CLUSTAL format seed alignment for MF_01189

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

A0A0F0PMK2_KLEAE      MSHSNETKPH--ARDLARPNWSAVFAVAFCVACLITVEFLPVSLLTPMALDLGISEGMAG
A6TFW4_KLEP7          MSHSNETKPH--ARDLARPNWSAVFAVAFCVACLITVEFLPVSLLTPMALDLGISEGMAG
A4W4U2_ENT38          MTEQIQSTPTPHAKEVSRPNWSAVFSVAFCVACLITVEFLPVSLLTPMAQDLGISEGVAG
A0A198GXZ9_9ENTR      MTEHIQTTTRPQTKEVSRPNWSAVFSVAFCVACLITVEFLPVSLLTPMAQDLGISEGVAG
NEPI_SALPA            MNENIAEKFR--ADGVARPNWSAVFAVAFCVACLITVEFLPVSLLTPMAQDLGISEGVAG
V1GZX2_SALER          MNENLTETTR--ADGVARPNWSAVFAVAFCVACLITVEFLPVSLLTPMAQDLGISEGVAG
D2TI30_CITRI          MSECIEEKAR--AEGVARPNWSAVFAVAFCVACLITVEFLPVSLLTPMAQDLGITEGVAG
NEPI_ECOK1            MSEFIAENRG--ADAITRPNWSAVFSVAFCVACLIIVEFLPVSLLTPMAQDLGISEGVAG
NEPI_ECO27            MSEFIAENRG--ADAITRPNWSAVFSVAFCVACLIIVEFLPVSLLTPMAQDLGISEGVAG
NEPI_ECOLI            MSEFIAENRG--ADAITRPNWSAVFSVAFCVACLIIVEFLPVSLLTPMAQDLGISEGVAG
NEPI_SHIBS            MSEFIAENRG--ADAITRPNWSAVFSVAFCVACLIIVEFLPVSLLTPMAQDLGISEGVAG
A0A028AGA4_ECOLX      MSEFIAENRG--ADAITRPNWSAVFSVAFCVACLIIVEFLPVSLLTPMAQDLGISEGVAG
NEPI_SHIDS            MSEFIAENRG--ADAITRPNWSAVFSVAFCVACLIIVEFLPVSLLTPMAQDLGISEGVAG
R9VMN2_9ENTR          ------------MDTVSRPNWSAVFAVAFCVACLITVEFLPVSLLTPMALDLGVSEGLAG
L0M091_ENTBF          MTEPLSSPQP--KDTVTRPNWSAVFAVAFCVACLITVEFLPVSLLTPMAQDLGISEGLAG
                                     ::********:********* ************* ***::**:**

A0A0F0PMK2_KLEAE      QSVTTTAFVAMFSSLFITTVIGKTDRRYVVILFSLLLTLSCLLVSFADSFTLLLLGRACL
A6TFW4_KLEP7          QSVTTTAFVAMFSSLFITTVIGKTDRRYVVILFSLLLTLSCLLVSFADSFTLLLLGRACL
A4W4U2_ENT38          QSVTVTAFVAMFASLFITQVIGTIDRRKVVILFAVLLTLSCVLVSFANSFTLLLLGRACL
A0A198GXZ9_9ENTR      QSVTVTAFVAMFASLFITQVIGTIDRRKVVILFSVLLTLSCLLVSFANNFTLLLLGRACL
NEPI_SALPA            QSVTVTAFVAMFSSLFITQIIQATDRRYIVILFAVLLTASCLMVSFANSFTLLLLGRACL
V1GZX2_SALER          QSVTVTAFVAMFSSLFITQIIQATDRRYVVILFAVLLTVSCLMVSFANSFTLLLLGRACL
D2TI30_CITRI          QSVTVTAFVAMFASLFITQIIQATDRRYVVILFSVLLTLSCLLVSFANSFTLLLLGRACL
NEPI_ECOK1            QSVTVTAFVAMFASLFITQTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACL
NEPI_ECO27            QSVTVTAFVAMFASLFITQTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACL
NEPI_ECOLI            QSVTVTAFVAMFASLFITQTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACL
NEPI_SHIBS            QSVTVTAFVAMFASLFITQTIQATDRCYVVILFAVLLTLSCLLVSFANSFSLLLIGRACL
A0A028AGA4_ECOLX      QSVTVTAFVAMFASLFITQTIQATDRRYVVILFAVLLTLSCLLVSFANSFSLLLIGRACL
NEPI_SHIDS            QSVTVTAFVAMFASLFITQTIQATDRRYVVILFAVLLTISCLLVSFANSFSLLLIGRACL
R9VMN2_9ENTR          QTVTVTAFVAMFASLFITTVIRAADRRYVVIAFAVLLTLSCLLVSFATNFTLLLLGRACL
L0M091_ENTBF          QSVTMTAFVAMFSSLFITHAIGRTDRRYVVVMFAVLLTLSCLLVSFANSFALLLLGRACL
                      *:** *******:*****  *   **  :*: *::*** **::**** .*:***:*****

A0A0F0PMK2_KLEAE      GLALGGFWAMSASLTMRLVPMRVVPKALSIIFGAVSIALVIAAPLGSFLGGLIGWRNVFN
A6TFW4_KLEP7          GLALGGFWAMSASLTMRLVPMRVVPKALSIIFGAVSIALVIAAPLGSFLGGLIGWRNVFN
A4W4U2_ENT38          GLGLGGFWAMSASLTMRLVPARKVPKALSVIFGAVSIALVIAAPLGSFLGGIIGWRNVFN
A0A198GXZ9_9ENTR      GLGLGGFWAMSASLTMRLVPARTVPKALSVIFGAVSIALVIAAPLGSFLGGIIGWRNVFN
NEPI_SALPA            GLALGGFWAISASLTMRLVPARTVPKALSVIFGAVSIALVIAAPLGSFLGGIIGWRNVFN
V1GZX2_SALER          GLALGGFWAMSASLTMRLVPARAVPKALSVIFGAVSIALVIAAPLGSFLGGIIGWRNVFN
D2TI30_CITRI          GLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSVALVIAAPLGSFLGGLIGWRNVFN
NEPI_ECOK1            GLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVIAAPLGSFLGELIGWRNVFN
NEPI_ECO27            GLALGGFWAISASLTMRLVPPRTVPKALSVIFGAVSIALVIAAPLGGFLGELIGWRNVFN
NEPI_ECOLI            GLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVIAAPLGSFLGELIGWRNVFN
NEPI_SHIBS            GLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVIAAPLGSFLGELIGWRNVFN
A0A028AGA4_ECOLX      GLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVIAAPLGSFLGELIGWRNVFN
NEPI_SHIDS            GLALGGFWAMSASLTMRLVPPRTVPKALSVIFGAVSIALVIAAPLGSFLGELIGWRNVFN
R9VMN2_9ENTR          GLALGGFWAMSASLTMRLVPMRVVPKALSVIFGAVSIALVIAAPLGSFLGGIIGWRNVFN
L0M091_ENTBF          GLALGGFWAMSASLTIRLVPMRVVPKALSVIFGAVSIALVIAAPLGSFLGGIIGWRNVFN
                      **.******:*****:**** * ******:******:*********.*** :********

A0A0F0PMK2_KLEAE      GAAVMGVLCTLWVLKALPSLPGESAAQQQNMFGLLKRPGVMAGMCAIFMAFAGQFAFFTY
A6TFW4_KLEP7          GAAVMGVLCTLWVLKALPSLPGESASQQQNMFGLLKRPGVMAGMCAIFMAFAGQFAFFTY
A4W4U2_ENT38          GAAVMGVLCIFWVWKALPSLPGEPAHHKENMFSLLKRPGVLAGMTAIFMAFAGQFAFFTY
A0A198GXZ9_9ENTR      AAAVMGLLCIIWVWKALPSLPGEAAHHKQNMFSLLKRPGVLAGMSAIFMAFAGQFAFFTY
NEPI_SALPA            AAAVMGVLCVIWVVKSLPSLPGEPSHQKQNMFSLLQRPGVMAGMIAIFMSFAGQFAFFTY
V1GZX2_SALER          AAAVMGVLCVIWVVKSLPSLPGEPSHQKQNIFSLLQRPGVMAGMIAIFMSFAGQFAFFTY
D2TI30_CITRI          AAAVMGVLCTIWIVKSLPSLPGESSRHKQNMFSLLNRPGVMAGMIAIFMSFAGQFAFFTY
NEPI_ECOK1            AAAAMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRPGVMAGMIAIFMSFAGQFAFFTY
NEPI_ECO27            AAAAMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRPGVMAGMIAIFMSFAGQFAFFTY
NEPI_ECOLI            AAAVMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRPGVMAGMIAIFMSFAGQFAFFTY
NEPI_SHIBS            AAAVMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRPGVMAGMIAIFMSFAGQFAFFTY
A0A028AGA4_ECOLX      AAAVMGVLCIFWIIKSLPSLPGEPSHQKQNTFRLLQRPGVMAGMIAIFMSFAGQFAFFTY
NEPI_SHIDS            AAAVMGVLCIFWIIKSLPSLPGKPSHQKQNTFRLLQRPGVMAGMIAIFMSFAGQFAFFTY
R9VMN2_9ENTR          GAALMGAACIIWVWQALPSLPGKTEHH-ENMFGLLKRPGVLAGMIAIFMVFAGQFSFFTY
L0M091_ENTBF          GAALMGALCIVWVIKALPSLPGEAAHQQQNMFSLMKRPGVLAGMSAIFLVFVGQFSFFTY
                      .** **  * .*: ::******:.  : :* * *::****:*** ***: *.***:****

A0A0F0PMK2_KLEAE      IRPVYMTLAGFDVDGLTLVLLSFGIASFIGTSLSSVVLKRSVKAALAISPLVLTACAAAL
A6TFW4_KLEP7          IRPVYMTLAGFDVDGLTLVLLSFGIASFIGTSLSSVLLKRSVKAALAIAPLVLTACAVAL
A4W4U2_ENT38          IRPIFTTLSGFGVDGLTLVLLSFGIASFVGTSLSAQFLKLSLKVALAGAPLVLAISAAVL
A0A198GXZ9_9ENTR      IRPVFMTMAGFDVDGLTLVLLSFGIASFIGTSLSSQFLKRSLKVALAGAPLVLAISAAVL
NEPI_SALPA            IRPVYMNLAGFDVDGLTLVLLSFGIASFVGTSFSSYVLKRSVKLALAGAPLLLALSALTL
V1GZX2_SALER          IRPVYMHLAGFDVDGLTLVLLSFGIASFVGTSFSSVILKRSVKLALAGAPLVLALSALVL
D2TI30_CITRI          IRPVYMNLAGFDVDGLTLVLLSFGIASFVGTSLSSFILKRSVKLALAGAPLVLAVSALVL
NEPI_ECOK1            IRPVYMNLAGFGVDGLTLVLLSFGIASFVGTSLSSFILKRSVKLALAGAPFVLALSALVL
NEPI_ECO27            IRPVYMNLAGFGVDGLTLVLLSFGIASFVGTSLSSFILKRSVKLALAGAPFVLALSALVL
NEPI_ECOLI            IRPVYMNLAGFGVDGLTLVLLSFGIASFIGTSLSSFILKRSVKLALAGAPLILAVSALVL
NEPI_SHIBS            IRPVYMNLAGFGVDGLTLVLLSFGIASFIGTSLSSFILKRSVKLALAGAPLILAVSALVL
A0A028AGA4_ECOLX      IRPVYMNLAGFSVDGLTLVLLSFGIASFIGTSLSSFILKRSVKLALAGAPLILAVSALVL
NEPI_SHIDS            IRPVYMNLAGFGVDGLTLVLLSFGIASFIGTSLSSFILKRSVKLALAGAPLILAVSALVL
R9VMN2_9ENTR          IRPVYMNLAGFDVDGLTLVLLSFGIASFVGTSFSSVVMKRSVKLALALAPLTLAISALVL
L0M091_ENTBF          IRPVYTTLAGFSVDGLTLVLLSFGIASFVGTSLSAAILKRSVKGTLACAPFVLTLSALAL
                      ***::  ::**.****************:***:*: .:* *:* :** :*: *: .* .*

A0A0F0PMK2_KLEAE      VLWGESKIVASTVAIIWGFAFALIPVGWSTWITRSLSDQAEKAGSIQVAVIQLANTCGAA
A6TFW4_KLEP7          VLWGESKIIASTVAIIWGFAFALIPVGWSTWITRSLSDQAEKAGSIQVAVIQLANTCGAA
A4W4U2_ENT38          IFWGSDKWVASAIAIIWGFAFALVPVGWSTWITRSLADQAEKAGSIQVAVIQLANTCGAA
A0A198GXZ9_9ENTR      VLWGSDKWVASAIAIIWGFAFALVPVGWSTWITRSLADQAEKAGSIQVAVIQLANTCGAA
NEPI_SALPA            IVWGSDKTVAAAIAIIWGLAFALVPVGWSTWITRSLADQAEKAGSIQVAVIQLANTCGAA
V1GZX2_SALER          ILWGSDKVVAAGIAIIWGLAFALVPVGWSTWITRSLADQAEKAGSVQVAVIQLANTCGAA
D2TI30_CITRI          TLWGGDKVVAAGIAIVWGLAFALVPVGWSTWITRSLADQAEKAGSVQVAVIQLANTCGAA
NEPI_ECOK1            TLWGSDKIVATGVAIIWGLTFALIPVGWSTWITRSLADQAEKAGSIQVAVIQLANTCGAA
NEPI_ECO27            TLWGSDKIVATGVAIIWGLTFALIPVGWSTWITRSLADQAEKAGSIQVAVIQLANTCGAA
NEPI_ECOLI            TLWGSDKIVATGVAIIWGLTFALVPVGWSTWITRSLADQAEKAGSIQVAVIQLANTCGAA
NEPI_SHIBS            TLWGSDKIVATGVAIIWGLTFALVPVGWSTWITRSLADQAEKAGSIQVAVIQLANTCGAA
A0A028AGA4_ECOLX      TLWGSDKIVATGVAIIWGLTFALVPVGWSTWITRSLADQAEKAGSIQVAVIQLANTCGAA
NEPI_SHIDS            TLCGSDKIVATGVAIIWGLTFALVPVGWSTWSTRSLADQAEKAGSIQVAVIQLANTCGAA
R9VMN2_9ENTR          ILWGSDKVVAAGIAIIWGLGFALIPVGWSTWITRTLADQAEKAGSIQVAVIQLANTCGAA
L0M091_ENTBF          IFWGSSPVVASAVAIIWGFAFAMVPVGWSTWITRSLSDQAEKAGSIQVAVIQFANTCGAA
                       . * .  :*: :**:**: **::******* **:*:********:******:*******

A0A0F0PMK2_KLEAE      VGGVALDHLGLLSPLVLSGILMLFTGLLVTTKVKVN---
A6TFW4_KLEP7          VGGIALDHLGLLSPLVLSGILMLFTGLLVAAKVKVNSPA
A4W4U2_ENT38          VGGYALDNLGLTSPLVLSGTLMLLTALLVAGKVKAK---
A0A198GXZ9_9ENTR      VGGIALDHIGLTSPLVISGTLMLLTALLVAGKVKAK---
NEPI_SALPA            VGGYALDNFGLLSPLALSGGLMLLTALVVAAKVRITPMS
V1GZX2_SALER          VGGYALDNFGLLSPLVLSGSLMLLTALLVTMKVRIQ---
D2TI30_CITRI          VGGYALDNLGLLSPLMLSGSLMLLTALLVAAKVRIKGMQ
NEPI_ECOK1            IGGYALDNIGLTSPLMLSGTLMLLTALLVTAKVKMKKS-
NEPI_ECO27            IGGYALDNIGLTSPLMLSGTLMLLTALLVTAKVKMKKS-
NEPI_ECOLI            IGGYALDNIGLTSPLMLSGTLMLLTALLVTAKVKMKKS-
NEPI_SHIBS            IGGYALDNIGLTSPLMLSGTLMLLTALLVTAKVKMKKS-
A0A028AGA4_ECOLX      IGGYALDNIGLTSPLMLSGTLMLLTALLVTAKVKMKKS-
NEPI_SHIDS            IGGYALDNIGLTSPLMLSGTLMLLTALLVTAKVKMK---
R9VMN2_9ENTR          IGGFALDHYGLLSPLVLSGSLMLLTALLVAAKVRVKA--
L0M091_ENTBF          LGGVALDHFGVLSPLAISACLMLLTATLVATKVKVS---
                      :** ***: *: *** :*. ***:*. :*: **: