CLUSTAL format seed alignment for MF_01185

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

FLIW_DESVH       MARQNEIEIQTRIGRQRITLDKIIHFPRGLAGFEGRHDFTLLQLRE--GAPFLVLQSLDD
FLIW_DESVV       MARQNEIEIQTRIGRQRITLDKIIHFPRGLAGFEGRHDFTLLQLRE--GAPFLVLQSLDD
FLIW_DESAG       MAREKEIEIQTRLGKQRILPSKVIYFPRGIMGFENQHEFTLLKLRE--DAPFLVLQSIDD
FLIW_DECAR       MKVE-----TYLFGAVDVSPEKVITFPNGLVGFEQSKRYMLVHEEGPAEPSSFTLQSLDD
FLIW_AZOSB       MKIE-----SPVFGSAEVSDDKVIEFPAGLPGFEHCKRFVLVHEEG-SDTAVFLLQSVDD
FLIW_CHRVO       MRFD-----SNQLGNVEVDETTIITFPQGIPALENCTRFKLFHDITQPTPQMYWLQSLDD
FLIW1_DESPS      MTSV-----KERVAAPSVNFEKILFFPEGIPGFEDFKEYRIFHKET-NGLAIYWLESCDD
FLIW_DESHY       -----MKIESTRFGTLDVAPEQIIHFPHGIPGFLGEKAFVHLPHDE-NS-PFSFLQSTAE
FLIW_CARHZ       --MFILRLFSPAFGEIEADESQIFSFPEGLPGFSHLKKFLLIRHRD-NS-PFFFLIAIDE
FLIW_MAGMM       -----MEIQGTRFGTLEFDEKEIIYLNEGLLGFPLSKQFLMFPYGE-DS-SFFWLQSVDE
FLIW2_DESPS      -----MNTIKTRFGVIDYDPANLLLFPNGLVGLPHLRNFIVMPNKK-EG-PLFWIQSVDD
FLIW_PELCD       ----MKKTIMTRFGEVEFDPENTVLFVDGLIGFENLRDFIVMPNRK-NG-PLFWIQSVEE
FLIW_MOOTA       -----MQVMTSRFGTLEINPSDLLHFPQGIPAFEHLKEFFFYPIPE-NP-AFTWLQAAAD
FLIW_GEOSL       -----MNVTTTRFGEIAVEEAKIITLPDGMLGFSE-KRFVLLTPQN-IT-PFCWLQSVEN
FLIW_GEOUR       -----MKVTTTRFGELDIEEGKVIHMPEGMLGFVE-KRFILLTPEN-LG-PFCWLQAVDN
FLIW_GEOMG       -----MKIETSRFGLLDIDDDKIITLPDAMPGFAE-TRFTLLNPEK-HA-PFCWLQSVDN
FLIW_BDEBA       -----MIISTSRFGQVELKQEDVLTFTEGLLGFADLRKFVLLDDPN-DE-IFAWLQSCEA
FLIW_CLOTE       -----MKLNTKHHGTIDYEEKDIINFKRGLPGFEHLKKFIVYSIEE-NN-IFSVLQSLEE
FLIW_CLOK5       -----MKLNTKYHGLLEYDEKNIVVFRKGIPGFEHLKKFILVPAEE-NN-LFYILHSIED
FLIW_CLOBH       -----MKLNTKYHGCIEYEEKDVIYFQKGIPGFEELNKFIIFPVED-NE-VFLVFHSIEN
FLIW_CLOB1       -----MKLNTKYHGCIEYEEKDVIYFQKGIPGFEELNKFIIFPVED-NE-VFLVFHSIEN
FLIW_CLOBL       -----MNLNTKYHGNIEYEEKDVIYFPKGIPGFEELKRFIIFPVED-NE-VFLVFHSIEN
FLIW_CLONN       -----MKLETKCHGIIEYKEEDVIEFKKGIPGFNELKRFINFPIED-NE-VFSVLHSIEN
FLIW_CLOB8       -----MKFISKVHGEITYDEKNIIIFNKGILGFDELKRFILIELEE-YE-PFKLLHSLED
FLIW_CLOAB       -----MKLETQYHGIIEYNENNIINLVKGMSGFENLKKFILVGIEN-NE-VFSLFHSMED
FLIW_CLOD6       --------------------MMKITLKKGILGFENLKEYELLDIEN-ED-ILKEFNSTEE
FLIW_CALS4       -----MELNTKNFGIIHYNEEDVIYFEEGIPGFEELHNFLIIGDEE-EDMPFKWLQSIDN
FLIW_GEOKA       ----MK-IATKYHGDIEIHEKDIVRFEQGIPGFLEEKQFVLLPLED--T-PFIILQSVNT
FLIW_GEOTN       ----MK-IATKYHGDIEIHEKDIVRFEQGIPGFLEEKQFVLLPLED--T-PFIILQSVNT
FLIW_ALKHC       ----MKVIETKYNGKLEVAEDRLIAFDQGIPAFEDEKEFVLLPFEE-GT-PYYTLQSTKT
FLIW_BACSU       -----MIIHTKYHGQMNIKEEQIILFESGIPGFLEEKQFVILPLSE-DS-PFVALQSVTS
FLIW_BACLD       -----MIIKTKYHGETQIQEDQTIVFKNGLPGFTGEKKFVILPLSE-DS-PFVVLQSVQS
FLIW_BACVZ       -----MIIKTKYHGEIRIDEGQIISFENGLPGFNDETQFVVLPLSE-DS-PFLALQSVKQ
FLIW_BACP2       -----MIIQTKYHGEVKIKEEQMINFSNGIPGFLDQKQFVILPLSE-ES-PFLVLQSLKN
FLIW_OCEIH       -----MQIESSYLGSIDIDVKKILQFPAGLPGFAEEKEFVILEIPE-NP-MFHVLQSVHN
FLIW_BACSK       -----MQLETSYLGTVKYKQEDIIVFQGGLPGFPEETEFILLPFNE-QP-PFYILQSVRT
FLIW_TREDE       -----MEIKTKAMGLVEIQDEQIIELVDGFYGFEEFHKYALLDS-G-KE-PFFWVQSLDD
FLIW_TREPA       -----MEIQTKTLGTQTVEAHQIITLERGLYGFEKYHRFALFDA-V-QV-PFIHMQSLDD
FLIW_SYNAS       -----MKISTTRFGMIEISESDIILMRRGILGFEESKKYALLYQDV-KN-PFLWFQSLDD
FLIW_SYNWW       -----MKIVSTLLGELEFEEEDIIMFPAGIPAFEQEKSFLLIAM-G-EGVPFYYLQSALN
FLIW_SYMTH       -------------------MDNVFEFPAGLYGFPDLKRFVVVDVPG-AGDVVKQLVSTED
FLIW_THEMA       ------MVYKTKLGEIEISDESIFTFEKGIPGFEHLRKFALVFP-Q-ETFPIGWLLSLED
FLIW_THEP1       ------MVYKTKLGEMEISDESIFTFEKGIPGFEHLRKFALVFP-Q-ETFPIGWLLSLED
FLIW_PSELT       ------MIYKTKLGEIDIRDEDILYFNEGIPGFTHLRKFALI-P-I-QNQPIQWLTSIED
FLIW_LEPBL       ---MEIEIQTKPFGKMQISEKQILSFPEGLLGFEDYKKFALIEE-E-EESVFKWLQSVEE
FLIW_LEPBJ       ---MEIEIQTKPFGKMQISEKQILSFPEGLLGFEDYKKFALIEE-E-EESVFKWLQSVEE
FLIW_LEPIC       ---MGIEIQTKPFGKMQVSERQILSFPEGLLGFEEYKKFALIEE-E-EESVFKWLQSTEE
FLIW_LEPIN       ---MGIEIQTKPFGKMQVSERQILSFPEGLLGFEEYKKFALIEE-E-EESVFKWLQSTEE
FLIW_BORBU       -------------MIDEKS--IEFDFPEGILGFENIKKFIIKDS-K--YKPFSIMQSINK
FLIW_BORBP       -------------MINEKS--IGFDFPEGILGFENIKKFIIKDS-K--YKPFSIMQSINK
FLIW_BORAP       -------------MTNENSIGIEFDFPEGILGFENIKTFIIKDS-K--HKPFSIMQSINK
FLIW_CAMJJ       ---------------------MTLAVKCPILGFEETKNMEFSTIDE----VFVRLKS-LD
FLIW_CAMJR       ---------------------MTLAVKCPILGFEETKNMEFSTIDE----VFVRLKS-LD
FLIW_CAMJE       ---------------------MTLAVKCPILGFEETKNMEFSTIDE----VFVRLKS-LD
FLIW_CAMJ8       ---------------------MTLAVKCPILGFEETKNMEFSTIDE----VFVRLKS-LD
FLIW_CAMJD       ---------------------MTLAVKCPILGFEETKNMEFSTIDE----VFVRLKS-LD
FLIW_CAMC1       ---------------------MIFSVKSPILGFEHIKTMELIELDK----FFVKLAS-KD
FLIW_CAMC5       ---------------------MTFSVKSPILGFEHIKTMELIELDK----FFVKLQS-KD
FLIW_CAMFF       ---------------------MTFSVKSPILGFEGIKNVEITKIDD----FFVKMQD-KD
FLIW2_HELPJ      ---------------------MIFDVKAPILGFETIHKMHLQKIDE----IFLRLNSAED
FLIW2_HELPH      ---------------------MLFDVKAPILGFETIHKMHLQKVDE----IFLRLNSAED
FLIW2_HELPY      ---------------------MIFDVKAPILGFETIHKMRLQKIDE----IFLRLNSTEE
FLIW1_HELAH      ---------------------MLFDVKVPILGFETIHKMRLQKIDE----IFLRLSSAEE
FLIW1_HELHP      ---------------------MIFEVKSPILGFESVAKMKLEKIDD----LFMKLYNAEG
FLIW2_WOLSU      ---------------------MEFEVKSPILGFESVRGMRLEKIDD----LFMKLKNAEA
FLIW_SULDN       ---------------------MKFDVCVPILGFENVKEVTLEKIDD----AFMRMESSND
FLIW1_HELPJ      ---------------------MNYFLKAPILGFEHINEVRLEKIDS----LFSRLMGQTN
FLIW1_HELPH      ---------------------MNYFLKAPILGFEHINEVRLEKIDS----LFSRLMGQTN
FLIW2_HELAH      ---------------------MNYFLKAPILGFEHISGVRLEKIDS----LFSRLMGQTN
FLIW1_HELPY      ---------------------MNYFLKAPILGFEHINEVRLEKIDS----LFSRLISQTN
FLIW1_WOLSU      ---------------------MVYELKSPLLGFEEIKEFDLVEVDE----MFAKIKAINN
FLIW2_HELHP      ---------------------MTYELKMPILGFDATK-IELEKIDE----TFSKIRGLDG
FLIW_RHOBA       -----MRIDSHRFGTLELNADQLFLFPQGLIGMESLHQWALIPDPD--NASVAWLQSAAR
                                          .   : .:                     .     

FLIW_DESVH       P--GLGLLVADPYSFLTDYQIRVGDPEQRLLKLENI--RQVAVLVTVSIP--AGQPEK--
FLIW_DESVV       P--GLGLLVADPYSFLTDYQIRVGDPEQRLLKLENI--RQVAVLVTVSIP--AGQPEK--
FLIW_DESAG       A--RLGLLVADPYSFLSDYQIKVSDAEQKLLRLRNI--RQVAVLVTVSIP--PGQPDK--
FLIW_DECAR       P--MLAFQIVDPVMLGFNYELALSDAENALLQSPSP--EDVAVMQVLFRK-EQDDKGS--
FLIW_AZOSB       A--DVAFSITGPEQLGINYEFALSDEEVATLGLASP--AEALVAVIVRKDGEAGSPAST-
FLIW_CHRVO       P--GITFSLALPDRLGVRFQIELSDEEVAQLQLSGP--QDAAILLMLYRPLDLDRDSHPV
FLIW1_DESPS      A--AVTFTLVAPDHYGLHYDFNLSDEEQTLLQAEEP--MQLAIFLIVSKG--EGQYAG--
FLIW_DESHY       A--DLSFLLIDPFSFIPEYEFVLSDEMAGELELSEE--NPPQVFLIGTVRE-KITDMTV-
FLIW_CARHZ       P--EIYFILIEPSRLLADYHVELSCEQQGLLHLSEE--TPVLSLNIVRIPP-EAKEMII-
FLIW_MAGMM       P--EIAFIVINPFDFFSDLEFAVEDEDASSLVLARS--EDVEIFTLVTIPEGRPEEMRT-
FLIW2_DESPS      P--DMAFVLTDPNNFFPDYQIQPGKDEHTTLGISGS--DEYFILSVVTVPAD--QKITL-
FLIW_PELCD       P--DLAFVLTDPTNFFLDYKVVPDARERAKLGIGTD--DDCHALAVVTVPPD--RKVTL-
FLIW_MOOTA       P--EVAFLLVDPFLFFPGYAVDLPARLQEELAIKDP--ADALVYAVVTIPDGDIRRATA-
FLIW_GEOSL       P--ELAFVVVDTKECASDYAVKLTAEESEKLCVNDG--DEVVLLAVVTMASDP-FNITV-
FLIW_GEOUR       P--DLAFVVADAKNCAPGYTFALTAEECRALELSER--SEAIFLLVVTMAPEP-GDITV-
FLIW_GEOMG       P--DLAFVMVDARQTLPDYAVSLTSDEYERLSLDEK--SNTVVFLVVTLATDP-ADITV-
FLIW_BDEBA       P--AIAFPVLEPELFAPQYKATLTKGDMEALKLTAQ--DKARYFSIVTIPDDP-TLMTA-
FLIW_CLOTE       E--NIGIPVLSPFTICSDYEVKLTEEQIKNLKIKSE--EEVWVLNTVTIN-SDYKEITT-
FLIW_CLOK5       E--NIGIIVASPFDILKDYEFELNEDKTAELKIENM--EDIFIVNTVTLN-SVLENITI-
FLIW_CLOBH       E--DIGIIVTSPFNIENNYEIQLEEEQITNLKLQDE--KDALVLNTVTLD-SDIDKITV-
FLIW_CLOB1       E--DIGIIVTSPFNIENNYEIQLEEEQITNLKLQDE--KDALVLNTVTLD-SDIDKITV-
FLIW_CLOBL       E--DIGIIITSPFNIEKDYEIQLEEEQITNLKIQDE--KDALVLNTVTLS-SDIDKITV-
FLIW_CLONN       N--EIGFIVTSPFSIIKDYEINLDDSVIERLNIENE--KDVLVLNTVTLH-SKLENITV-
FLIW_CLOB8       D--GVGLIVTSPYDFFEDYELKLSEDIINNLKIEMP--KDVMVITTITLN-SEAKKITT-
FLIW_CLOAB       K--ETAFIVSSPFYVKADYEVNLSEELVKELKIDSE--KDVLIINTVNLS-KDIKKMTT-
FLIW_CLOD6       D--CIGFIVVSPFEIIKEYEIVLNQETIEKLEVKSP--NDIMLLNIITVG-QTLEESTV-
FLIW_CALS4       P--DIAFVVIDPRVFKPDYTFEIDEELKNFLAVEDV--NHLLIFVIVVIP-EKIEEMTA-
FLIW_GEOKA       P--ALGFVLIEPFSYFPTYEIELDDNTLEQLQITGE--QDVALYVILTVA-DPFDDTTA-
FLIW_GEOTN       P--ALGFVLIEPFSYFPTYEIDLDDNTLEQLQITGE--QDVALYVILTVA-DPFDDTTA-
FLIW_ALKHC       V--DLAFIIVNPFSFFPEYRVKLPEATIVQLNITNE--NDVAIFSLLTVK-EPFSETTV-
FLIW_BACSU       E--NLAFIVVSPFIFFKNYEFDLDESTAELLDIDNI--QDVEVMTILTMA-EPFEKSTA-
FLIW_BACLD       E--ELAFIVASPFVFFKDYGFDLDETTVELLEIESA--EDVEVMAILTIE-EPFEKSTA-
FLIW_BACVZ       E--HIAFIVASPFIFFKGYEFDIDHATLELLHIEDI--EDVEVMAILTLE-EPFENTTA-
FLIW_BACP2       A--ELGFIVSSPFLFFNQYEFDLDETVVEILEVEDA--NDVEVMVILTME-SSIEKTTA-
FLIW_OCEIH       P--NLAFVITDPYQIYTSYTFELDDYTIESLQITSQ--EDVAVFAIMTLK-EPFHKSTI-
FLIW_BACSK       K--EIGFVCINPFLFWPDYEVELADSVVRQLSAESE--QDVAIFVFLTIQ-QPFSKSTA-
FLIW_TREDE       Q--NLAFIVIDPFLFRPDYELDIDDELLKPIEAESP--KDLLVFALVTIP-PAGSPITA-
FLIW_TREPA       P--ALSFIAIDPFLFRPDYELDIDDVLLQPLDISSP--TDVLVFALVTIP-PDGSAVTA-
FLIW_SYNAS       G--ATAFVVIDPFLLQPYYQPELNDDTLEKLEIDNP--EDVALMVIVSIR-SNPVLLTA-
FLIW_SYNWW       P--ELCLVVANPFAFFPRYSIEIGQEELQRLDCSQR--EELLLYVILTVP-QDFRESTA-
FLIW_SYMTH       P--NVGFTLVFPFAFFPRYSPDIPEEELVAVGAESA--EQVLLYAIASVP-EDFRKATA-
FLIW_THEMA       S--EVGLPVVDPKLVRADYDPAVPSEDLEEIEAENQ--EALLFFCVLTIPPGKPEKTTI-
FLIW_THEP1       P--EVGLPVVDPKLVRADYDPVVLSEDLEEIEAENQ--EALLFFCVLTIPPGKPEKTTI-
FLIW_PSELT       P--FVALPVVDPWLVCIDYSLTLTDEDIQDLDIKDK--NDVGILSILTIPKGCPEKTTI-
FLIW_LEPBL       V--DLAFVVIPPSLFKKEYKPLIPEQELQGIGITDL--EDGLMLVIVTVPGEDPALMTA-
FLIW_LEPBJ       V--DLAFVVIPPSLFKKEYKPLISEQELQGIGITDL--EDGLMLVIVTVPGEDPALMTA-
FLIW_LEPIC       V--DLAFVVIPPSLFKKEYKPLIPEQELLGIGINEI--KESLTLVIVTVPGEDPSMMTA-
FLIW_LEPIN       V--DLAFVVIPPSLFKKEYKPLIPEQELLGIGINEI--KESLTLVIVTVPGEDPSMMTA-
FLIW_BORBU       ---DVSFLVTSPFNFLSEYLPNIQEKDWSDIKAKEE--DEKVILCIINMHVNDYKDITA-
FLIW_BORBP       ---EVSFLVTSPFNFLSEYLPNIQEKDWSDIKAKEE--DERVILCIINMHVNDYKDITA-
FLIW_BORAP       ---DVSFLVTSPFNFLNEYLPNIEEKDWSDIDAKAE--DEKVILCIINMHVNDYKDITA-
FLIW_CAMJJ       GK-DFSFVLINPYLIRPDYEFDIPTYYQELLSLTPE--SNMKIFNIVAIAKSIEESTV--
FLIW_CAMJR       GK-DFSFVLINPYLIRPDYEFDIPTYYQELLSLTPE--SNMKIFNIVAIAKSIEESTV--
FLIW_CAMJE       GK-DFSFVLINPYLIRPDYEFDIPTYYQELLSLTPE--SNMKIFNIVAIAKSIEESTV--
FLIW_CAMJ8       GK-DFSFVLINPYLIRPDYEFDIPTYYQELLSLTPE--SNMKIFNIVAIAKSIEESTV--
FLIW_CAMJD       GK-DFSFVLINPYLIRPDYEFDIPTYYQELLSLTPE--SNMKIFNIVAIAKSIEESTV--
FLIW_CAMC1       D--ETSFTMINPFALR-SYEFDIPSYYEELMDIKES--SQLRIYNIIVVALPLEKSTV--
FLIW_CAMC5       D--ETSFTMINPFALR-SYEFDIPSYYEELMDIRDT--SQLRIYNIIVVSLPLEKSTV--
FLIW_CAMFF       G--DTSFTMINPYSLR-NYEFDIPTYYQDLMQISDK--SELQVYNMLVISSPIEESSV--
FLIW2_HELPJ      NS-VVSFTLVNPFALR-KYEFEVPTPLKILLELEGA--KSVLVANIMVVQTPIELSTV--
FLIW2_HELPH      NS-VVSFTLVNPFALR-KYEFEVPTPLKILLELEGA--KSVLIANIMVVQTPIELSTV--
FLIW2_HELPY      NS-VVSFTLVNPFALR-KYEFEVPTPLKILLELEGA--KSVLVANIMVVQTPIELSTV--
FLIW1_HELAH      NS-VVSFTLVNPFALR-KYEFEVPTPLKILLELEEA--KSVLVANIMVVQTPIELSTV--
FLIW1_HELHP      E--VPHFTLVNPFLLR-EYEFDVPASIKILLDLSDA--KNLLIANIMVIQQPIENSTI--
FLIW2_WOLSU      D--SPVFTLVNPFLLR-EYDFEIPLAMKVLLDLKEN--TNLLVLNIMIIHTPLESSTV--
FLIW_SULDN       E--HISFTLINPFALR-EYDFEIPDATQKLLEIDEK--SNILILNIAIIQTPVEDTVV--
FLIW1_HELPJ      SPMALDMVLVNPYCLR-EYSFVIPKYIELLLELDSH--SKVEVYCVVVLQKNLEDSMV--
FLIW1_HELPH      SPMALDMVLVNPYCLR-EYSFVIPKYIELLLELDSH--SKVEVYCVVVLQKNLEDSMV--
FLIW2_HELAH      SPMALDMVLVNPYCLR-EYSFVIPKYIELLLELDSH--SKVEVYCVVVLQKNLEDSMV--
FLIW1_HELPY      SPMALDMVLVNPYCLR-EYSFVIPKYIELLLELDSH--SKVEVYCVVVLQKNLEDSMV--
FLIW1_WOLSU      P--SIEITLANPYALR-EYSFDIPAYIQALLDINAQ--SKVRVFCTVVIQNPIDESRV--
FLIW2_HELHP      K-QPFEITLINPFSLC-DYAFTIPTADERLLDLDESRGDKVEVYCVVVLQKPIENSVV--
FLIW_RHOBA       G--DRALAVISPRAFFPDYRVHIGRRDLSSLHLTSG----SEVYVMTTVAGHVGKLTT--
                       :    .                  :                             

FLIW_DESVH       ---TALNLTGPILINHRARIGLQVPQTDASLPPQFYLHMDDANGSTTVRRKASPPAAGED
FLIW_DESVV       ---TALNLTGPILINHRARIGLQVPQTDASLPPQFYLHMDDANGSTTVRRKASPPAAGED
FLIW_DESAG       ---TALNLSGPILVNHEAKLGLQVPQVEGKYPAQVYVHPQNE------TKVAAADARHPD
FLIW_DECAR       ---ITPNLRAPLVINTKSRVGLQKVMETMRPNITLSNLSSSI------------------
FLIW_AZOSB       --GLRANFMAPLVINVEGRRGLQKVINRLGCDIVLRERA---------------------
FLIW_CHRVO       LGALQANLCNPLVISLSSRRGIQKT--GLKIDILLHTP----------------------
FLIW1_DESPS      ---LNANISGPIVINVQRQRALQKVLQQSRVLTTIIDQ----------------------
FLIW_DESHY       ------NLLAPIVVNRNKSIGRQIILDKTEYSIRHKLFSEAKASETPEGGK---------
FLIW_CARHZ       ------NLKAPVVFNLQEKIARQIILD-ADYPVRYPIPLSKVKEKADAGTK---------
FLIW_MAGMM       ------NLAGPVVVNVQNRLGKQILCK--DYSPRQPLIPDSMRSQLKEQARSSKGGHVAG
FLIW2_DESPS      ------NLAAPIIFTPTNNRAVQVILGGDGYSTKTPLPTVKRHERRSVVNE---------
FLIW_PELCD       ------NLMAPVLFAPATNRAIQVVLEKSQYKTRHPLPA---------------------
FLIW_MOOTA       ------NLVGPIIINPTVRLGMQLILEGTKYTTRHQLFKESFSDDESIPSSGGNEG----
FLIW_GEOSL       ------NLQGPIALNPKRMLAKQIVLEGSRYTTKHPFFDQAARSKAPGKR----NASGEV
FLIW_GEOUR       ------NLRGPIVLNPERLIARQIVIEGEKYTTRHPFFETSEKKQSGLQRLER-QPEKSV
FLIW_GEOMG       ------NLQGPIVLNPERMIAKQIVLEGSRFPSRHPLFGIAKGRE-----------TVET
FLIW_BDEBA       ------NLKAPVVVNIEARTARQCVLQDNNLAIREPIFTKLQQRVVQNPAVAIKNQSTGI
FLIW_CLOTE       ------NLRAPIIINIKERIGEQIILKNEEYKIKYPIFQEENKC----------------
FLIW_CLOK5       ------NLKAPIVINIKENIGEQLILDKVEYPIKYPLFKGEVSC----------------
FLIW_CLOBH       ------NLRAPIIINIKEKIGEQIIINSDKYKVKHSLFKEEA------------------
FLIW_CLOB1       ------NLRAPIIINIKEKIGEQIIINSDKYKVKHSLFKEEA------------------
FLIW_CLOBL       ------NLRAPIIINIKEKIGEQIIINSDRYKVKHPLFKEEA------------------
FLIW_CLONN       ------NLCAPIVINIKTKLGEQIILNNGKYQIKHPLFKEGI------------------
FLIW_CLOB8       ------NLQGPIIINISNNLGEQIILDNSKYKIKQPLIGE--------------------
FLIW_CLOAB       ------NLGAPIIININKHLGKQIIISDDEKMIKYPMIHS--------------------
FLIW_CLOD6       ------NMKAPIVINVRNNCGMQIILQDEEYSIWHPLLRGDGGC----------------
FLIW_CALS4       ------NLKAPIIINAENNRGVQIILDNDKYLIKHPILEELKNAYSHA------------
FLIW_GEOKA       ------NLQAPIVINARKRLGKQVILTNTNYKTKHRLFPEKVAK----------------
FLIW_GEOTN       ------NLQAPIVINVHKRLGKQVILTNTNYKTKHRLFPEKVAK----------------
FLIW_ALKHC       ------NLQAPIVINANKQMGKQLVLGDTAYDRKQPLFQKELVLAKEAK-----------
FLIW_BACSU       ------NLLAPIIVNRKNMMAKQVVLHDSSYTTKHPIG-GESC-----------------
FLIW_BACLD       ------NLMAPIVVNRRKMLAKQVILHDSSYLTKQPIG-GEAC-----------------
FLIW_BACVZ       ------NLKAPIIVNKKEMKAKQIILHDASYETKHLIG-GGSC-----------------
FLIW_BACP2       ------NLRAPIIVNRKNMKAKQVILHDSAYHTKHLLEVASSC-----------------
FLIW_OCEIH       ------NLKAPIVINMKKQLAKQYVLNLDEYSSQASIQSPPLKEGE--------------
FLIW_BACSK       ------NLRAPIAVHAKKRFAKQLMLDGERYSLKAPIHTAG-KGGR--------------
FLIW_TREDE       ------NLQGPLIINKKNKKAFQAVLNDGKWNTKHDILA--ELNAAGRN-----------
FLIW_TREPA       ------NLQGPLIVNKKNRKAMQVAMGGDRWRTKHDIVA--EMAERRAQEQC--------
FLIW_SYNAS       ------NLRAPIVINAAKKKACQVVLEDSRFPIRYDILKNREFLLGGHCYEISATAP---
FLIW_SYNWW       ------NLVAPLIINQESKKGLQFIATNSDYTTRHPIFQPTQAEEQTGIAAAEEG-----
FLIW_SYMTH       ------NLRAPVLFNPFTRKGRQVILGDDRYGIREPLFQGADR------IPAEEGR----
FLIW_THEMA       ------NLRAPIILNQKKKKGIQTILENEDYQLRHLLSEEIERSKTVV------------
FLIW_THEP1       ------NLRAPIILNQKKKKGIQTILENEDYQLRHLLSEEMERSKTVV------------
FLIW_PSELT       ------NLLAPIVINLKNRKAKQIIQENSSYSVKHLVKDEIERSQSLLKKSKTGSE----
FLIW_LEPBL       ------NMQGPILINKKTLLGKQFISRNESHSVREKILASAAVEMD--------------
FLIW_LEPBJ       ------NMQGPILINKKTLLGKQFISRNESHSVREKILASAAVEMD--------------
FLIW_LEPIC       ------NTQGPILINKETLIGKQFISRNESHSVREKIFESAAVEIG--------------
FLIW_LEPIN       ------NTQGPILINKETLIGKQFISRNESHSVREKILESAAVEIG--------------
FLIW_BORBU       ------NLKAPIIINKKKLLGKQAICTNEKYSLHHKVFKE--------------------
FLIW_BORBP       ------NLKAPIIINKKKLLGKQAICTNEKYSLHHKVFKE--------------------
FLIW_BORAP       ------NLKAPIIINKKKLLGKQAICTNEKYSLRHKVFKE--------------------
FLIW_CAMJJ       ------NFLAPVVINLDNNTMVQVI-LDTVNYPDFFQADQIANYIKK-------------
FLIW_CAMJR       ------NFLAPVVINLDNNTMVQVI-LDTVNYPDFFQADQIANYIKK-------------
FLIW_CAMJE       ------NFLAPVVINLDNNTMVQVI-LDTVNYPDFFQADQIANYIKK-------------
FLIW_CAMJ8       ------NFLAPVVINLDNNTMVQVI-LDTVNYPDFFQADQIANYIKK-------------
FLIW_CAMJD       ------NFLAPVVINLDNNTMAQVI-LDTVNYPDFFQADQIANYIKK-------------
FLIW_CAMC1       ------NFVAPIVCNMDNMTLSQVV-LDVTKYPQYGQAEMIENFIQK-------------
FLIW_CAMC5       ------NFVAPIVCNMDNMTLSQVV-LDVGAYPQYGQAEPIENFIQK-------------
FLIW_CAMFF       ------NFMAPIVCNTTNMTLSQVI-LDPVNYPQYSQAEKISTLLKKK------------
FLIW2_HELPJ      ------NYLAPLIFNLDKQLMGQVV-LDSKKYPHYHLRENILSHTHE-------------
FLIW2_HELPH      ------NYLAPLIFNLDKQLMGQVV-LDSNKYPHYHLRENILSHTHE-------------
FLIW2_HELPY      ------NYLAPLIFNLDKQLMGQVV-LDSNKYPHYHLRENILSHTHE-------------
FLIW1_HELAH      ------NYLAPLIFNFDKQLMGQVV-LDSNKYPHYHLRENILSHTHE-------------
FLIW1_HELHP      ------NFLAPLIFNFDNLTMAQVV-LDSTQYPLYSLNEPIGKYYDKEEAQKGEQAAPVR
FLIW2_WOLSU      ------NFLAPVIFNFDNHTMGQLV-LESHRYPAYGLAETISSFFNSD-------STPTQ
FLIW_SULDN       ------NFIGPMIFNTDNNKAAQLV-LSES--TKYGVAEKISLYLKK-------------
FLIW1_HELPJ      ------NFLAPLVFNSKNGFGAQVA-LSMMDYPDFGFRDPLKSFVVKERERA--------
FLIW1_HELPH      ------NFLAPLVFNSKNGFGAQVA-LSMMDYPDFGFRDPLKSFVVKERERA--------
FLIW2_HELAH      ------NFLAPLVFNSKNGFGAQVA-LSMMDYPDFGFRDPLKSFVIKERERA--------
FLIW1_HELPY      ------NFLAPLVFNSKNGFGAQVA-LSMMDYPDFGFRDPLKSFVIQERERA--------
FLIW1_WOLSU      ------NFLAPLIFNDDNQTAAQIA-LSIKDYPDFSVADKIKNYVKE-------------
FLIW2_HELHP      ------NLMAPFVFNPANACALQVTTLPVAEYPQFSKVLPLKEFLSKEILETLNR-----
FLIW_RHOBA       ------NLRAPLMLNLDRRLGCQVITNDDR-PMRQPLPTVAAESAKPLPTSQVRAA----
                       *   *.          *                                     

FLIW_DESVH       KGDVQE--------
FLIW_DESVV       KGDVQE--------
FLIW_DESAG       DGGAENW-------
FLIW_DECAR       --------------
FLIW_AZOSB       --------------
FLIW_CHRVO       --------------
FLIW1_DESPS      --------------
FLIW_DESHY       --------------
FLIW_CARHZ       --------------
FLIW_MAGMM       GR------------
FLIW2_DESPS      --------------
FLIW_PELCD       --------------
FLIW_MOOTA       --------------
FLIW_GEOSL       TAA-----------
FLIW_GEOUR       PPAG----------
FLIW_GEOMG       SCAG----------
FLIW_BDEBA       DVATKLHVVRDAEL
FLIW_CLOTE       --------------
FLIW_CLOK5       --------------
FLIW_CLOBH       --------------
FLIW_CLOB1       --------------
FLIW_CLOBL       --------------
FLIW_CLONN       --------------
FLIW_CLOB8       --------------
FLIW_CLOAB       --------------
FLIW_CLOD6       --------------
FLIW_CALS4       --------------
FLIW_GEOKA       --------------
FLIW_GEOTN       --------------
FLIW_ALKHC       --------------
FLIW_BACSU       --------------
FLIW_BACLD       --------------
FLIW_BACVZ       --------------
FLIW_BACP2       --------------
FLIW_OCEIH       --------------
FLIW_BACSK       --------------
FLIW_TREDE       --------------
FLIW_TREPA       --------------
FLIW_SYNAS       --------------
FLIW_SYNWW       --------------
FLIW_SYMTH       --------------
FLIW_THEMA       --------------
FLIW_THEP1       --------------
FLIW_PSELT       --------------
FLIW_LEPBL       --------------
FLIW_LEPBJ       --------------
FLIW_LEPIC       --------------
FLIW_LEPIN       --------------
FLIW_BORBU       --------------
FLIW_BORBP       --------------
FLIW_BORAP       --------------
FLIW_CAMJJ       --------------
FLIW_CAMJR       --------------
FLIW_CAMJE       --------------
FLIW_CAMJ8       --------------
FLIW_CAMJD       --------------
FLIW_CAMC1       --------------
FLIW_CAMC5       --------------
FLIW_CAMFF       --------------
FLIW2_HELPJ      --------------
FLIW2_HELPH      --------------
FLIW2_HELPY      --------------
FLIW1_HELAH      --------------
FLIW1_HELHP      DSQKK---------
FLIW2_WOLSU      EA------------
FLIW_SULDN       --------------
FLIW1_HELPJ      --------------
FLIW1_HELPH      --------------
FLIW2_HELAH      --------------
FLIW1_HELPY      --------------
FLIW1_WOLSU      --------------
FLIW2_HELHP      --------------
FLIW_RHOBA       --------------