CLUSTAL format seed alignment for MF_01191

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YJJB_ECOLI       MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGSIGHGSRMILMTSGLNIE
YJJB_ECO57       MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGSIGHGSRMILMTSGLNIE
YJJB_SHIDS       MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVQALRWCALLGSIGHGSRMILMTSGLNIE
YJJB_SHIF8       MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGSIGHGSRMILMTSGLNIE
YJJB_SHIFL       MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGSIGHGSRMILMTSGLNIE
YJJB_ECOL5       MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGAIGHGSRMILMTSGLNIE
YJJB_ECOUT       MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGAIGHGSRMILMTSGLNIE
YJJB_ECOL6       MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGAIGHGSRMILMTSGLNIE
YJJB_ECOK1       MGVIEFLLALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGAIGHGSRMILMTSGLNIE
YJJB_SHIBS       MGVIEFLFALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGAIGHGSRMILMTRGLNIE
YJJB_SHISS       MGVIEFLFALAQDMILAAIPAVGFAMVFNVPVRALRWCALLGAIGHGSRMILMTSGLNIE
YJJB_SALCH       MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE
YJJB_SALTY       MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE
YJJB_SALPA       MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGSRMLMMSAGFNIE
YJJB_SALTI       MGIIDFLLALMQDMILSAIPAVGFAMVFNVPHRALPWCALLGALGHGLRMLMMSAGFNIE
Y4078_YERPA      MG-VSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGSRMLMIHFGMNIE
Y485_YERPE       MG-VSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGSRMLMIHFGMNIE
Y358_YERPN       MG-VSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGSRMLMIHFGMNIE
Y627_YERPS       MG-VSLLWALLQDMVLAAIPALGFAMVFNVPVRALRYCALLGAIGHGSRMLMIHFGMNIE
Y625_YERE8       MV-MSLLWALLQDMVLAAIPALGFAMVFNVPMRALRYCALLGALGHGSRMLMIHFGMDIE
Y3865_PECAS      MG-LSLLWALLQDMVLAAVPALGFAMVFNVPLKVLPYCALLGGVGHGVRFLAIHFGMNIE
                 *  :.:* ** ***:*:*:**:********* :.* :*****.:*** *:: :  *::**

YJJB_ECOLI       WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP
YJJB_ECO57       WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP
YJJB_SHIDS       WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP
YJJB_SHIF8       WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISSVKISQLGYSEP
YJJB_SHIFL       WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISSVKISQLGYSEP
YJJB_ECOL5       WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP
YJJB_ECOUT       WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP
YJJB_ECOL6       WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP
YJJB_ECOK1       WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP
YJJB_SHIBS       WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP
YJJB_SHISS       WSTFMASMLVGTIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISQLGYSEP
YJJB_SALCH       WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP
YJJB_SALTY       WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP
YJJB_SALPA       WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP
YJJB_SALTI       WSTFMASLLVGSIGIQWSRWYLAHPKVFTVAAVIPMFPGISAYTAMISAVKISHLGYSEP
Y4078_YERPA      LASLVASIMIG---INWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEA
Y485_YERPE       LASLVASIMIG---INWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEA
Y358_YERPN       LASLVASIMIG---INWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEA
Y627_YERPS       LASLVASIMIGVIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEA
Y625_YERE8       PASLLASIMIGMIGINWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEV
Y3865_PECAS      WASFLAAILIGIIGIRWSRWLLAHPKVFTVAAVIPMFPGISAYTAMISVVEISHLGYSEA
                  ::::*::::*   *.**** *************************** *:**:***** 

YJJB_ECOLI       LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
YJJB_ECO57       LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
YJJB_SHIDS       LMITLLTNFLTASSIVGALSVDLSIPGLWLYRKRPRV
YJJB_SHIF8       LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
YJJB_SHIFL       LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
YJJB_ECOL5       LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
YJJB_ECOUT       LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
YJJB_ECOL6       LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
YJJB_ECOK1       LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
YJJB_SHIBS       LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
YJJB_SHISS       LMITLLTNFLTASSIVGALSIGLSIPGLWLYRKRPRV
YJJB_SALCH       MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
YJJB_SALTY       MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
YJJB_SALPA       MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
YJJB_SALTI       MMITLLTNFLKASSIVGALSIGLSVPGLWLYRKRPRV
Y4078_YERPA      LMSTMVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV
Y485_YERPE       LMSTMVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV
Y358_YERPN       LMSTMVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV
Y627_YERPS       LMSTMVTNFLKASFIVGALSIGLSLPGLWLYRKRPGV
Y625_YERE8       LMSTMVTNFLKASFIVGSLSIGLSLPGLWLYRKRPGV
Y3865_PECAS      LMSVMMTNFLKASFIVGALSIGLSLPGIWLYRKRPGV
                 :* .::****.** ***:**:.**:**:******* *