CLUSTAL format seed alignment for MF_01187

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PREY_MOUSE            -MLSATCRRLAPALRRLRAL-SAVAGRFLQVPGARL-----CSDQSERAEQP-HTFHPAL
PREY_RAT              -MLTTTCRRLSQALQRPHAL-SAVAQRCLRAPGARS-----YADQNEKAEQP-RTFHPAL
PREY_HUMAN            -MLSGARCRLASALRGTRAPPSAVARRCLHASGSRP-----LADRGKKTEEPPRDFDPAL
PREY_XENTR            -MLAVRAWGRTYNTLVQRKLNAACPTGALPAVTLRPLHCSLVARSPEQSLKDSKTFDPTL
Y767_VESOH            ------------------------------------------------------MIDEAL
I0I334_CALAS          MKNFLKFLFFAVIFAGVVYALKQIFAPSNQNSAATSGVLPSQPIKSLDEAPLGGKISEEL
A3N1S7_ACTP2          -------------------------------------------------------MNEKL
O33186_MYCTU          ------------------------------------------------------MLDEAL
F5Z2Q5_MYCSD          ------------------------------------------------------MIDDEL
Q9CC33_MYCLE          ------------------------------------------------------MLDDLL
B2HR43_MYCMM          ------------------------------------------------------MLDEKL
A1UH90_MYCSK          ------------------------------------------------------MLDEKL
A0A375YMZ3_MYCPF      -----------------------------------------------------MALDDTL
Q4JVY6_CORJK          ------------------------------------------------------MIDQKL
Q8NQM9_CORGL          -----------------------------------------------------MSLDPQL
B1W5Y4_STRGG          -----------------------------------------------------MNPEDPL
Y064_RHOS4            -----------------------------------------------MTGTTL--FDRRM
Y2896_RHOS5           -----------------------------------------------MTESPQ--FDRRM
Y2369_PARDP           -----------------------------------------------MTDTTERGYDRHM
Y037_ROSDO            -----------------------------------------------MSETEVV-FDRRM
H6SQT9_PARPM          -----------------------------------------------MT-TSVRPTDPKL
Y2845_BRUA2           ----------------------------------------------MDDKVETGNIDVRL
B9KHI2_ANAMF          ------------------------------------------------------------
Y1098_BARBK           -----------------------------------------------------MTTDPKM
Y1286_BARHE           -----------------------------------------------------MITDPKM
Y623_NEIMF            -------------------------------------------------------MEKKF
Y3844_PSESM           -------------------------------------------------------MDTKL
Y592_CUPPJ            -------------------------------------------------------MDNRL
Y2101_BORA1           -------------------------------------------------------MESRL
Y2088_METFK           -------------------------------------------------------MDAKL
Y1884_LEGPL           -------------------------------------------------------MDKKL
Y1400_FRATH           -------------------------------------------------------MDHSV
Y733_FRATM            -------------------------------------------------------MDHSV
Y3426_ALIF1           -------------------------------------------------------MDYRL
Y1876_VIBCH           -------------------------------------------------------MDHRL
YCAR_ECOLI            -------------------------------------------------------MDHRL
Y997_SODGM            -------------------------------------------------------MDHRL
Y2578_YERPN           -------------------------------------------------------MDHRL
Y1511_IDILO           -----------------------------------------------------MAIDKTT
Y1782_PSEA6           -----------------------------------------------------MAFDKKL
Y902_PSYIN            ------------------------------------------------------MLDIKL
Y388_BLOPB            -------------------------------------------------------MKYQL
Y377_BLOFL            -------------------------------------------------------MQKKL
Y657_HAES1            -------------------------------------------------------MNGRL
Y997_HISS2            -------------------------------------------------------MNGRL
Y859_PASMU            -------------------------------------------------------MDSTL
Y252_WIGBR            -------------------------------------------------------MDKKL
D3DII4_HYDTT          ------------------------------------------------------MVDEEL
Y256_BAUCH            -------------------------------------------------------MEISL
A1SGK5_NOCSJ          --------------------------------------------------MNAVNIDPEL
F8AYT6_9ACTN          -----------------------------------------------------MSLDPLL
A4FNK3_SACEN          -------------------------------------------------------MEPQL
G0FNM7_AMYMS          ---------------------------------------------------MAITLDAQL
H6RKX1_BLASD          -----------------------------------------MTGTQGTSAGGPLGLDPDL
D3Q0A6_STANL          ----------------------------------------------------MPTLDPAL
Q9KZL7_STRCO          -----------------------------------------------------MPLEAGL
B1VUW2_STRGG          -----------------------------------------------------MALEAGL
D7GCL1_PROFC          -----------------------------------------------------MALTAEL
B8DIS5_DESVM          -----------------------------------------------------MSLNKEL
Q72EC2_DESVH          -----------------------------------------------------MPLNKEL
M1WRR0_PSEP2          -----------------------------------------------------MALNKEL
T2G6Z6_DESGG          -----------------------------------------------------MAFNKEL
B8FGY5_DESAL          -----------------------------------------------------MPVKKDF
B9M8W6_GEODF          -----------------------------------------------------MTISQEL
Q74AU3_GEOSL          -----------------------------------------------------MALSIEL
                                                                                  

PREY_MOUSE            ------LQFLVCP-LSKKPLRYEASTNE-----LVNEELGIAYPIIDGIPNMIPQAARTT
PREY_RAT              ------LQFLVCP-LSKKPLRYDASTNE-----LINDELGIAYPIIDGVPNMIPQAARTT
PREY_HUMAN            ------LEFLVCP-LSKKPLRYEASTNE-----LINEELGIAYPIIDGIPNMIPQAARMT
PREY_XENTR            ------LQFLVCP-LSRKSLRYEESTNE-----LINDELGIAYPIVDGIPNMIPQDARMI
Y767_VESOH            ------LKLLVCP-KSKAPLK--QVGNE-----LICEVSGLAYPIEDGIPILLVEEAREL
I0I334_CALAS          ------LKILVCP-EDKGPLELVDDG-----KFLLNPRNGYKYPIRNGIPVMLIEEGKKY
A3N1S7_ACTP2          ------INHLACP-VTNTGLEWDKAN-----NRLISREAKLAYPIENGIPVLLPEAGEKL
O33186_MYCTU          ------LAILVCP-ADRGPLVLVEDG---DIQVLYNPRLRRAYRIEDGIPVLLVDEAREV
F5Z2Q5_MYCSD          ------LAILVCP-ADRGPLLRVKRS---ADEVLYNPRLRRAYRIEDGIPVLLIDEATDV
Q9CC33_MYCLE          ------LSILVCP-ADRGPLVLVDQGYGAGGQSFYNPRLRRAYRIDDGIPVLLVDEARDV
B2HR43_MYCMM          ------LKILVCP-ADRGPLLLVEDG--ERGRLLYNPRLRRAYRIDDDIPVLLIDQARDV
A1UH90_MYCSK          ------RAILVCP-QDRGPLLLVGDE------MLYNPRLRQGYRIDDGIPVLLVDEAVAV
A0A375YMZ3_MYCPF      ------LAILVCP-QDRGPLLAV-DG------CLYNPRLKRKYRIDDGIPVLLIDEAVSV
Q4JVY6_CORJK          ------LEILACP-IDKQPLEDHGDY-------LVNPRLNKAYPVQDGIPVLLVEEAKDW
Q8NQM9_CORGL          ------LEVLACP-KDKGPLRYLESE-----QLLVNERLNLAYRIDDGIPVLLIDEATEW
B1W5Y4_STRGG          ------LALLACP-LDKGPLSLLTEE-----EALYNPRLRLSYPIVDGIPQLLPSSGRKV
Y064_RHOS4            ------LEALVCP-VTQAGLAYDAD-----RQELISKQARLAFPIRDGIPIMLVSEAREL
Y2896_RHOS5           ------LEALVCP-VSQSGLSYDAE-----RQELVSRQARLAFPIRDGIPIMLVSEAREL
Y2369_PARDP           ------LEALVCP-VTHATLRYDAE-----AQELISEAAGLAFPIRGGIPIMLLNEARQI
Y037_ROSDO            ------LEALICP-RSHETLKYDQE-----RQELISETANLAYPIRNGIPVMLIDEARVL
H6SQT9_PARPM          ------LDLLVAP-GSQNPLRYDAE-----AQELVDDVGGLAFPIRDGIPVMLVDEARVL
Y2845_BRUA2           ------LELLVCP-LTKGPLEYDAE-----RSELVSRKARLAYPVRGGIPIMLPSEARSL
B9KHI2_ANAMF          ---------MVCP-LTGGELYYDAD-----SCELVSENAGLAFPVHDGIPVMLADEARKL
Y1098_BARBK           ------LELLVCP-ITGGNLSFNRK-----TQELISLKAKLAYPIRDGVPIMLASEARPL
Y1286_BARHE           ------LELLVCP-ITGGTLSLNRK-----TQELISLEAKLAYPIRDGVPIMLASEARPL
Y623_NEIMF            ------LDILVCP-VTKGRLEYHQD-----KQELWSRQAKLAYPIKDGIPYMLENEARPL
Y3844_PSESM           ------LDILACP-ICKGPLKLSAD-----KTELISKGAGLAYPVRDGIPVMLESEARTL
Y592_CUPPJ            ------LEILVCP-LCKGKLEYDRA-----AQELICHADKLAYPIRDGIPVMLADEARQS
Y2101_BORA1           ------LDILVCP-LCKGRLEFLRA-----QDELVCHADRLAFPVRDGIPVMLESAARPL
Y2088_METFK           ------LEILVCP-ICKGPLHYKKN-----EQELICKPCRLAYPIQDGIPVMLEDEARKL
Y1884_LEGPL           ------LEILVCP-LCKGKLLFKK-------HELICKFDRLAFPVRDDIPVMLEQEARLI
Y1400_FRATH           ------LNVLVCP-ICKANLYYDKE-----NQVLVCKADKLAYPIRENIPVMLVEEAKKM
Y733_FRATM            ------LNVLVCP-ICKANLYYGKE-----NQVLVCKADKLAYPIRENIPVMLVEEAKKM
Y3426_ALIF1           ------LEIVACP-VCKGKLNYDKD-----KQELICKIDRLAYPIKDGIPVMLEPEARRM
Y1876_VIBCH           ------LEIVACP-VCKGKLTYDKD-----RQELICKLDRLAYPIKEGIPVLLEPEARSM
YCAR_ECOLI            ------LEIIACP-VCNGKLWYNQE-----KQELICKLDNLAFPLRDGIPVLLETEARVL
Y997_SODGM            ------LEIVACP-VCNGKFYYNKE-----RQELICKSDALAYPLCDGIPVLLESEARAI
Y2578_YERPN           ------LEIVACP-VCNGKLYFNKE-----NLELVCKVDNLAYPVRDGIPVLLENEARPL
Y1511_IDILO           ------LAILACP-KCKGKLTYYAD-----KDELVCRGERLAYPIDENIPVLIADKAREL
Y1782_PSEA6           ------LEIVACP-VCKGTLILNKDSNG--NERLVCRFDRLAYPIEQNIPVLLETEALVL
Y902_PSYIN            ------LDIIACP-LCKGKLSYKKN-----SNELICKFDHLAYPVIDGIPALLKVKARTI
Y388_BLOPB            ------LKIIVCP-VCHSKLSFDLE-----KKELICNVDNLAFPIRKGIPVLLKRDARNF
Y377_BLOFL            ------LEIIVCP-FCYTRLFMNDT-----ETELICNIENISFPLKQGIPVLLKNQIRYL
Y657_HAES1            ------LEIVACP-ICQGRLKYDSE-----NEQLICHFDHIAYPIKQGIPILLSDQAISL
Y997_HISS2            ------LEIVACP-ICQGRLKYDSE-----NEQLICHFDHIAYPIKQGIPILLSDQAIGL
Y859_PASMU            ------LEIVACP-ICHGRLALDQT-----SQKLVCHFDKVAYDINQGIPVLLAEQAMPL
Y252_WIGBR            ------LNIIACP-ICNKKLNFDLI-----RKELICEFDSVAFPIKDGIPILLRDSSYPI
D3DII4_HYDTT          ------LKILACP-KCKKELFYNRE-----RDVLICENCQVFYPIEDGIPILLTDASKPL
Y256_BAUCH            ------LNIIACP-LCQGQLLLQ-------EQELVCQIDALAYPVRTNIPVLLVSEARNI
A1SGK5_NOCSJ          ------LEIIVCP-ACRSELDLV-------EAELVCRGCGLAYPIRDDIPVLLVDEARKP
F8AYT6_9ACTN          ------LEILACPCPAHAPLRQD--T-LGGEPVLVCTSCDLAFPVRDEIPVMLLDEAVPF
A4FNK3_SACEN          ------LEILACPCPAHAPLRQS--D-DG---LLTCTSCGRGFPVRDGIPVLLLEEAV--
G0FNM7_AMYMS          ------LEILACPSPDHAPLRPGAPD-DPEADALTCTECGRVYPVRDGIPVLLLDEATVP
H6RKX1_BLASD          ------LSILACPDTHHTPLTVD-----EAAGELVCATCDRGFPVREGIPVLLLDEARHR
D3Q0A6_STANL          ------LEVLACPDTHHAPLTYD-----SAAQTLTCTECRRIFRIDDGIPVLLLDEATEP
Q9KZL7_STRCO          ------LEILACP-ACHAPLEER-----DAELICTGQDCGLAYPVRDGIPVLLVDEARRP
B1VUW2_STRGG          ------LEILACP-ACHSPLDDRSAA-DSPELVCTGDDCGLAYPVRDGIPVLLVDEARRP
D7GCL1_PROFC          EMPTTFLEIAACP-QCHSKLAVDY---EHSELACTNSLCGLAYPVRDGIPILLVDEARST
B8DIS5_DESVM          ------LEILACP-KCRQPVEPV-----DNERGLKCAQCKVVYPVRDEIPVMLVEEAVPA
Q72EC2_DESVH          ------LDILACP-ACRGELTLL-----DGEEGLRCPACAVVYPVRDEIPVMLVEEAVPA
M1WRR0_PSEP2          ------VKTLACP-QCKGSLTVQ-----PAEDGLACAVCKKIYPVKDDIPIMLVDQAIAE
T2G6Z6_DESGG          ------LDILVDP-VSKQPLTLT-----PEEDGLVCEATGMVYPIRDEIPVMLPEEAITL
B8FGY5_DESAL          ------LEILACP-KCKGKLELN-----EQENGLICRPCKLVYEIRDEIPIMLISEAKAL
B9M8W6_GEODF          ------LSILACP-NCKGELVLL-----ADGSGLVCEACRLRYPVRDGIPVMLVDEAEKL
Q74AU3_GEOSL          ------FEILACP-RCTGEVKPV-----NNGSALVCEACRLRFPVRDDIPVMLLDEAERI
                                  *      .                      : :   :* ::       

PREY_MOUSE            RQNEKQE--EAEQP-------
PREY_RAT              RQKEKQE--ETKQH-------
PREY_HUMAN            RQSKKQE--EVEQR-------
PREY_XENTR            HKDRKPESPDTEQTT------
Y767_VESOH            DKGSDKK--------------
I0I334_CALAS          RDP----NFVPKSDNATA---
A3N1S7_ACTP2          ED-------------------
O33186_MYCTU          DED-EHARLMARGRPAAPQ--
F5Z2Q5_MYCSD          GDD-EHARLIGRAGPADPR--
Q9CC33_MYCLE          DDD-EHAQLMVQAPTTDPQ--
B2HR43_MYCMM          TDD-EHARFTAAGLPTDSPAG
A1UH90_MYCSK          TDDAEHQRLLDRAES------
A0A375YMZ3_MYCPF      DDD-EHRRLVAAAEQS-----
Q4JVY6_CORJK          PVK------------------
Q8NQM9_CORGL          TPNN-----------------
B1W5Y4_STRGG          GSD-DHERLLTRLKASAT---
Y064_RHOS4            ---------------------
Y2896_RHOS5           ---------------------
Y2369_PARDP           RA-------------------
Y037_ROSDO            D--------------------
H6SQT9_PARPM          GDAASAGPDMTPSV-------
Y2845_BRUA2           TE-------------------
B9KHI2_ANAMF          EPDTK----------------
Y1098_BARBK           ---------------------
Y1286_BARHE           QNNGKELHKK-----------
Y623_NEIMF            GEEELEA--------------
Y3844_PSESM           TTDERLDK-------------
Y592_CUPPJ            VPGRVIDPAAPRTE-------
Y2101_BORA1           DAPADTAHAS-----------
Y2088_METFK           PAEEEVE--------------
Y1884_LEGPL           PLEEKDKL-------------
Y1400_FRATH           TLEEVKKYG------------
Y733_FRATM            TLEEVKKYG------------
Y3426_ALIF1           TMEEVESCRSQS---------
Y1876_VIBCH           SMDEGR---------------
YCAR_ECOLI            TADESKS--------------
Y997_SODGM            KLDETNS--------------
Y2578_YERPN           SIDEKHA--------------
Y1511_IDILO           SSEELEKVPS-----------
Y1782_PSEA6           SSEELEKIK------------
Y902_PSYIN            SSDEE----------------
Y388_BLOPB            IL-------------------
Y377_BLOFL            NCKIIDNQ-------------
Y657_HAES1            STSLTNPEQQNQ---------
Y997_HISS2            STSLTNPEQQNQ---------
Y859_PASMU            SARQEEP--------------
Y252_WIGBR            KKR------------------
D3DII4_HYDTT          EELR-----------------
Y256_BAUCH            LVK------------------
A1SGK5_NOCSJ          ---------------------
F8AYT6_9ACTN          GGEARPSVSTSS---------
A4FNK3_SACEN          GGPAPGDPGEG----------
G0FNM7_AMYMS          GDNGSTDADSA----------
H6RKX1_BLASD          TS-------------------
D3Q0A6_STANL          KPGDGAVPEDANTEGE-----
Q9KZL7_STRCO          E--------------------
B1VUW2_STRGG          A--------------------
D7GCL1_PROFC          KKI------------------
B8DIS5_DESVM          ERWEQGQRSVK----------
Q72EC2_DESVH          EDWERGERTPAKRR-------
M1WRR0_PSEP2          QEWTGSK--------------
T2G6Z6_DESGG          VDWKAGKRQAVSA--------
B8FGY5_DESAL          EESVAP---------------
B9M8W6_GEODF          D--------------------
Q74AU3_GEOSL          GDR------------------