      DPTSYVPAFRDTLLSLKQNEISEPFRSQFGWHIVQLLDTRVADKTEQAKRNRAHGMLFNR
SURA_SHEDO      SPDVYVPEFAQTLNSLKENEMSEPFRTTHGWHLTQLMDKRKTDATEQFNSNRAHQLIFRR
SURA_SHEFN      DPSMYVPEFTQTLASLQEGQYSEPFRTTHGWHVVQLESRRKTDATEQFNSNRAHQLIFRR
SURA_SHESM      EPSIYVPEFAQTLNSLSQDQISEPFRTTHGWHITQLEERRKTDATDQFNTNRAHQLIFRR
SURA_SHESR      EPSIYVPEFAQTLNSLSPDQISEPFRTTHGWHITQLEERRKTDATDQFNTNRAHQLIFRR
SURA_SHEON      EPSIYVPEFAQTLNSLSPDQISEPFRTTHGWHITQLEERRKTDATDQFNTNRAHQLIFRR
SURA_IDILO      RPNKYAPEFKQKVESIEQDTISEPFSTQFGWHIVEVTGRRTLDATEENKQERAYQMLFSR
SURA_ALKEH      QPGQLVPEFQGAMDALEEGQISAPFASPFGWHIVQVTDRRERDVSRERLRDQLAQQIHQR
SURA_METCA      KPGALVPPFEEAMNALDENQLSDPVQTQFGWHLIQVLERQESSDTNEVLKNRARDELFKR
SURA_NITOC      SPGQMIPRFEEAMRSLEPGEISEPFKTQFGWHVVQVLDRRQENMTEEFNRNRAKMEIRQR
SURA_PSE14      DPNSLVPEFRQVMNETPQGELSKPFKTAYGWHVLEVLGRRSTDATDQAREQQALNVLRNR
SURA_PSEU2      DPNSLVPEFRQVMSETPQGVLSKPFQTQYGWHVLEVLGRRSTDATDQAREQQALNVLRNR
SURA_PSESM      DPNSLVPEFRDVMSSTPQGELSKPFKTAYGWHVLEVLGRRATDATGQARDQQALSVLRNR
SURA_PSEF5      DPNALVPEFREVMAKTPQGQLSKPFKSPYGWHVLEVLGRRATDSTSQAREQQAMTVLRNR
SURA_PSEPF      DPNALVPEFRAVMAKSPQGQLSKPFQTQYGWHVLEVLGRRATDSTEQAREQQAMTVLRNR
SURA_PSEPK      DPNSLVPEFREQMANAQQGVVTKPFKTQYGWHVLEVLGRRATDSTEQAREQQALSVLRNR
SURA_PSEAE      DPEALVPEFRQVMNDTPQGELSKPFRSQFGWHILQVLGRRATDSSEKFREQQAVSVLRNR
SURA_HAHCH      NPGDMVPEFDQMMRETPVGAVSKPFQSTFGWHILQVQDRREADIGDRLMASQARQVLHRR
SURA_ALCBS      NKGEMVPEFEQVMLNTPVGELSPVFESQFGWHFLRVDDIRDADMSTEFRRMQATQALQKR
SURA_CHRSD      RPGQMVPAFEDAVKALDVGELSQPVRSRFGYHVIELEDRRRQDVTRDAQREQIRQTLFQR
SURA_SACD2      TPGTFVPAFEKTMAETKEGEISQPFKSRFGWHIMKVEERREEDMTQEALRQKARNMIMSR
SURA_XANAC      PADAFGPDFGKQVESLTDGAVSEPFRTQAGWHIVQRVGSRQTDVSAENQRAQVRETIGRR
SURA_XANC5      PADAFGPDFGKQVESLTDGAVSEPFRTQAGWHIVQRVGSRQTDVSAENQRAQVRETIGRR
SURA_XANOM      PADAFGPDFGKQVEGLADGAVSEPFRTQAGWHIVQRVGSRQTDVSAENQRAQVRETIGRR
SURA_XANOR      PADAFGPDFGKQVEGLADGAVSEPFRTQAGWHIVQRVGSRQTDVSAENQRAQVRETIGRR
SURA_XANC8      PADAFGPDFGKQVEGLTDGAVSEPFRTQAGWHIVQRVGTRQTDVSAENQRAQIRETIGRR
SURA_XANCP      PADAFGPDFGKQVEGLTDGAVSEPFRTQAGWHIVQRVGTRQTDVSAENQRAQIRETIGRR
SURA_XYLFA      PSDAFGADFGNHVKALADGNVSEPFRSAAGWHIVQRLGTRQTDVTRENQRAQIRDTIGQR
SURA_XYLFT      PSDAFGADFGNHVKALADGNVSEPFRSAAGWHIVQRLGTRQTDVTRENQRAQIRDTIGQR
SURA_AROAE      SPGDTVPEFERTMNALKPGEVSAPVRSPFGWHLIQVEARRLQDVSDERKRNAARNALRER
SURA_DECAR      NPGDTVPEFERAMDALKINEVSQVVQSPFGMHLIQVLERRERDVSAERQRAVARQALRER
SURA_THIDA      NPGDTVPDFEKAMNALQPGEVSAPVQSPFGWHLIQVLERRDQDVTQERQKLMARQAIRER
SURA_NITEU      SPGDTVPEFEQAMNALLPGQVSPPVRTPFGWHLIKVIERRSQDVSERQQREAARHTIHAR
SURA_NITMU      SPGDTVPEFEQAMSALKPGEISSPVQSPFGWHLIQVIERRTQDVSQERKRQSARQAIRAR
SURA_METFK      NAGDTVPAFEKAMNALDINEISAPVRTPFGWHIIQVLERRKQDMTQESARLKARQEIRAR
SURA_CHRVO      NMGDLVPEFEKAMVSLPIGQVSQPVRTPFGWHLILVEGKRNQDVSSDHEKMAVKQQIRAR
SURA_BURCA      SPGETVPEFERAMNNLQDGQISQPIRTEYGYHLIQVLNRREAEGSVQQQMDIARQAIGQR
SURA_BURL3      SPGETVPEFERAMNNLQDGQISQPIRTEYGYHLIQVLSRREAEGSVQQQMDIARQAIGQR
SURA_BURP1      SPGETVPEFERAMNTLQDGQVSNPVRTEYGYHLIQVLGRRDAEGSVQQQMDIARQAIGQR
SURA_BURPS      SPGETVPEFERAMNTLQDGQVSNPVRTEYGYHLIQVLGRRDAEGSVQQQMDIARQAIGQR
SURA_BURMA      SPGEPVPEFERAMNTLQDGQVSNPVRTEYGYHLIQVLGRRDAEGSVQQQMDIARQAIGQR
SURA_BURTA      SPGETVPEFERAMNALQDGQVSNPVRTEYGYHLIQVLGRRDAEGSVQQQMDIARQAIGQR
SURA_PARXL      SPGETVPEFERAMNSLQDGQISDPVRSEYGYHLIQVLGRRESEGSVAQQMDLARQAIGQR
SURA_CUPPJ      SPGELVPEFEQAMNRLRPGEISEPVVTQFGVHLIQVENRRETEMAPEKQRDFARAEIREQ
SURA_CUPMC      SPGELVPEFEQAMNRLRPGEISDPVVTQFGVHLIQVENRRETEVSPEKQRDFARAEVREQ
SURA_RALSO      SPGQLVPEFEQAMGLLKPGEVSQPVQSQFGLHLIQVEGRREAEVPVDRQRDYARSVIREQ
SURA_BORBR      NPGDTVPPFEAAMNALQPNEISPPVLSPFGWHLIQVLERREHDVSDEVQRMRARQLLFER
SURA_BORPE      NPGDTVPPFEAAMNALQPNEISPPMLSPFGWHLIQVLERREHDVSDEVQRMRARQLLFER
SURA_BORPA      NPGDTVPPFEAAMNALQPNEISPPVLSPFGWHLIQVLERREHDVSDEVQRMRARQLLFER
SURA_BORA1      NPGEMVPSFEAAMNSLKPGEISQPVESPFGWHLVQVLERRQKDVTDEMQRMQARQALFER
SURA_POLSJ      NPGMFVPEFEKVMNGLAPNQISDPLVSRFGVHLIQVLERREAQMSQRDQREMARNVLRGK
SURA_RHOFT      NPGMFVPEFEAVMNSLTPGQISEPLVSRFGVHLIQLMERRQATLSPQEQREAVRAMLHEK
SURA_HYDCU      TAKEMSPEYYQAIEALQPGHAAKPFATEKGWVILFLDGIRDQDLSLKDKRKQAMQTLRMK
SURA_LEGPA      NPGELVPEFEKTMNSLPLHKVSKPVKTQYGWHLIEVIARRQKDDSEAFKKQQVRQFLQQR
SURA_LEGPH      NPGELVPEFEKTMNSLPLHKVSKPVKTQYGWHLIEVIARRQKDDSEAFKKQQVRQFLQQR
SURA_LEGPL      NPGELVPEFEKTMNSLPLHKVSKPVKTQYGWHLIEVIARRQKDDSEAFKKQQVRQFLQQR
SURA_BAUCH      ALNAFTPTFRKLLLSLNKGQLSIPVRSSQGWHLIQLQNIRQVENTTN--KEAAYRILWHR
SURA_BLOPB      DLDDFEPSIRKALSSLKSNEISIPVHTSCGWRLIQLIDISILE-YNEIMYERAYLYLLNN
SURA_BUCAP      STDFFSNDFRNFLTDLRKNEISKPIKSNFGWHIIKLLDIRQVDKSNRIDKNLVYRFLLEK
                            :           . :  *  .                       :  .

SURA_ECOLI      KFSEEAASWMQEQRASAYVKILSN-----------------------------
SURA_SHISS      KFSEEAASWMQEQRASAYVKILSN-----------------------------
SURA_SHIBS      KFSEEAASWMQEQRASAYVKILSN-----------------------------
SURA_SHIFL      KFSEEAASWMQEQRASAYVKILSN-----------------------------
SURA_ECO57      KFSEEAASWMQEQRASAYVKILSN-----------------------------
SURA_ECOL6      KFSEEAASWMQEQRASAYVKILSN-----------------------------
SURA_ECOUT      KFSEEAASWMQEQRASAYVKILSN-----------------------------
SURA_SHIDS      KFSEEAASWMQEQRASAYVKILSN-----------------------------
SURA_SALPA      KFSEEAATWMQEQRASAYVKILSN-----------------------------
SURA_SALTI      KFSEEAATWMQEQRASAYVKILSN-----------------------------
SURA_SALTY      KFSEEAATWMQEQRASAYVKILSN-----------------------------
SURA_SALCH      KFSEEAATWMQEQRASAYVKILSN-----------------------------
SURA_YERPE      KFAEEAQTWMQEQRAAAYVKILDGSNAQPQ-----------------------
SURA_YERPN      KFAEEAQTWMQEQRAAAYVKILDGSNAQPQ-----------------------
SURA_YERPS      KFAEEAQTWMQEQRAAAYVKILDGSNAQPQ-----------------------
SURA_YERPA      KFAEEAQTWMQEQRAAAYVKILDGSNAQPQ-----------------------
SURA_PECAS      KFAEEAQTWMQEQRAAAYVKVINGATN--------------------------
SURA_SODGM      KFAEEAQTWMQEQRASAYVKILDSNGQ--------------------------
SURA_PHOLL      KFTEEAQSWMQEQRASAYVKILDGNDAQQ------------------------
SURA_VIBVU      KFNEEVGAWMQELRAGAFVEIINEEENDG------------------------
SURA_VIBVY      KFNEEVGAWMQELRAGAFVEIINEEENDG------------------------
SURA_VIBPA      KFNEEAGAWMQELRASAFVEIVDDNNDN-------------------------
SURA_VIBCH      KFNEEASAWLQELRASAFVEVLKDEKDEQ------------------------
SURA_ALIF1      KFNEEAGAWLQEIRASAYVEILQDDDGEDDNE---------------------
SURA_PHOPR      KFNEEAQAWLQELRAGAYIEQLGTNDDQG------------------------
SURA_COLP3      KYGMESTRWLKETRDEAYIEIFEQ-DNK-------------------------
SURA_PSEA6      KFAEETEAWLKEMRDSAYVELLDEKDNS-------------------------
SURA_PSEHT      KFKEESFNWQQEMREQAHVEIFPIDE---------------------------
SURA_SHEDO      KFNEELQAWLDEMRSDAYIEVFEPEVNRG------------------------
SURA_SHEFN      KFNEELQNWLDEMRSEAYIEIVEPESKRG------------------------
SURA_SHESM      KFNEELQNWLDEMRADAYIEVFQPESNRG------------------------
SURA_SHESR      KFNEELQNWLDEMRADAYIEVFQPESNRG------------------------
SURA_SHEON      KFNEELQNWLDEMRADAYIEVFQPESNRG------------------------
SURA_IDILO      KFREELDNWQQEIRDQAFIRRVAE-----------------------------
SURA_ALKEH      KVEEAFEQWIRRLRDEAYVDVRVEL----------------------------
SURA_METCA      KVDEETELWLRKIRDEAYVEIRLDETPASPGEDAPAGEDSPETFMR-------
SURA_NITOC      KVEEELENWLRQLRDEAYVEYRLDN----------------------------
SURA_PSE14      KYDEELQTWLRQIRDEAYVEIKLPGATQAAQ----------------------
SURA_PSEU2      KYDEELQTWLRQIRDEAYVEIKLPGATQAAQ----------------------
SURA_PSESM      KYDEELQTWLRQIRDEAYVEIKLPGATQAAQ----------------------
SURA_PSEF5      KYDEELQTWLRQIRDEAYVEIKLPGAEQAAQ----------------------
SURA_PSEPF      KYDEELQTWLRQIRDEAYVEIKLPGADQAAQ----------------------
SURA_PSEPK      KYDEELQTWLRQIRDEAYVEIKLPGADQAAQ----------------------
SURA_PSEAE      KYDEELQAWLRQIRDEAYVEIKQ------------------------------
SURA_HAHCH      KYEEELQNWLSEIRDEAFVQLKL------------------------------
SURA_ALCBS      RFEEELETWVQEKRSESYVDIRL------------------------------
SURA_CHRSD      KVSDEMEAWTQEIRSGAYIDNRLEDGRQ-------------------------
SURA_SACD2      RFEDETQIWLQELRDEAFIDIKI------------------------------
SURA_XANAC      KLEEEYNRYLQELRGEAYVSYRTGDRADDNATAAPAKSPDPAAPSPPPAKPTR
SURA_XANC5      KLEEEYNRYLQELRGEAYVSYRTGDRADDNATAAPAKSADPAAPSPPPAKPTR
SURA_XANOM      KLEEEYNRYLQELRGEAYVSYRTGDRADNNATAAPAKSADPALPAPPPAKPTR
SURA_XANOR      KLEEEYNRYLQELRGEAYVSYRTGDRADNNATAAPAKSADPALPAPPPAKPTR
SURA_XANC8      KLEEEYNRYLQELRGEAFVSFRTGDRADADATAAPEPAAAPAAPTPPPAQPTR
SURA_XANCP      KLEEEYNRYLQELRGEAFVSFRTGDRADADATAAPEPAAAPAAPTPPPAQPTR
SURA_XYLFA      KLEESYERFLRELRSEAYVSLQIEEPADDHQTPSAAVIPATGAVLPSATKH--
SURA_XYLFT      KLEESYERFLRELRSEAYVSLQIEEPADDHHTPSAAVTPATGAVLPAATKH--
SURA_AROAE      KADEAFEDWLRQLRDRTYVEYRTGKE---------------------------
SURA_DECAR      KLDEAYQDWLRQLRDRTYVENRLDEQ---------------------------
SURA_THIDA      KAEEAFQDWVRQIRDAAYVELRPID----------------------------
SURA_NITEU      KADAIVQEWLQQLRDQAYVEYKVEDN---------------------------
SURA_NITMU      KAETAFQEWLQRLRDRAYVEYRLEEG---------------------------
SURA_METFK      KADDAFQDWLSELRDRAYVEYRLEDKY--------------------------
SURA_CHRVO      KMEQAYTDWVRQLRDSAFVEEHLDEK---------------------------
SURA_BURCA      KAEQAYADWLRELRDSSYVQYKIGGVGPAN-----------------------
SURA_BURL3      KAEQAYADWLRELRDSSYVQYKIGGVGPAN-----------------------
SURA_BURP1      KAEQAYSDWLRELRDSSYVQIKLPVAQ--------------------------
SURA_BURPS      KAEQAYSDWLRELRDSSYVQIKLPVAQ--------------------------
SURA_BURMA      KAEQAYSDWLRELRDSSYVQIKLPVAQ--------------------------
SURA_BURTA      KAEQAYSDWLRELRDSSYVQIKLPVGQ--------------------------
SURA_PARXL      KAEQAYADWLRELRDTAYVEVKPTLSSTQ------------------------
SURA_CUPPJ      KLRAAYDDWVRQLRSQAYVEYRVNRQR--------------------------
SURA_CUPMC      KLRAAYDDWVRQLRSAAYVEYRINRQR--------------------------
SURA_RALSO      KVQAAYEDWLRQLRDSAHVEYRVNRQQ--------------------------
SURA_BORBR      RAVPAFEDWLEQLRSQAFIDNRLEKQERLEQNNR-------------------
SURA_BORPE      RAVPAFEDWLEQLRSQAFIDNRLEKQERLEQNNR-------------------
SURA_BORPA      RAVPAFEDWLEQLRSQAFIDNRLEKQERLEQNNR-------------------
SURA_BORA1      RAGPAFEDWMEQLRAQAYIDNRLEKQERIEQNNR-------------------
SURA_POLSJ      KQEEAYVLWAQEVRGRAYVEYRESPQ---------------------------
SURA_RHOFT      KLDEAYISWAQDVRGRAYVELREPPQ---------------------------
SURA_HYDCU      KANESYEIWLRRLKDEALIDIRLEDPEIMKKQPSHEEANAN------------
SURA_LEGPA      KFVEAVQNWQQHLRSQAYINIVDKDLA--------------------------
SURA_LEGPH      KFVEAVQNWQQHLRSQAYINIVDKDLA--------------------------
SURA_LEGPL      KFVEAVQNWQQHLRSQAYINIVDKDLA--------------------------
SURA_BAUCH      KLAEIAHIWIQEQRDLAYIKIINHHDNR-------------------------
SURA_BLOPB      KFDEIMKNWIQELRSESYIKIIN------------------------------
SURA_BUCAP      KIKKERYNWIRQLKKSSYIKIFKN-----------------------------
                :       :    :  : :