CLUSTAL format seed alignment for MF_01197

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

SEPF_CARHZ       ----MSGGFLDKVLNFMGFSEEEE-EEYVE------------------------------
SEPF2_DESRM      ----MSKAFLDKFLNFIGFEEVEDSEKAPE------------------------------
SEPF_MOOTA       ------MAFWQGLINWLGYGHEGEEPVMEK------------------------------
SEPF_ALKMQ       ----MSAKFIDKVKYFIG---LDAFEDDN-------------------------------
SEPF_ALKOO       ----MSGKIIDKVKVFMG---FDVFEDE--------------------------------
SEPF_CLOD6       ----MSNGIISKFKNWIVDEEEDYIEDEY-------------------------------
SEPF_HUNT2       -----MSTILNKVLNFVGWETEDEEEDVET------------------------------
SEPF_CALS4       ----MSSKVIDKIMSFLGIEEE--------------------------------------
SEPF_CLOAB       ----MASKVLNKVMGIIGLNDEDFDEYEDEV-----------------------------
SEPF_CLONN       ----MAKKMLNKVMDFLGL-EEEIDEIEE-------------------------------
SEPF_CLOBH       ----MSGKILDKMAGLLGLEDDLEEDLEE-------------------------------
SEPF_CLOBL       ----MSGKILDKMAGLLGLEDDLEEDLEE-------------------------------
SEPF_CLOPE       -----MSKVVSKMKSFLGF--DEFEDEDE-------------------------------
SEPF_CLOP1       -----MSKVVSKMKSFLGF--DEFEDEDE-------------------------------
SEPF_CLOPS       -----MSKVVSKMKSFLGF--DEFEDEDE-------------------------------
SEPF_CLOB8       -----MGNVISKVKSLLGF--EDYEEYDE-------------------------------
SEPF_CLOTE       ----MAGKVLNKVMGFLGL--EDEYEYEE-------------------------------
SEPF1_DESRM      ----MAMGMFDKILGFIGFDETE-EQQVD-------------------------------
SEPF_PELTS       ----MAFKLVDKVLSFMGFEEEVVEEEEK-------------------------------
SEPF_DESHY       ---MTMAKLFDKVIGIMGFADDDYEDDYF-------------------------------
SEPF_SYMTH       --MPNKPGLWSRLVDYLGFGPEEDEFEDG-------------------------------
SEPF_NOSS1       -----MNNIFSKLRDFVGLNEQVEYEYYEEE-----------------------------
SEPF_TRIV2       -----MNNIFSKLRDFVGLNEQVEYEYYEEE-----------------------------
SEPF_TRIEI       -----MNNLLSKFKDFVGLNEPVEYEYDYDE-----------------------------
SEPF_SYNY3       -------MILTKLKDFVGISEHDEYEEDYDE-----------------------------
SEPF_PROM1       ------MSLISRLRAVVAGDDFLDSDF---------------------------------
SEPF_PROMT       ------MSLISRLRAVVAGDDFLDSDF---------------------------------
SEPF_PROMA       ------MSLISRLRAVVAGDDYLDGDF---------------------------------
SEPF_PROM3       ------MSLISRLRAVVAGDDYLDSDY---------------------------------
SEPF_PROMM       ------MSLISRLRAVVAGDDYLDSDY---------------------------------
SEPF_SYNSC       ------MSLISRLRAVVAGDDYLDGEL---------------------------------
SEPF_SYNS9       ------MSLISRLRAVVAGDDYLDGEL---------------------------------
SEPF_SYNPX       ------MSLISRLRAVVAGDDYLDGDL---------------------------------
SEPF_SYNPW       ------MSLISRLRAVVAGDDYLDGDY---------------------------------
SEPF_PROMS       ------MSLISRLKAVVAGDEYLDDDF---------------------------------
SEPF_PROM0       ------MSLISRLKAVVAGDEYLEDDF---------------------------------
SEPF_PROM2       ------MSLISRLKAVVAGDEYLDDDF---------------------------------
SEPF_PROM9       ------MSLISRLKAVVAGDEYLDDDF---------------------------------
SEPF_PROM5       ------MSLISRLKAVVAGDDYLDDDF---------------------------------
SEPF_PROMP       ------MSLISRLKAVVAGDDFLDDDF---------------------------------
SEPF_SYNR3       ------MSIFSRLKKVVAGDDYLDDDYG--------------------------------
SEPF_SYNP6       ------MSFVNRIRDIVGLNESLDYDE---------------------------------
SEPF_SYNE7       ------MSFVNRIRDIVGLNESLDYDE---------------------------------
SEPF_THEEB       -----MLGKLRDLMGLTPETDIYDEEYPQGT-----------------------------
SEPF_SYNJB       MEGQDDYQLLYEGRRSQPAAPPEEEEV---------------------------------
SEPF_SYNJA       MEGQEDYQLLYEGRRSQPAP--EEQEA---------------------------------
SEPF_GLOVI       -----MSSFWSKVKDFVGFGDPLEYEEDGEE-----------------------------
SEPF_SYNWW       ------MGVMDGLWRWLGVE----------------------------------------
SEPF_BACVZ       ------MSMKNKLKNFFSMDE---------------------------------------
SEPF_BACSU       ------MSMKNKLKNFFSMED---------------------------------------
SEPF_BACLD       ------MSLKNKFKNFFSLDD---------------------------------------
SEPF_BACP2       ------MSIKNKFKSFFTLDD---------------------------------------
SEPF_GEOKA       ------MGLMKKFRDYFLEEDY--------------------------------------
SEPF_GEOTN       ------MGLMKKFRDYFLEEDY--------------------------------------
SEPF_BACSK       ------MGFKTKFKRYFNLDDHV-------------------------------------
SEPF_BACHD       ------MGMKSKFKRFFELDD---------------------------------------
SEPF_LISIN       ------MGLSNKFKSFFFLDEE--------------------------------------
SEPF_LISW6       ------MGLSNKFKSFFFLDEE--------------------------------------
SEPF_LISMO       ------MGLSNKFKSFFFLDEE--------------------------------------
SEPF_LISMF       ------MGLSNKFKSFFFLDEE--------------------------------------
SEPF_OCEIH       ------MSFKNKLKDYFMGDEY--------------------------------------
SEPF_BACAH       ------MSWSKVKYFFFDTPEE--------------------------------------
SEPF_BACHK       ------MSWSKVKYFFFDTPEE--------------------------------------
SEPF_BACCZ       ------MSWSKVKYFFFDTPEE--------------------------------------
SEPF_BACAN       ------MSWSKVKYFFFDTPEE--------------------------------------
SEPF_BACC1       ------MSWSKVKYFFFDTPEE--------------------------------------
SEPF_BACCR       ------MSWSKVKYFFFDTPEE--------------------------------------
SEPF_BACCN       ------MSWSKVKYFFFDTPEE--------------------------------------
SEPF_STAAU       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAAB       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAAC       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAA2       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAA9       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAAS       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAA1       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAAM       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAAW       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAAN       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAA8       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAAE       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAAT       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAA3       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAAR       ---MSHLALKDLFSGFFVIDDEE-EVEVP---DKQQ------QVNEAPAKEQSQQ-----
SEPF_STAEQ       ------MALKDLFNNFFVVEEEE-EVEGP---EERESSRSRERVQEREDYNRNENQATPQ
SEPF_STAHJ       ------MAIKDLFNNFFLMDDEE-EVESP---EERQRRVVQNEENETNNVQQNQPQQSER
SEPF_STAS1       ------MALKDLFSGFFVVEEEDDELEAPPEENEQQ------ERQQPKQQAQSQNQFTEQ
SEPF_LACAC       -------MAFDKLGRFFGISNDD-------------------------------------
SEPF_LACH4       -------MAFDKLGRFFGISNDD-------------------------------------
SEPF_LACGA       -------MAFDKLGRFFGIAEDD-------------------------------------
SEPF_LACJO       -------MAFDKLGRFFGISEDD-------------------------------------
SEPF_LACDA       --------MNNKFKDFFGFGDND-------------------------------------
SEPF_LACDB       --------MNNKFKDFFGFGDND-------------------------------------
SEPF_LACBA       ------MAEKFSLSKFFGMNDEY-------------------------------------
SEPF_LACSS       ------MAGKFSFSNFFGMTE---------------------------------------
SEPF_LACP3       --MAFEKLGEK-FSNFFAMDNE--------------------------------------
SEPF_LACPL       -------MAGF-ISNFFGVGDS--------------------------------------
SEPF_LACRD       ------MAANF-LKSLFGEEDI--------------------------------------
SEPF_ENTFA       ----MSIFNKDALSSFFGLSGEE-------------------------------------
SEPF_LEUMM       ------MALGDTIKRLFS--NEE-------------------------------------
SEPF_OENOB       --------MAFSFKSFFGGADDE-------------------------------------
SEPF_LACS1       ------MSLSEKLSNWFNGVPEE-------------------------------------
SEPF2_STRAW      -----MAGAMRKMAVYLGLVEDDG---------YDGRGFDPDDDF---------------
SEPF2_STRCO      -----MAGAMRKMAVYLGLVEDDG---------YDGRGFDPDDDF---------------
SEPF_THEFY       -----MAGALRKMAVYLGLVEDDR---------YDHRYADEYDDF---------------
SEPF_ACIC1       ------MAFMRKAAVYLGLVEDDE---------ERYEDYDDYDDA---------------
SEPF_NOCSJ       -----MSGAMRRIGEYLGLLEDTG------------RYDDEYGDY---------------
SEPF_CUTAK       -----MAGIGRKIASYVGIVDDRR---------YDEEDLPDEELT---------------
SEPF_FRAAA       ------MGLGRRAMVYLGLAEEDE---------D-YLDDDDYDDG---------------
SEPF_FRACC       ------MGLGRRAMVYLGLAEEDE---------D-YLDDD-YDDG---------------
SEPF_SALAI       ------MGALRKAGVWLGLVEEDD---------ERAYDDAGYDKGGYRESRYRSSRYS--
SEPF3_STRAW      ------MGSVRKASAWLGLVDDN----------DDERYYDDDYAE---------------
SEPF1_STRCO      ------MGSVRKASAWLGLVDDNN---------DDERYYDDDYSE---------------
SEPF_PAEAT       -----MAGALRKTMIYLGLADGDE---------HYESEQSVATHH---------------
SEPF_ARTS2       -----MAGALRKTMIYLGLADGDE---------HYESEH-HTPHK---------------
SEPF_RENSM       -----MAGALRKTMIYLGLADGDE---------HYEPQP---------------------
SEPF_KINRD       -----MAGALRNAMVYLGLAEDDR---------YAEDTEPETTRP---------------
SEPF_MYCA1       ------MSTLHKVKAYFGMAPMDD---------YEDEYYD--DR----------------
SEPF_MYCPA       ------MSTLHKVKAYFGMAPMDD---------YEDEYYD--DR----------------
SEPF_MYCTU       ------MSTLHKVKAYFGMAPMED---------YDDEYYD--DR----------------
SEPF_MYCTA       ------MSTLHKVKAYFGMAPMED---------YDDEYYD--DR----------------
SEPF_MYCBO       ------MSTLHKVKAYFGMAPMED---------YDDEYYD--DR----------------
SEPF_MYCBP       ------MSTLHKVKAYFGMAPMED---------YDDEYYD--DR----------------
SEPF_MYCUA       ------MSTLHKVKAYFGMAPMED---------YDDEYYD--DR----------------
SEPF_MYCLE       ------MSTLHKVKAYFGMAPMED---------YDDEYYD--DR----------------
SEPF_MYCGI       ------MSTLHKVKAYFGMAPMDE---------YEDDYYEDDDR----------------
SEPF_MYCVP       ------MSTLHKVKAYFGMAPMDD---------YEDDYYEDDDR----------------
SEPF_MYCS2       ------MSTLHKVKAYFGMAPMDD---------YEDEYYEDDDR----------------
SEPF_MYCSJ       ------MSTLHKVKAYFGMAPMDD---------YDDEYYEDDDRA---------------
SEPF_MYCSK       ------MSTLHKVKAYFGMAPMDD---------YDDEYYEDDDRA---------------
SEPF_MYCSS       ------MSTLHKVKAYFGMAPMDD---------YDDEYYEDDDRA---------------
SEPF_NOCFA       ------MSTLHKFKAYFGMVPLED---------YEDDYVD--DRA---------------
SEPF_RHOJR       ------MSSLHKFKAYFGMVPLDD---------YEDEYLD--EPE---------------
SEPF_SACEN       ------MSALHKLKAYFGMVPADE---------IDEVYDDEVAYR---------------
SEPF_CLAM3       -----MANPLRKTMVYLGLADEEL---------DYQQGQ---QPA---------------
SEPF_CLAMS       -----MANPLRKTMVYLGLADEEL---------DYQQGQ---QPA---------------
SEPF_LEIXX       -----MANPLKKTMVYLGLADEEL---------EFEEEQTQHQPR---------------
SEPF_TROW8       -----MAGGLKKAMVYLGLAEDNQ---------ELHSAP---------------------
SEPF_TROWT       -----MAGGLKKAMVYLGLAEDNQ---------ELHSAP---------------------
SEPF_BIFAA       -----MAGFMKNAMSYLGMSDVAE---------GEDDF----EDDVD-------------
SEPF_BIFLO       -----MAGFMKNAMSYLGMSDVVD---------DEDDYIEEDEEQKP-------------
SEPF1_STRAW      ------MRGG-PVNSHDVTDEQWE---------GLAQVVPLRGRD---------------
SEPF3_STRCO      ------MKSGEPVNSHDVTDEQWE---------GLAQVVPLRGRD---------------
SEPF_LACLM       ---MAFKDWMNNLRDYFVEDDEE-------FNEPTRPVQESRPTVASTP-----------
SEPF_LACLS       ---MAFKDWMNNLRDYFVEDDEE-------FNEPTRPVQESRPTVASTP-----------
SEPF_LACLA       ---MAFKDWMNNLRDYFVEDDEE-------FNEPARPVQESRPTVASTP-----------
SEPF_STRA1       ---MALKDRFDKIISYFDTDDVS---------ENEVHEVQERTSVQRDSR----------
SEPF_STRA5       ---MALKDRFDKIISYFDTDDVS---------ENEVHEVQERTSVQRDSR----------
SEPF_STRA3       ---MALKDRFDKIISYFDTDDVS---------ENEVHEVQERTSVQRDSR----------
SEPF_STRP1       ---MAFKDTFNKMISYFDTDEVN---------EVEEDVAASTDNVIPRSQQSVRASSHPK
SEPF_STRPG       ---MAFKDTFNKMISYFDTDEVN---------EVEEDVAASTDNVIPRSQQSVRASSHPK
SEPF_STRP6       ---MAFKDTFNKMISYFDTDEVN---------EVEEDVAASTDNVIPRSQQSVRASSHPK
SEPF_STRPD       ---MAFKDTFNKMISYFDTDEVN---------EVEEDVAASTDNVIPRSQQSVRASSHPK
SEPF_STRPB       ---MAFKDTFNKMISYFDTDEVN---------EVEEDVAASTDNVIPRSQQSVRASSHPK
SEPF_STRPC       ---MAFKDTFNKMISYFDTDEVN---------EVEEDVAASTDNVIPRSQQSVRASSHPK
SEPF_STRP3       ---MAFKDTFNKMISYFDTDEVN---------EVEEDVAASTDNVIPRSQQSVRASSHPK
SEPF_STRP8       ---MAFKDTFNKMISYFDTDEVN---------EVEEDVAASTDNVIPRSQQSVRASSHPK
SEPF_STRPM       ---MAFKDTFNKMISYFDTDEVN---------EVEEDVAASTDNVIPRSQQSVRASSHPK
SEPF_STRPF       ---MAFKDTFNKMISYFDTDEVN---------EVEEDVTASTDNVIPRSQQSVRASSHPK
SEPF_STRMU       ---MALRDSFNKIISYFDTDEVS---------EVEEPAVASVKR----------------
SEPF_STRT2       ---MAIKDAIEKIVSYFDADEVT---------DHEDVAKERPVKV---------------
SEPF_STRT1       ---MAIKDAIEKIVSYFDADEVT---------DHEDVAKERPVKV---------------
SEPF_STRTD       ---MAIKDAIEKIVSYFDADEVT---------DHEDVAKERPVKV---------------
SEPF_STRR6       ---MSLKDRFDRFIDYFTEDED-----------SSLPYEKR-------------------
SEPF_STRP2       ---MSLKDRFDRFIDYFTEDED-----------SSLPYEKR-------------------
SEPF_STRPN       ---MSLKDRFDRFIDYFTEDED-----------SSLPYEKR-------------------
SEPF_STRSV       ---MSLKDRFDKFIDYFTEDGDETEVQEQTVSRPAAPVKQKPELVQPKPV----------
SEPF_STRGC       ---MSLKDRFDKFIEYFTEDGDD-------VQVAESRVQQQAVKPS--------------
SEPF_STRSY       ---MALKDTFKNLFNYFEVDEV-----------NEVEEQADAYSMP--------------
SEPF_STRS2       ---MALKDTFKNLFNYFEVDEV-----------NEVEEQADAYSMP--------------
SEPF_RUBXD       ---MGVREQLERVAAYFGFGVDDDYYEDEEE-----------------------------
SEPF_CALS8       ----MFDNLQRKFLNLIGIEIEEE------------------------------------
SEPF_LACP7       -----MANLFKNILDSLKLTDDEDLDDYDDYVSELEEKERRKTER---------------
                                                                             

SEPF_CARHZ       -----------------KEPAKKVRGK---------------------------------
SEPF2_DESRM      -----------------LSSSRETKTKNQNQSKSLL------------------------
SEPF_MOOTA       -----------------PVLEAETTPVTPA------------------------------
SEPF_ALKMQ       ------------EDMLEEADGMDDEMIPISSTSKK-------------------------
SEPF_ALKOO       ------------EVEEEETVEIEDELVPVMNS-KR-------------------------
SEPF_CLOD6       ------------ESGMDDIVQ-EEEMNSGFSTAKA-------------------------
SEPF_HUNT2       --------VEESEDVEEEESKKPQFIQPLSSRRTQ-------------------------
SEPF_CALS4       ----------------EEEIQTP---QPVVSYDRR-------------------------
SEPF_CLOAB       ------MEEKAIAR--ENSYDYDEKLNDKNSSNSN-------------------------
SEPF_CLONN       ------MDNEAIVE--GN-EEIDNIFDSSNVRNQK-------------------------
SEPF_CLOBH       -----------VEE--ETAEEEVTPLISSNTK-RN-------------------------
SEPF_CLOBL       -----------VEE--ETAEEEVTPLISSNTK-RN-------------------------
SEPF_CLOPE       ----------VMEE--EEVMEEEESFAPVLSSKKN-------------------------
SEPF_CLOP1       ----------VMEE--EEVMEEEESFAPVLSSKKN-------------------------
SEPF_CLOPS       ----------VMEE--EEVMEEEESFAPVLSSKKN-------------------------
SEPF_CLOB8       ----------YEEEQYEEQVKDEDEIEPVITNKKN-------------------------
SEPF_CLOTE       --------YYEDTDELENSNESAEFEPIIHSNKKQ-------------------------
SEPF1_DESRM      -------------RERE--AVEKTETLQQIKRKN--------------------------
SEPF_PELTS       -------------RARD--EIVEEQPWQRKKEKDR-------------------------
SEPF_DESHY       -------------EEEEEKEEVREETRGTGNRKG--------------------------
SEPF_SYMTH       -------------ELEQVQPAYQEEPPRRSAPERR-------------------------
SEPF_NOSS1       ------ADTDNYQNLYQQENPQPAPAEAAP-NNRRWREPMTTMGDDVAA-----------
SEPF_TRIV2       ------ADTDNYQNLYQQENPQPAPAEAAP-NNRRWREPMTTMGDDVAT-----------
SEPF_TRIEI       ------MEGEQYVYPQQQQTPAAVPTQEESRSNRRLRNRASATTATTASTTGINGVV---
SEPF_SYNY3       ------E------MEFPQSVASQPPAEEVAPPPRISREPLSLNNETSIG-----------
SEPF_PROM1       ---------DELEYDSSDDFENFNRGNKEGSTEMATISQANPFDGRSGF-----------
SEPF_PROMT       ---------DELDYETSDDFENFNRGKKEGSTEMATISQANPFDGRSGF-----------
SEPF_PROMA       ---------DELDYETGDDFDTGNDGGGNYSSGLAALSNANPFNNRGGS-----------
SEPF_PROM3       ---------DDLDYDTDDHMDADHRSDHASGGALATPSDSSPFDLGGGF-----------
SEPF_PROMM       ---------DDLDYDTDDHMDADHRSDHASGGALATPSDSSPFDLGGGF-----------
SEPF_SYNSC       ---------DDFAYD-DEQDDQDQRALQADGGALATIGDSNPFDLGGDL-----------
SEPF_SYNS9       ---------DDFAYE-DEQQDQDQRATQADGGALATLGDSNPFDLGGDL-----------
SEPF_SYNPX       ---------DDLVYD-DDQPEQDQRASQADGGALATIGDGNPFDLGDNF-----------
SEPF_SYNPW       ---------DDLDYDAGEHDDSPQ-AMASASSALAPLDAANPFDMDQGF-----------
SEPF_PROMS       ---------DELDYPSEDELNDINNFKQNP-KNSNALANSNPFDFMNNN-----------
SEPF_PROM0       ---------DELDYASEDELNDINNFKQNP-KNANALANSNPFDFMNNN-----------
SEPF_PROM2       ---------DELDYASEDELNDIDNFKNSP-RNKNALANANPFDFMNNN-----------
SEPF_PROM9       ---------DELDYATEDELNDINDFKQTQ-RNSNALANSNPFDFMNNN-----------
SEPF_PROM5       ---------DELDYASEDELNGVNDYKENR-KNSNALSNSNPFDFMNNN-----------
SEPF_PROMP       ---------DELDYASEDEFNGNDDLKQNY-KKSNALSNSNPFEFMNNN-----------
SEPF_SYNR3       ---------TELEYEDGLEPSDSTLDRGGAIAPIGSFDDGDPFA----------------
SEPF_SYNP6       ---------EYETYDVAADSYNGYNDAAETSSRRRQRNHTPTASIEPVS-----------
SEPF_SYNE7       ---------EYETYDVAADSYNGYNDAAETSSRRRQRNHTPTASIEPVS-----------
SEPF_THEEB       ------A--RTLTTEPGVEPLPASPPTPTHDFDTRPSPSVATGSVPTGS-----------
SEPF_SYNJB       ---------STLPRGRRQRGVEAGEGSAGREESRGHRRSQHRDRSAGGS-----------
SEPF_SYNJA       ---------SALPRGRRQRGVEAGEGSVGREEARGHRRSQHRDRLGGGS-----------
SEPF_GLOVI       ------YEQVYREENKREEARRATAGTAAAATPTAAAQASDAAPMGSGP-----------
SEPF_SYNWW       -----------------REEVREEIIELPAYSEENQRGP---------------------
SEPF_BACVZ       -------EEYEYEYIETEQD-HPEEHEQQKDKQPAYAQ----------------------
SEPF_BACSU       -------EEYEYEYIETERE-SHEEHEQ-KEKPAYNGN----------------------
SEPF_BACLD       -------EEYEYEYIETDREEIPEEHES-KDRTAYQS-----------------------
SEPF_BACP2       -------EEYEYEYIDEEREPVQEEKGT-KDKAAFQER----------------------
SEPF_GEOKA       -------EDYEEEYEAPQPE------------EEALP-----------------------
SEPF_GEOTN       -------EDYEEEYEAPQQE------------EEALPL----------------------
SEPF_BACSK       ------EEVERYVEEPEQRDERPALEK-GRAPKEKQTA----------------------
SEPF_BACHD       -------DASMYEEDAVSRDFVEEVEEPRRRSRTGVKQ----------------------
SEPF_LISIN       -------EEYYEEEVAREPEPMQKKTKKEKPSKNRFYA----------------------
SEPF_LISW6       -------EEYYEEEVAREPEPMQKKTKKEKPSKNRFYA----------------------
SEPF_LISMO       -------EEYYEEEVAREPEPMQKKTKKEKPNKNRFYA----------------------
SEPF_LISMF       -------EEYYEEEVAREPEPMQKKTKKEKPNKNRFYA----------------------
SEPF_OCEIH       --------EYEYVDEDNQSE------------EPTQKE----------------------
SEPF_BACAH       ------KEAAQYSYEKEQTDMKKQQDPP--EQQDVTFP----------------------
SEPF_BACHK       ------KEAAQYSYEKEQTDMKKQQDPP--EQQDVTFP----------------------
SEPF_BACCZ       ------KEAAQYSYEKEQTDMKKQQDPP--EQQDVTFP----------------------
SEPF_BACAN       ------KEAAQYSYEKEQTDMKKQQDPP--EQQDVTFP----------------------
SEPF_BACC1       ------KEAAQYSYEKEQTDMKKQQDPP--EQQDVTFP----------------------
SEPF_BACCR       ------KEAAQYGYEKEQTDMKKQQDPP--EQQDVTFP----------------------
SEPF_BACCN       ------KEAAQYAYEKEQIEMKKQQEPP--EQQDVPFT----------------------
SEPF_STAAU       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAAB       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAAC       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAA2       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAA9       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAAS       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAA1       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAAM       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAAW       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAAN       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAA8       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAAE       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAAT       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAA3       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAAR       -----TTKQNAIKSVPQKSASRYTTTSEERNNRMSNY-----------------------
SEPF_STAEQ       TF---NNKQQAIKSVPQKNTLRSNTTSEERNYRMNNN-----------------------
SEPF_STAHJ       S----YSNQSKLKTVPQKKTTRNYNS-EERNVRMNQPP----------------------
SEPF_STAS1       PRNVNSERPRSIQSVPKKQSTRLQQSSGERKYQMNNTT----------------------
SEPF_LACAC       --------ELANDEEYTTQNEENNE-DLPLNSIN--------------------------
SEPF_LACH4       --------DELEKEEYTTSNKDENE-NLPLNSVS--------------------------
SEPF_LACGA       --------E-MNEAPYTEA-EQQEE-EVPQAQKNE-------------------------
SEPF_LACJO       --------E-MNEVPYTES-EEQQE-EIPQTQKNE-------------------------
SEPF_LACDA       --------SYEERDAYEEHYDEQEEMQNSNRPTNS-------------------------
SEPF_LACDB       --------SYEERDAYEEHYDEQEEMQNSNRPTNS-------------------------
SEPF_LACBA       --------DDDYAE---EPTPATKSTPTPPT-RPN-------------------------
SEPF_LACSS       --------DEDYST---DLQGTKTTDEVSPTSRPD-------------------------
SEPF_LACP3       --------DDYQDQ---EDEQAQQPAPEQPVDNHY-------------------------
SEPF_LACPL       --------DSQYEE---PTEASQAAAPTESATNTR-------------------------
SEPF_LACRD       --------DEQDGL---YETSEQVSTPAN-------------------------------
SEPF_ENTFA       --------DDYYDNYEEYEERKAVNEPPRRAARPKPQRPVQQQESYSQPAYTQQSEPVVE
SEPF_LEUMM       --------DDYYEEDGYEQSQQQEQQ----TTQQTSS-----------------------
SEPF_OENOB       --------EEEYEDSGYEQQPNQGQQQPVNSQQQNTSNQSYSGYNN--------------
SEPF_LACS1       --------EYYEEVTDSKQAVSTNTDVTRASEPEKDN-----------------------
SEPF2_STRAW      -----------EPELDPEPERDRRRHE------PPHQSHQA-------------------
SEPF2_STRCO      -----------EPELDPEPERDHRRHE------PAHQSHGA-------------------
SEPF_THEFY       -----------EDFDEPLDERPSRNRS------PRDDSRNN-------------------
SEPF_ACIC1       -----------EPHRREPREAVERDLG------SRRTAVVR-------------------
SEPF_NOCSJ       -----------AGDYETQETAPVATRS------SKRESRPA-------------------
SEPF_CUTAK       -----------TEVYSDDGYEPSSEVT------QLHHHDSN-------------------
SEPF_FRAAA       -------RAVGHDDRRAMHEPVPMDRT-----VRRIDAR---------------------
SEPF_FRACC       -------RAVGRDDRRAMHEPVPMDRT-----VRRIDAR---------------------
SEPF_SALAI       -------EDFGDEDDEDEEAAVPRSRRGDRSRLERAAARSGDVDHNVEG-----------
SEPF3_STRAW      -----------GQESGEAWVTDPRVKV---------------------------------
SEPF1_STRCO      -----------GPESGDAWVTDPRVKV---------------------------------
SEPF_PAEAT       -----------DEERPQAQEREERR--------APAPVREV-------------------
SEPF_ARTS2       -----------DEDDSMEHDREERR--------APAPVREI-------------------
SEPF_RENSM       -----------EGKQTRPAQKNEEY--------VDQEIRHT-------------------
SEPF_KINRD       -----------RVEAAREVRVESRHE-------ARPEVRHE-------------------
SEPF_MYCA1       -------------APSRGFPRPRFDDG-----YGRYDGDDYD------------------
SEPF_MYCPA       -------------APSRGFPRPRFDDG-----YGRYDGDDYD------------------
SEPF_MYCTU       -------------APSRGYARPRFDDD-----YGRYDGRDYDDARSDS------------
SEPF_MYCTA       -------------APSRGYARPRFDDD-----YGRYDGRDYDDARSDS------------
SEPF_MYCBO       -------------APSRGYARPRFDDD-----YGRYDGRDYDDARSDS------------
SEPF_MYCBP       -------------APSRGYARPRFDDD-----YGRYDGRDYDDARSDS------------
SEPF_MYCUA       -------------GPSRGYSRPRFEDD-----YGRYEGRDFEDPRRDPRA----------
SEPF_MYCLE       -------------SPTHGYGRSRFEEG-----YGRYEGRDY-------------------
SEPF_MYCGI       ------------GPAPRGYRR-PRED--------RFEDEGYAPR-GYDG-----------
SEPF_MYCVP       ------------VPA-RGYRR-PRED--------RFEDEAY-PR-GYD------------
SEPF_MYCS2       ------------GARAGGYSRRPRED--------RFEEEAY----GYE------------
SEPF_MYCSJ       -----------ERGAARGYARRPRED--------RFEEEGYIDRAGREY-----------
SEPF_MYCSK       -----------ERGAARGYARRPRED--------RFEEEGYIDRAGREY-----------
SEPF_MYCSS       -----------ERGAARGYARRPRED--------RFEEEGYIDRAGREY-----------
SEPF_NOCFA       -----------PRASERGGARGPRPYSE----RAGYGADRYGEDRYSADRFGPERFGAER
SEPF_RHOJR       -----------P---ARRPARPAR----------DSGRDPYLDR----------------
SEPF_SACEN       -----------DRYADPDTSYDAPSD--------RVGGRRRVAG----------------
SEPF_CLAM3       ----------QQQQSPVQAVPTPAPAPQQQ------------------------------
SEPF_CLAMS       ----------QQQQSPVQAVPTPVPAPQQQ------------------------------
SEPF_LEIXX       ----------REAAAPASVQPVPHPAAVAPV-----------------------------
SEPF_TROW8       -------------SGMSHLRRVPHPK----------------------------------
SEPF_TROWT       -------------SGMSHLRRVPHPK----------------------------------
SEPF_BIFAA       ---------TGETSFDSDHSVTPMPSS---------------------------------
SEPF_BIFLO       ---------ASKSAFDSDHTVTPLAST---------------------------------
SEPF1_STRAW      -----------AWPSAVGHRSIPEAQTE--------------------------------
SEPF3_STRCO      -----------AWPSAVGHRAMPEAETE--------------------------------
SEPF_LACLM       ----------KPKVEERKVQADYQSRRP--------------------------------
SEPF_LACLS       ----------KPKVEERKVQADYQSRRP--------------------------------
SEPF_LACLA       ----------KPKVEERKAQPEYQTRRP--------------------------------
SEPF_STRA1       -----AATAQEASQRSHMTNSAEEEMIG--------------------------------
SEPF_STRA5       -----AATAQEASQRSHMTNSAEEEMIG--------------------------------
SEPF_STRA3       -----AATAQEASQRSHMTNSAEEEMIG--------------------------------
SEPF_STRP1       QEPRNNHVQQDHQARSQEQTRSQMHPKH--------------------------------
SEPF_STRPG       QEPRNNHVQQDHQARSQEQTRSQMHPKH--------------------------------
SEPF_STRP6       QEPRNNHVQQDHQARSQEQTRSQMHPKH--------------------------------
SEPF_STRPD       QEPRNNHVQQDHQARSQEQTRSQMHPKH--------------------------------
SEPF_STRPB       QEPRNNHVQQDHQARSQEQTRSQMHPKH--------------------------------
SEPF_STRPC       QEPRNNHVQQDHQARSQEQTRSQMHPKH--------------------------------
SEPF_STRP3       QEPRNNHVQQDHQARSQEQTRSQMHPKH--------------------------------
SEPF_STRP8       QEPRNNHVQQDHQARSQEQTRSQMHPKH--------------------------------
SEPF_STRPM       QEPRNNHVQQDHQARSQEQTRSQMHPKH--------------------------------
SEPF_STRPF       QEPRNNHVQQDHQARSQEQTRSQMHPKH--------------------------------
SEPF_STRMU       --------QQDAAQPASQQQKAQSHQYH--------------------------------
SEPF_STRT2       --------QKTEQTPSQQQRKPERPQET--------------------------------
SEPF_STRT1       --------QKTEQTPSQQQRKPERPQET--------------------------------
SEPF_STRTD       --------QKTEQTPPQQQRKPERPQET--------------------------------
SEPF_STRR6       -----------DEPVFT-PVNSSQEPAL--------------------------------
SEPF_STRP2       -----------DEPVFT-PVNSSQEPAL--------------------------------
SEPF_STRPN       -----------DEPVFT-SVNSSQEPAL--------------------------------
SEPF_STRSV       ---------RESKPAPR-PAAAAKPQPK--------------------------------
SEPF_STRGC       ----------NSRPAQQEPVRDIKQPRL--------------------------------
SEPF_STRSY       ----------NDRPKMRVANTTVAPVRE--------------------------------
SEPF_STRS2       ----------NDRPKMRVANTTVAPVRE--------------------------------
SEPF_RUBXD       -----EERYAKGSYGNGGRTGEPSPAVRRLGRSERSSAFGTSLGDLFGS-----------
SEPF_CALS8       ---------DKPQESTKAKEENVKPKHE--------------------------------
SEPF_LACP7       --------QEQRQAVKQEKRTFPSQRPAFSEEAPTSSSSKLSAASGSSD-----------
                                                                             

SEPF_CARHZ       ------------------------------------------------------------
SEPF2_DESRM      ------------------------------------------------------------
SEPF_MOOTA       ------------------------------------------------------------
SEPF_ALKMQ       ------------------------------------------------------------
SEPF_ALKOO       ------------------------------------------------------------
SEPF_CLOD6       ------------------------------------------------------------
SEPF_HUNT2       ------------------------------------------------------------
SEPF_CALS4       ------------------------------------------------------------
SEPF_CLOAB       ------------------------------------------------------------
SEPF_CLONN       ------------------------------------------------------------
SEPF_CLOBH       ------------------------------------------------------------
SEPF_CLOBL       ------------------------------------------------------------
SEPF_CLOPE       ------------------------------------------------------------
SEPF_CLOP1       ------------------------------------------------------------
SEPF_CLOPS       ------------------------------------------------------------
SEPF_CLOB8       ------------------------------------------------------------
SEPF_CLOTE       ------------------------------------------------------------
SEPF1_DESRM      ------------------------------------------------------------
SEPF_PELTS       ------------------------------------------------------------
SEPF_DESHY       ------------------------------------------------------------
SEPF_SYMTH       ------------------------------------------------------------
SEPF_NOSS1       ------------------------------------------------------------
SEPF_TRIV2       ------------------------------------------------------------
SEPF_TRIEI       ------------------------------------------------------------
SEPF_SYNY3       ------------------------------------------------------------
SEPF_PROM1       ------------------------------------------------------------
SEPF_PROMT       ------------------------------------------------------------
SEPF_PROMA       ------------------------------------------------------------
SEPF_PROM3       ------------------------------------------------------------
SEPF_PROMM       ------------------------------------------------------------
SEPF_SYNSC       ------------------------------------------------------------
SEPF_SYNS9       ------------------------------------------------------------
SEPF_SYNPX       ------------------------------------------------------------
SEPF_SYNPW       ------------------------------------------------------------
SEPF_PROMS       ------------------------------------------------------------
SEPF_PROM0       ------------------------------------------------------------
SEPF_PROM2       ------------------------------------------------------------
SEPF_PROM9       ------------------------------------------------------------
SEPF_PROM5       ------------------------------------------------------------
SEPF_PROMP       ------------------------------------------------------------
SEPF_SYNR3       ------------------------------------------------------------
SEPF_SYNP6       ------------------------------------------------------------
SEPF_SYNE7       ------------------------------------------------------------
SEPF_THEEB       ------------------------------------------------------------
SEPF_SYNJB       ------------------------------------------------------------
SEPF_SYNJA       ------------------------------------------------------------
SEPF_GLOVI       ------------------------------------------------------------
SEPF_SYNWW       ------------------------------------------------------------
SEPF_BACVZ       ------------------------------------------------------------
SEPF_BACSU       ------------------------------------------------------------
SEPF_BACLD       ------------------------------------------------------------
SEPF_BACP2       ------------------------------------------------------------
SEPF_GEOKA       ------------------------------------------------------------
SEPF_GEOTN       ------------------------------------------------------------
SEPF_BACSK       ------------------------------------------------------------
SEPF_BACHD       ------------------------------------------------------------
SEPF_LISIN       ------------------------------------------------------------
SEPF_LISW6       ------------------------------------------------------------
SEPF_LISMO       ------------------------------------------------------------
SEPF_LISMF       ------------------------------------------------------------
SEPF_OCEIH       ------------------------------------------------------------
SEPF_BACAH       ------------------------------------------------------------
SEPF_BACHK       ------------------------------------------------------------
SEPF_BACCZ       ------------------------------------------------------------
SEPF_BACAN       ------------------------------------------------------------
SEPF_BACC1       ------------------------------------------------------------
SEPF_BACCR       ------------------------------------------------------------
SEPF_BACCN       ------------------------------------------------------------
SEPF_STAAU       ------------------------------------------------------------
SEPF_STAAB       ------------------------------------------------------------
SEPF_STAAC       ------------------------------------------------------------
SEPF_STAA2       ------------------------------------------------------------
SEPF_STAA9       ------------------------------------------------------------
SEPF_STAAS       ------------------------------------------------------------
SEPF_STAA1       ------------------------------------------------------------
SEPF_STAAM       ------------------------------------------------------------
SEPF_STAAW       ------------------------------------------------------------
SEPF_STAAN       ------------------------------------------------------------
SEPF_STAA8       ------------------------------------------------------------
SEPF_STAAE       ------------------------------------------------------------
SEPF_STAAT       ------------------------------------------------------------
SEPF_STAA3       ------------------------------------------------------------
SEPF_STAAR       ------------------------------------------------------------
SEPF_STAEQ       ------------------------------------------------------------
SEPF_STAHJ       ------------------------------------------------------------
SEPF_STAS1       ------------------------------------------------------------
SEPF_LACAC       ------------------------------------------------------------
SEPF_LACH4       ------------------------------------------------------------
SEPF_LACGA       ------------------------------------------------------------
SEPF_LACJO       ------------------------------------------------------------
SEPF_LACDA       ------------------------------------------------------------
SEPF_LACDB       ------------------------------------------------------------
SEPF_LACBA       ------------------------------------------------------------
SEPF_LACSS       ------------------------------------------------------------
SEPF_LACP3       ------------------------------------------------------------
SEPF_LACPL       ------------------------------------------------------------
SEPF_LACRD       ------------------------------------------------------------
SEPF_ENTFA       KPS---------------------------------------------------ARYRSA
SEPF_LEUMM       ------------------------------------------------------------
SEPF_OENOB       ---------------------------------------------------------QNQ
SEPF_LACS1       ------------------------------------------------------------
SEPF2_STRAW      --------------------------------------LHPQRDES-VRVVQPPMQR---
SEPF2_STRCO      --------------------------------------HQSQRDEE-VRVVQPPAQR---
SEPF_THEFY       --------------------------------------AVTDSSDH-SPSRNERRSP---
SEPF_ACIC1       --------------------------------------RMDARESSPADPAELRRVS---
SEPF_NOCSJ       --------------------------------------PVSDLSER------RRPAS---
SEPF_CUTAK       --------------------------------------EQHARGHK--AVQHRRRSE---
SEPF_FRAAA       --------------------------------------EEPVAMPRRPPVEPLRPA----
SEPF_FRACC       --------------------------------------EEPVAMPRRPPVEPLRPA----
SEPF_SALAI       --------------------------------------EQPERVERASVRSITRSAEPSE
SEPF3_STRAW      --------------------------------------ASETAEEK--------------
SEPF1_STRCO      --------------------------------------ASDVAEEK--------------
SEPF_PAEAT       --------------------------------------VREMPTVDA--EEEYRAPV---
SEPF_ARTS2       --------------------------------------ARETPTPHAA-EEEYRAPV---
SEPF_RENSM       --------------------------------------EPASAHQAS--EDEYRAPV---
SEPF_KINRD       --------------------------------------PRPEVSVERRPAPATTAQV---
SEPF_MYCA1       --------DPRREPADYPPPAGYRGGYA----------EESRYGAVH--PREFERPEMGR
SEPF_MYCPA       --------DPRREPADCPPPAGYRGGYA----------EESRYGAVH--PREFERPEMGR
SEPF_MYCTU       ------RGDLRGEPADYPPPG-YRGGYA----------DEPRFR-----PREFDRAEMTR
SEPF_MYCTA       ------RGDLRGEPADYPPPG-YRGGYA----------DEPRFR-----PREFDRAEMTR
SEPF_MYCBO       ------RGDLRGEPADYPPPG-YRGGYA----------DEPRFR-----PREFDRAEMTR
SEPF_MYCBP       ------RGDLRGEPADYPPPG-YRGGYA----------DEPRFR-----PREFDRAEMTR
SEPF_MYCUA       ----GMRADLRGEPADYPPPGGYRGGYP----------DEARFQ-----PREFDRADMAR
SEPF_MYCLE       -------SDLRGDPTGYLPLG-YRGGYG----------DEHRFR-----PREFDRPDLSR
SEPF_MYCGI       --------HPEDRRRDYDEPPAYRAGLAGGM---PGGFDDARFEARMRAPREFDR---TP
SEPF_MYCVP       -----------DRAREYDEPAGYR-----------GGFDDARFEPRLRGPREFDR---TP
SEPF_MYCS2       -------------GHEYDEGPAYRGGYA------ERFADEPRFEGRMRAPREFDRP--AP
SEPF_MYCSJ       --------DDRPAPREYDEPPIYR-----------GGYDEPRFDPRLRGPREFER---PA
SEPF_MYCSK       --------DDRPAPREYDEPPIYR-----------GGYDEPRFDPRLRGPREFER---PA
SEPF_MYCSS       --------DDRPAPREYDEPPIYR-----------GGYDEPRFDPRLRGPREFER---PA
SEPF_NOCFA       FGPDRFGADRFDEDADYPEPAYKSYKSGYPVARRDDYPEDAYGEDRYEAPRRPTRIDAAP
SEPF_RHOJR       ------------DDRDFAEPAFS--KAAYAPGRRDDLDDDF---DRYDGPRHSSRVEPVA
SEPF_SACEN       -----------GVRGGFQPEAEEDGG---------DYGEEFREPAR---SRRQWAPPETP
SEPF_CLAM3       -------------------------------------AKRAPVTPLHKPSTTTRNAA---
SEPF_CLAMS       -------------------------------------AKRAPVTPLHKPSTTTRNAA---
SEPF_LEIXX       -------------------------------------QNRAPVTPLRK-SSTARNAP---
SEPF_TROW8       ------------------------------------------------------------
SEPF_TROWT       ------------------------------------------------------------
SEPF_BIFAA       --------------------------------------SASASTPSAPREQSNPFQG---
SEPF_BIFLO       --------------------------------------TAPAASSTT-----KPFPG---
SEPF1_STRAW      ------------------------------------------------------------
SEPF3_STRCO      ------------------------------------------------------------
SEPF_LACLM       --------------------------------------AQTTPKPQTQTAAPKRSASTFS
SEPF_LACLS       --------------------------------------AQSTPKPQAQTAAPKRSASTFS
SEPF_LACLA       --------------------------------------AQSTSKAQTQTAAPKRAGSTFT
SEPF_STRA1       --------------------------------------SRPRTSTYDPNRQERQRVQRDN
SEPF_STRA5       --------------------------------------SRPRTYTYDPNRQERQRVQRDN
SEPF_STRA3       --------------------------------------SRPRTSTYNPNRQERQRVQRDN
SEPF_STRP1       --------------------------------------GTSERYYQQSQPKEGHEMVDRR
SEPF_STRPG       --------------------------------------GTSERYYQQSQPKEGHEMVDRR
SEPF_STRP6       --------------------------------------GTSERYYQQSQPKEGHEMVDRR
SEPF_STRPD       --------------------------------------GTSERYYQQSQPKEGHEMVDRR
SEPF_STRPB       --------------------------------------GTSERYYQQSQPKEGHEMVDRR
SEPF_STRPC       --------------------------------------GTSERYYQQSQPKEGHEMVDRR
SEPF_STRP3       --------------------------------------GTSERYYQQSQPKEGHEMVDRR
SEPF_STRP8       --------------------------------------GTSERYYQQSQPKEGHEMVDRR
SEPF_STRPM       --------------------------------------GTSERYYQQSQPKEGHEMVDRR
SEPF_STRPF       --------------------------------------GTSERYYQQSQPKEGHEMVDRR
SEPF_STRMU       --------------------------------------QSASRPSQQ-QVQSGQN--RRS
SEPF_STRT2       --------------------------------------VPPRRQHIKSDVQETQVLRSLS
SEPF_STRT1       --------------------------------------VPPRRQHIKSDVQETQVLRSLS
SEPF_STRTD       --------------------------------------VPPRRQHIKSDVQKTQVLRSLP
SEPF_STRR6       --------------------------------------PMNQPSQSAGT--KENNITRLH
SEPF_STRP2       --------------------------------------PMNQPSQSAGT--KENNITRLH
SEPF_STRPN       --------------------------------------PMNQPSQSAGT--KENNITRLH
SEPF_STRSV       --------------------------------------PQPKPQPQQKS--STENITRLH
SEPF_STRGC       --------------------------------------VSSSSQHVTNTPSSNENITRLH
SEPF_STRSY       --------------------------------------QQPKVETRREAR-SESQLQRLH
SEPF_STRS2       --------------------------------------QQPKVETRREAR-SESQLQRLH
SEPF_RUBXD       ------------------------------------------------------------
SEPF_CALS8       ------------------------------------------------------------
SEPF_LACP7       ------------------------------------------------------------
                                                                             

SEPF_CARHZ       ---------------ANLVALPGMSM----------------------------------
SEPF2_DESRM      --------------RSELTAVPAPRS----------------------------------
SEPF_MOOTA       --------------KGKLVGLPTARN----------------------------------
SEPF_ALKMQ       ---------------NKILNIHTTTQ----------------------------------
SEPF_ALKOO       ---------------NKVVNIHTTTQ----------------------------------
SEPF_CLOD6       ---------------NKIVNLHTTSQ----------------------------------
SEPF_HUNT2       ---------------NKVVNIHSASQ----------------------------------
SEPF_CALS4       ---------------PKVVNIHTNPQ----------------------------------
SEPF_CLOAB       ---------------NKVVNIHTASS----------------------------------
SEPF_CLONN       ---------------GKVVSIHTTTS----------------------------------
SEPF_CLOBH       ---------------NKVVSIHTAVS----------------------------------
SEPF_CLOBL       ---------------NKVVSIHTAVS----------------------------------
SEPF_CLOPE       ---------------GKVVNIHTANT----------------------------------
SEPF_CLOP1       ---------------GKVVNIHTANT----------------------------------
SEPF_CLOPS       ---------------GKVVNIHTANT----------------------------------
SEPF_CLOB8       ---------------SKVVNIHTSST----------------------------------
SEPF_CLOTE       ---------------GKVVSIHSTST----------------------------------
SEPF1_DESRM      ---------------AQVVSIHSGRQ----------------------------------
SEPF_PELTS       ---------------GAVLSLHAQRQ----------------------------------
SEPF_DESHY       ---------------AQVVSIHTQKQ----------------------------------
SEPF_SYMTH       ---------------GQVVPISAVPSK-QG------------------------------
SEPF_NOSS1       ---------GTKSAMGNVIGMPGAI---NG------------------------------
SEPF_TRIV2       ---------GTKSAMGNVIGMPGAI---NG------------------------------
SEPF_TRIEI       -----QQESGMGSVMNNVIGMPGAL---NG------------------------------
SEPF_SYNY3       -----------TGVRNNVIGMPGIN---NS------------------------------
SEPF_PROM1       -------------PPSNVIGMPGIS---TN------------------------------
SEPF_PROMT       -------------PPSNVIGMPGIS---TN------------------------------
SEPF_PROMA       ---------------SKVIGMPGIS---TA------------------------------
SEPF_PROM3       -------------SGSNVIGMPGVG---ST------------------------------
SEPF_PROMM       -------------SGSNVIGMPGVG---ST------------------------------
SEPF_SYNSC       -------------PGSNVIGMPGIS---NA------------------------------
SEPF_SYNS9       -------------PGSNVIGMPGIS---TA------------------------------
SEPF_SYNPX       -------------SGSNVIGMPGIS---TA------------------------------
SEPF_SYNPW       -------------SGSNVIGMPGIS---SS------------------------------
SEPF_PROMS       -------------RSSKVVGMPGIS---NS------------------------------
SEPF_PROM0       -------------RSSKVVGMPGIS---NS------------------------------
SEPF_PROM2       -------------RSSKVVGMPGIS---NS------------------------------
SEPF_PROM9       -------------RSSKVVGMPGIS---NS------------------------------
SEPF_PROM5       -------------RSSNVVGMPGIS---NS------------------------------
SEPF_PROMP       -------------RTSNVVGMPGIA---NS------------------------------
SEPF_SYNR3       --------------SSNVIGMPGIT---SA------------------------------
SEPF_SYNP6       -------------TASNVIGLPGLS---SS------------------------------
SEPF_SYNE7       -------------TASNVIGLPGLS---SS------------------------------
SEPF_THEEB       -------------TASNVIGMPNAGRWWGA------------------------------
SEPF_SYNJB       -------------MGSNVIGLPGVN---PP------------------------------
SEPF_SYNJA       -------------MGSNVIGLPGVN---PP------------------------------
SEPF_GLOVI       --------ARKRVRAGNVIGMPNSG-----------------------------------
SEPF_SYNWW       ---------------TNVVSIHSNK-----------------------------------
SEPF_BACVZ       ----------KPQGKQNVVSLQSV--QKS-------------------------------
SEPF_BACSU       ----------KPAGKQNVVSLQSV--QKS-------------------------------
SEPF_BACLD       ----------KAAGKQNVVSLQSV--QKS-------------------------------
SEPF_BACP2       ----------PQTGKQNVVSLQSV--QKS-------------------------------
SEPF_GEOKA       ----------KTAGKANVVSLQSV--QKS-------------------------------
SEPF_GEOTN       ----------KTANKTNVVSLQSV--QKS-------------------------------
SEPF_BACSK       ----------GMEQNQNIVSLQSV--QKS-------------------------------
SEPF_BACHD       ----------ERETGQNVVSLQSV--QKT-------------------------------
SEPF_LISIN       ----------VEEEDAKVVSMQGA--QFS-------------------------------
SEPF_LISW6       ----------VEEEDAKVVSMQGA--QYS-------------------------------
SEPF_LISMO       ----------VEEDDAKVVSMQGA--QFS-------------------------------
SEPF_LISMF       ----------VEEDDAKVVSMQGA--QFS-------------------------------
SEPF_OCEIH       ----------AKVNPKNVVNLSSV--QQSN------------------------------
SEPF_BACAH       ----------KAQPKQNVVSIETA--KQS-------------------------------
SEPF_BACHK       ----------KAQPKQNVVSIETA--KQS-------------------------------
SEPF_BACCZ       ----------KAQPKQNVVSIETA--KQS-------------------------------
SEPF_BACAN       ----------KAQPKQNVVSIETA--KQS-------------------------------
SEPF_BACC1       ----------KAQTKQNVVSIETA--KQS-------------------------------
SEPF_BACCR       ----------KAQPKQNVVSIETA--KQS-------------------------------
SEPF_BACCN       ----------KVQPKQNVVSIETA--KQS-------------------------------
SEPF_STAAU       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAAB       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAAC       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAA2       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAA9       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAAS       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAA1       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAAM       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAAW       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAAN       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAA8       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAAE       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAAT       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAA3       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAAR       ----------SKNNSRNVVTMNNATPNNAS------------------------------
SEPF_STAEQ       ----------SKNNSRNVVTMNQASQSYTA------------------------------
SEPF_STAHJ       ----------SKSNGKNVVTMNQTSQSYSG------------------------------
SEPF_STAS1       ----------SKNNARNVVNMNNQEQENYDFT----------------------------
SEPF_LACAC       --------------RDNVVSIKSGLN----------------------------------
SEPF_LACH4       --------------RDNIVSIKSGLN----------------------------------
SEPF_LACGA       -------------RRANVVSINSGV-----------------------------------
SEPF_LACJO       -------------RRANVVSINSGV-----------------------------------
SEPF_LACDA       -------------RDSNVVSIKAGQA----------------------------------
SEPF_LACDB       -------------RDSNVVSIKAGQA----------------------------------
SEPF_LACBA       -------------DSRKVVAMRTA------------------------------------
SEPF_LACSS       -------------NIISMTAAGNA------------------------------------
SEPF_LACP3       -------------RSNKVVSMATP------------------------------------
SEPF_LACPL       -------------STPKVVPMQGG------------------------------------
SEPF_LACRD       -------------TSNKVVSINSGR-----------------------------------
SEPF_ENTFA       EAHQERDTQQAAYTEKKVVSMRSSNQSATTNTRRAQE--------------------STA
SEPF_LEUMM       -------------QPRFVRQTTQSQTP------------------------------AGL
SEPF_OENOB       NRNGFAYDNGYRQQPKMSAVNSSTQSA------------------------------NNS
SEPF_LACS1       --------------NRQVMSLMSSKNN------------------------------STT
SEPF2_STRAW      ---------------DPVPHSASLPAESVRPARIAPVASITQERQSLEKNAPVIMPKVVS
SEPF2_STRCO      ---------------EPMPRAASLAAESSRPARIAPVASITQERASLEKSAPVIMPKVVS
SEPF_THEFY       ---------------APAPATADLA-----------------------------------
SEPF_ACIC1       ---------------EPAPTERPTP-----------------------------------
SEPF_NOCSJ       ---------------GPTGVVAELS-----------------------------------
SEPF_CUTAK       ---------------LEEPSIADIN-----------------------------------
SEPF_FRAAA       ---------------GPVPMRRVMPVE---------------------------------
SEPF_FRACC       ---------------GPVPMRRVAAVE---------------------------------
SEPF_SALAI       SLT---YHTRDNLALAPQPVRERVPAD---------------------------------
SEPF3_STRAW      ---------------GR-------------------------------------------
SEPF1_STRCO      ---------------GR-------------------------------------------
SEPF_PAEAT       ---------------TPIKRAAS---------------------------------SRED
SEPF_ARTS2       ---------------TPIKRAAS---------------------------------SREE
SEPF_RENSM       ---------------TPIKRAAS---------------------------------NRDD
SEPF_KINRD       ---------------TPIRKQVAHVVPQT--------------------------STTSS
SEPF_MYCA1       PR------FGSW-LRNSTRGALAMDPRRM-------------------------AMMFEE
SEPF_MYCPA       PR------FGSW-LRNSTRGALAMDPRRM-------------------------AMMFEE
SEPF_MYCTU       PR------FGSW-LRNSTRGALAMDPRRM-------------------------AMMFED
SEPF_MYCTA       PR------FGSW-LRNSTRGALAMDPRRM-------------------------AMMFED
SEPF_MYCBO       PR------FGSW-LRNSTRGALAMDPRRM-------------------------AMMFED
SEPF_MYCBP       PR------FGSW-LRNSTRGALAMDPRRM-------------------------AMMFED
SEPF_MYCUA       PR------FGSW-LRNPTRGSLAMDPRRM-------------------------AMMFEE
SEPF_MYCLE       PR------LGSW-LRNSTRGALAMDPRRM-------------------------AMLFDE
SEPF_MYCGI       PR------FGA--MRGSTRGALAMDPRGM-------------------------AELFEA
SEPF_MYCVP       PR------FGG--LRGSTRGALAMDPRGM-------------------------AELFEA
SEPF_MYCS2       AR------LGA--MRGSTRGALAMDPRGM-------------------------AELFEA
SEPF_MYCSJ       PR------LGA--LRGSTRGALAMDPRRM-------------------------AMLFEE
SEPF_MYCSK       PR------LGA--LRGSTRGALAMDPRRM-------------------------AMLFEE
SEPF_MYCSS       PR------LGA--LRGSTRGALAMDPRRM-------------------------AMLFEE
SEPF_NOCFA       SSGRFRAGGGAPMLRGATRGALAVDPEAEERRLEERMRPEPVVARR--------PGIFED
SEPF_RHOJR       VRSARPSASGA--VRGSTRGALAVDTRSE--RVESRRGP-----------------LFDE
SEPF_SACEN       VR----APLGSDAHREQVSRLRAVTDTGS-------------------------------
SEPF_CLAM3       ------------------------------------------------------------
SEPF_CLAMS       ------------------------------------------------------------
SEPF_LEIXX       ------------------------------------------------------------
SEPF_TROW8       ------------------------------------------------------------
SEPF_TROWT       ------------------------------------------------------------
SEPF_BIFAA       ------------------------------------------------------------
SEPF_BIFLO       ------------------------------------------------------------
SEPF1_STRAW      ------------------------------------------------------------
SEPF3_STRCO      ------------------------------------------------------------
SEPF_LACLM       KPMP------EKIVQQQTVSQAQSL-----------------------------------
SEPF_LACLS       KPMP------EKIVQQQTVSQAQSL-----------------------------------
SEPF_LACLA       KPMP------EKIVQQQTVSQSQSV-----------------------------------
SEPF_STRA1       AYQQ------ATPRVQNKDSVRQQ------------------------------------
SEPF_STRA5       AYQQ------ATPRVQNKDSVRQQ------------------------------------
SEPF_STRA3       SYQQ------ATPRIQNKDSVRQQ------------------------------------
SEPF_STRP1       KRMS------TSSIANRREQYQQST-----------------------------------
SEPF_STRPG       KRMS------TSSIANRREQYQQST-----------------------------------
SEPF_STRP6       KRMS------TSSIANRREQYQQST-----------------------------------
SEPF_STRPD       KRMS------TSSIANRRERYQQST-----------------------------------
SEPF_STRPB       KRMS------TSGIANRREQYQQST-----------------------------------
SEPF_STRPC       KRMS------TSGIANRREQYQQST-----------------------------------
SEPF_STRP3       KRMS------TSGIANRREQYQQST-----------------------------------
SEPF_STRP8       KRMS------TSGIANRREQYQQST-----------------------------------
SEPF_STRPM       KRMS------TSGIANRREQYQQST-----------------------------------
SEPF_STRPF       KRMS------TSGIANRREQYQQST-----------------------------------
SEPF_STRMU       GEEN------IHSLPTRRQSHNQQP-----------------------------------
SEPF_STRT2       LSR------------SQVNQGSQQM-----------------------------------
SEPF_STRT1       LSR------------SQVNQGSQQM-----------------------------------
SEPF_STRTD       LSR------------SQVNQGSQQM-----------------------------------
SEPF_STRR6       ARQ------------QELAN-QSQR-----------------------------------
SEPF_STRP2       ARQ------------QELAN-QSQR-----------------------------------
SEPF_STRPN       ARQ------------QELAN-QSQR-----------------------------------
SEPF_STRSV       ARQ------------QELAQ-HRAN-----------------------------------
SEPF_STRGC       ARQ------------QELAQNHSVA-----------------------------------
SEPF_STRSY       ERQ------------QELMTNNNEK-----------------------------------
SEPF_STRS2       ERQ------------QELMTNNNEK-----------------------------------
SEPF_RUBXD       ----------EGPERGRYAHNPPHLRAVPD------------------------------
SEPF_CALS8       --------------TPKVVTIGKAN-----------------------------------
SEPF_LACP7       ---------FADLRKERSQRMEKTNVSKVVPIR--------------------------N
                                                                             

SEPF_CARHZ       ---LKMMVFE-PRSFDEVQ----GIADSLKSGSPVVVNLERI-DGELGRRIIDFLMGTTY
SEPF2_DESRM      ---TKIISTQ-PRTFTDVQ----TVAEHLKNGQPVVVNLSQV-HPEEAQRILDYTSGVAF
SEPF_MOOTA       ---AMRLVIARPQSFEQAA----GLAENLKNYRPLIVNVEGI-PVEEARRIIDFLSGAAY
SEPF_ALKMQ       ----MKVVIFEPSSFEEAP----GIVDNLKNRKPVIINLENI-EPDLAKKFFDFLNGAIY
SEPF_ALKOO       ----MKVVLYEPTNFEEAP----NIVDNLKNRKPVIINLENI-EPDLAKKFFDFLNGAIY
SEPF_CLOD6       ----MKVVIVEPKVYDEAA----TIADHLKQRRAVIVNLEGLTNSEVRKSIFNFMNGAVY
SEPF_HUNT2       ----FKVIVMQPESFNDAK----DVCDHLKSKKPVVVNLGSV-QKEVAQRIVDFLSGSVY
SEPF_CALS4       ----IKVLISKPEKFEQVL----SICNELKSKKPVIVDLQKM-DKSEAQRVVDFLSGAVY
SEPF_CLOAB       ----VKVVIVKPKDYDEAT----QICDDLKNRKIVVVNVTDL-EPKTAQRLLDFMGGASY
SEPF_CLONN       ----TKVLILKPMDYDAAI----EICDNLKSRKIIVVNMTSL-ESKIAQRLLDFIAGASY
SEPF_CLOBH       ----AKVKIIKPCSYEEAV----DICDELKNRKIIIVNTTDL-ETKIAQRLLDFMGGASY
SEPF_CLOBL       ----AKVKIIKPCSYEEAV----DICDELKNRKIIIVNTTDL-ETKIAQRLLDFMGGASY
SEPF_CLOPE       ----AKLMITKPLVYDDAT----EICTALKNRKIVVINTTSL-ELRTAQRLIDFVGGACY
SEPF_CLOP1       ----AKLMITKPLVYDDAT----EICTALKNRKIVVINTTSL-ELRTAQRLIDFVGGACY
SEPF_CLOPS       ----AKLMITKPLVYDDAT----EICTALKNRKIVVINTTSL-ELRTAQRLIDFVGGACY
SEPF_CLOB8       ----TKVTITKPIDYEEAT----EICEALKNRRIVLVNTTVL-ELKIAQRLLDFISGSCY
SEPF_CLOTE       ----PKVSIVKPKTYDEVV----DICDDLKDGKIVIVNSIEL-DPKVGQRLVDFVSGATY
SEPF1_DESRM      ----LRVVVCDPASFDEAQ----NIADNLKNRRAVVVNLEKA-GAEQARRIVDFISGATA
SEPF_PELTS       ----VRVVVVEPRAFDEVQ----GIADNLKNRRPVIVNLEQA-EPDLAKRIVDFISGATY
SEPF_DESHY       ----IKVVVMEPQAFEDSQ----SIADQLRNRRPVIVNLENA-ERNLAKRIVDFVSGATY
SEPF_SYMTH       ---TVKVVVVEPRSFEEVQ----TIVDQMKARRPVILNLESL-DKDLAQKILNFLNGAIY
SEPF_NOSS1       ---ISEVLVLEPRTFEEMP----QAIQALRERKSVVLNLTIM-DPDQAQRAVDFVAGGTY
SEPF_TRIV2       ---ISEVLVLEPRTFEEMP----QAIQALRERKSVVLNLTIM-DPDQAQRAVDFVAGGTY
SEPF_TRIEI       ---MSEVVVLEPRTFEEMP----QAIRALRERKSVVLNLTIM-DPEQAQRAVDFVAGGTY
SEPF_SYNY3       ---VAEVVVVEPHSFDEMP----QVIQTLRERKSVVLNLNVM-DPEEAQRAVDFVAGGTF
SEPF_PROM1       ---DSEVSLMEPRSFDEMP----RVIQALRERKTVILNLTMM-EPDQAQRAVDFVAGGTF
SEPF_PROMT       ---DSEVSLMEPRSFDEMP----RVIQALRERKTVILNLTMM-EPDQAQRAVDFVAGGTF
SEPF_PROMA       ---AAEVSLMEPRSFDEMP----KAIQALRERKTVILNLTMM-EPDQAQRAVDFVAGGTF
SEPF_PROM3       ---SAEVNLMEPRSFDEMP----RAIQALRERKTVILNLTMM-EPDQAQRAVDFVAGGTF
SEPF_PROMM       ---SAEVNLMEPRSFDEMP----RAIQALRERKTVILNLTMM-EPDQAQRAVDFVAGGTF
SEPF_SYNSC       ---AAEVNVMEPRSFDEMP----RAIQALRERKTVILNLTMM-EPDQAQRAVDFVAGGTF
SEPF_SYNS9       ---AAEVNLMEPRSFDEMP----RAIQALRERKTVILNLTMM-EPDQAQRAVDFVAGGTF
SEPF_SYNPX       ---AAEVNLMEPRSFDEMP----RAIQALRERKTVILNLTMM-EPDQAQRAVDFVAGGTF
SEPF_SYNPW       ---AAEVSLMEPRSFDEMP----RAIQALRERKTVILNLTMM-EPDQAQRAVDFVAGGTF
SEPF_PROMS       ---SSEVSLMEPRSFDEMP----QAIQALRERKTVILNLTMM-DPDQAQRAVDFIAGGTY
SEPF_PROM0       ---SSEVSLMEPRSFDEMP----QAIQALRERKTVILNLTMM-DPDQAQRAVDFIAGGTY
SEPF_PROM2       ---SSEVSLMEPRSFDEMP----QAIQALRERKTVILNLTMM-DPDQAQRAVDFIAGGTY
SEPF_PROM9       ---SSEVSLMEPRSFDEMP----QAIQALRERKTVILNLTMM-DPDQAQRAVDFIAGGTY
SEPF_PROM5       ---SSEVSLMEPRSFDEMP----QAIQALRERKTVILNLTMM-DPDQAQRAVDFVAGGTY
SEPF_PROMP       ---SSEVNLMEPRSFDEMP----QAIQALRERKTVILNLTMM-DPDQAQRAVDFVAGGTY
SEPF_SYNR3       ---AAEVLVMEPRSFDEMP----KTIQALRERKTIILNLTMM-EPDQAQRAVDFVAGGTY
SEPF_SYNP6       ----SEVVVMEPRSFEEMP----QAIQALRERKTIVLNLTMM-EPDQAQRAVDFVAGGTF
SEPF_SYNE7       ----SEVVVMEPRSFEEMP----QAIQALRERKTIVLNLTMM-EPDQAQRAVDFVAGGTF
SEPF_THEEB       ---VAEVLVMQPRSFSEMP----EVIKALKERKSVVLNLTLM-EPEQAQRSVDFVAGATF
SEPF_SYNJB       ---TSEVVVMEPRSFDEMA----QVIQYLRERKTVIMNLTLM-DPAEAQRSVDFVAGGTY
SEPF_SYNJA       ---TSEVVVLEPRSFDEMA----QVIQYLRERKTVIMNLTLM-DPAEAQRSVDFVAGGTY
SEPF_GLOVI       ---VNEVLVIEPRSFEEAP----QIVQHLRDRKSVILNLTLM-DSDQAQRSVDFVAGATF
SEPF_SYNWW       ---TFKVVVCEPESFDEVQ----VLADHLKSRKQLILNFDNT-PPEVSQRIIDFISGTTY
SEPF_BACVZ       ----SKVVLSEPRVYAEAQ----EIADHLKNRRAVVVNLQRI-QHDQAKRIVDFLSGTVY
SEPF_BACSU       ----SKVVLSEPRVYAEAQ----EIADHLKNRRAVVVNLQRI-QHDQAKRIVDFLSGTVY
SEPF_BACLD       ----SKVVLSEPRVYAEAQ----EIADHIKNRRAVVVNLQRI-QHDQAKRIVDFLSGTVY
SEPF_BACP2       ----SKVVLSEPRVYAEAQ----EIADHIKNRRAVVVNLQRI-QHDQAKRIIDFLSGTVY
SEPF_GEOKA       ----AKVVLAEPRVYAEAQ----EIADHLKSRRAVIVNLQRI-QHEQAKRIVDFLSGTVY
SEPF_GEOTN       ----AKVVLAEPRVYAEAQ----EIADHLKSRRAVIVNLQRI-QHEQAKRIVDFLSGTVY
SEPF_BACSK       ----AKMILLEPRSYDEAQ----DIADHLKRRKAVVINLLRI-EQEQALRIVDFLSGTVY
SEPF_BACHD       ----AKVVLLEPRTYDEAQ----EIADQLKNRKAVIINLQRI-SHEQAKRVVDFLSGTVY
SEPF_LISIN       ----SRMVLAEPRVYAEAQ----ELADYLKDYKTVVVNLQRI-SHDQATRIVDFLSGTVY
SEPF_LISW6       ----SRMVLAEPRVYAEAQ----ELADYLKDYKTVVVNLQRI-SHDQATRIVDFLSGTVY
SEPF_LISMO       ----SRMVLAEPRVYAEAQ----ELADYLKEYKSVVVNLQRI-SHDQATRIVDFLSGTVY
SEPF_LISMF       ----SRMVLAEPRVYAEAQ----ELADYLKEYKSVVVNLQRI-SHDQATRIVDFLSGTVY
SEPF_OCEIH       ----SRVVLIEPRNYNEAQ----EIADNIVNRRAVIINLQRV-DHQQAKRIVDFLSGTVY
SEPF_BACAH       ----SKVVLLEPRTYSEAQ----GIADHLKGRRAVVINLQRM-STDQAVRIVDFLSGTVY
SEPF_BACHK       ----SKVVLLEPRTYSEAQ----GIADHLKGRRAVVINLQRM-STDQAVRIVDFLSGTVY
SEPF_BACCZ       ----SKVVLLEPRTYSEAQ----GIADHLKGRRAVVINLQRM-STDQAVRIVDFLSGTVY
SEPF_BACAN       ----SKVVLLEPRTYSEAQ----GIADHLKGRRAVVINLQRM-STDQAVRIVDFLSGTVY
SEPF_BACC1       ----SKVVLLEPRTYSEAQ----GIADHLKGRRAVVINLQRM-STDQAVRIVDFLSGTVY
SEPF_BACCR       ----SKVVLLEPRTYSEAQ----GIADHLKGRRAVVINLQRM-STDQAVRIVDFLSGTVY
SEPF_BACCN       ----SKVVLLEPRTYSEAQ----GIADHLKGKRAVVINLQRM-STDQAVRIVDFLSGTVY
SEPF_STAAU       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAAB       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAAC       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAA2       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAA9       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAAS       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAA1       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAAM       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAAW       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAAN       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAA8       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAAE       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAAT       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAA3       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAAR       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_STAEQ       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DQVSAKRIIDFLSGTVY
SEPF_STAHJ       -YESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKISAKRIIDFLSGTVY
SEPF_STAS1       -QESSKMCLFEPRVFSDTQ----DIADELKNRRATLVNLQRI-DKVSAKRIIDFLSGTVY
SEPF_LACAC       -SSKSKIVLYEPRVYSDAK----DVAQNLLNNKAVVINFSRM-EDSSARRIVDFITGTVY
SEPF_LACH4       -SAKSKIVLYEPRVYSDAK----DVAQNLLNNKAVVINFSRM-EDSSARRIVDFITGTVY
SEPF_LACGA       -GATSKIVLYEPRVYSDAK----EVAQNLLNNKAVIINFARM-DDEQARRIVDFITGTVY
SEPF_LACJO       -SATSKIVLYEPRVYSDAK----EVAQNLLNNKAVIINFARM-DDEQARRIVDFITGTVY
SEPF_LACDA       GSGPSKIVLYEPRVYSDAK----EVAQNLLNQRAIIINFSRM-DDASARRVVDFITGTVY
SEPF_LACDB       GSGPSKIVLYEPRVYSDAK----EVAQNLLNQRAIIINFSRM-DDASARRVVDFITGTVY
SEPF_LACBA       KPNASHIAICEPRIYSDAK----SIAKQLTNGDAVIVNFARV-DEAQAQRIVDFLNGTAY
SEPF_LACSS       KMN--KIVLCEPRIYSDAK----KVGKHLLENKAVIVNFTRI-EGAQASRIIDFLTGTVF
SEPF_LACP3       AGKTAKIVVYEPRVYSDAK----EIGSHLLNNRAVVINFDRI-GSDDATRIVDFLTGTVF
SEPF_LACPL       KSVNSKIALFEPKIYSDVK----EIATQLLKNQAVIINFDHV-DDEMARRIVDFLTGTVF
SEPF_LACRD       LNQMSQISLYEPRLYADVK----QIASQLLEGHAVIVNFTQM-DANVAARLVDFLNGTVF
SEPF_ENTFA       NAKTHKITIIEPRVYSEAM----SIAKHLFAEEAVLVNFTLV-EEDQARRIVDFLTGTVY
SEPF_LEUMM       NSANSKIALFEPKVYSDSR----SIASQILGGEAAIVNFTQI-DEAQAKRILDFLGGTIY
SEPF_OENOB       AKIDSHIALFVPKVFSDAK----TIVNQLLLHEAVIVNFSAI-DETQSAKIVDFVAGAIY
SEPF_LACS1       VQREQKIMVFDPSVFSDVK----NIGKMILNGRAVIVNFRKM-DENQIHRVIDFLSGLIF
SEPF2_STRAW      EREPYRITTLHPRTYNEAR----TIGEHFREGTPVIMNLTEM-DDTDAKRLVDFAAGLVF
SEPF2_STRCO      EREPYRITTLHPRTYNEAR----TIGEHFREGTPVIMNLTEM-DDTDAKRLVDFAAGLVF
SEPF_THEFY       -----RITTLHPRTYNEAR----TIGEHFREGIPVIMNLTEM-VDSDAKRLVDFAAGLIF
SEPF_ACIC1       ---PLRVTTLHPRTYNEAR----AIGEHFREGIPVIMNLTEM-DDADAKRLVDFAAGLTF
SEPF_NOCSJ       -----RITTLHPSTYNEAR----TVGENFRDGTPVIMNLSEM-DDADAKRLVDFAAGLVF
SEPF_CUTAK       -----RILTVHPRNYNEAR----TIGEQFREGIPVIMNLTEM-DDADAKRLVDFAAGLIF
SEPF_FRAAA       ETHPYRITTLQPRSYNEAR----QIGEEFRDGTPVIMNLTDM-DDVDAKRLVDFAAGLIF
SEPF_FRACC       ESHPYRITTLQPRSYNEAR----QIGEEFRDGTPVIMNLTDM-DDADAKRLVDFAAGLIF
SEPF_SALAI       EEQRYQITTLHPTTYREAR----TIGEHFRDGVPVIINLTEM-DEADARRLVDFAAGLAF
SEPF3_STRAW      -----RIGTVTPDSFRDAR----GIGELFRDGVPVIINLTAM-EPTDAKRVVDFAAGLTF
SEPF1_STRCO      -----RIATVTPDSFRDAR----AIGELFRDGVPVIVNLTAM-EGTDAKRVVDFAAGLIF
SEPF_PAEAT       ASGLRQITTVHPRSYNDAK----VIGESFRDGIPVIMNVTDM-GEADAKRLVDFSAGLVF
SEPF_ARTS2       TTGLRQITTIHPRSYNDAK----LIGESFRDGIPVIMNVTDM-GEADAKRLVDFSAGLVF
SEPF_RENSM       SSGLRQITTVHPRSYNDAK----VIGESFRDGIPVIMNVTDM-GEGDAKRLVDFSAGLVF
SEPF_KINRD       SPELHRITTIHPRTYNEAK----TIGESFREGVPVIMNLTDM-DDSDAKRLVDFSAGLVF
SEPF_MYCA1       GHPLSKITTLRPKDYSEAR----TIGERFRDGTPVIMDLVSM-DNADAKRLVDFAAGLAF
SEPF_MYCPA       GHPLSKITTLRPKDYSEAR----TIGERFRDGTPVIMDLVSM-DNADAKRLVDFAAGLAF
SEPF_MYCTU       GHPLSKITTLRPKDYSEAR----TIGERFRDGSPVIMDLVSM-DNADAKRLVDFAAGLAF
SEPF_MYCTA       GHPLSKITTLRPKDYSEAR----TIGERFRDGSPVIMDLVSM-DNADAKRLVDFAAGLAF
SEPF_MYCBO       GHPLSKITTLRPKDYSEAR----TIGERFRDGSPVIMDLVSM-DNADAKRLVDFAAGLAF
SEPF_MYCBP       GHPLSKITTLRPKDYSEAR----TIGERFRDGSPVIMDLVSM-DNADAKRLVDFAAGLAF
SEPF_MYCUA       GHPLSKITTLRPKDYSEAR----TIGERFRDGTPVIMDLVSM-DNADAKRLVDFAAGLAF
SEPF_MYCLE       GSPLSKITTLRPKDYSEAR----TIGERFRDGTPVIIDLVSM-DNADAKRLVDFAAGLAF
SEPF_MYCGI       GSPLAKITTLRPKDYSEAR----TIGERFRDGTPVIMDLVSM-DNADAKRLVDFAAGLAF
SEPF_MYCVP       GSPLAKITTLRPKDYSEAR----TIGERFRDGTPVIMDLVSM-DNADAKRLVDFAAGLAF
SEPF_MYCS2       GSPLAKITTLRPKDYSEAR----TIGERFRDGTPVIMDLVSM-DNADAKRLVDFAAGLAF
SEPF_MYCSJ       GSPLAKITTLRPKDYSEAR----TIGEKFRDGTPVIMDLVSM-DNADAKRLVDFAAGLAF
SEPF_MYCSK       GSPLAKITTLRPKDYSEAR----TIGEKFRDGTPVIMDLVSM-DNADAKRLVDFAAGLAF
SEPF_MYCSS       GSPLAKITTLRPKDYSEAR----TIGEKFRDGTPVIMDLVSM-DNADAKRLVDFAAGLAF
SEPF_NOCFA       GGPLSKITTLRPRDYSEAR----IIGERFREGNPVIMDLVEL-SNADAKRLVDFAAGLAF
SEPF_RHOJR       GGPLSKITTLRPRDYGEAR----TIGERFRDGTPVIMDLVEM-SNADAKRLVDFAAGLAF
SEPF_SACEN       HFNLSKITTLHPRSYSEAR----TIGEQYRDGTPVIMNLTEM-DEADAKRLVDFAAGLAF
SEPF_CLAM3       PAEMNEILTVHPKAYKDAQ----VIAENFREGVPVIINLSQM-TDDDARRLIDFASGLSI
SEPF_CLAMS       PAEMNEILTVHPKAYKDAQ----VIAENFREGVPVIINLSQM-TDDDARRLIDFASGLSI
SEPF_LEIXX       VQEMNEILTVHPRQYRDAQ----AIAESFREGIPVIINLSQM-SEGDARRLIDFASGLSQ
SEPF_TROW8       -QQMSEIFTFHPKKYSEVS----GIVERFRQNIPVIIDMSQL-SDTDARRMIDFASGLSQ
SEPF_TROWT       -QQMSEIFTFHPKKYSEVS----GIVERFRQNIPVIIDMSQL-SDTDARRMIDFASGLSQ
SEPF_BIFAA       -GRVSRITTIHPKTYDDAQ----MVGRAIRDGIPVVLNLTGV-AEAVAYRIVDFSAGVVF
SEPF_BIFLO       -GRVNRITTIHPKSYEDAQ----LVGRALRDGVPVVLNLTGV-AEAVAYRIVDFSAGVVF
SEPF1_STRAW      --ARRRFVVLRVNIFADAR----DVAETLMRGIPVLLDLTSA-ETEVAKRVLDFSTGVVF
SEPF3_STRCO      --RRRRFVVLRINVFADAR----EVAETLMAGIPVLLDLTSA-EGEVAKRVLDFSTGVVF
SEPF_LACLM       AATVSTIAIKEPRAYADIM----ESARIVKNGECVLVNFKFM-GDAQARRSIDFMTGVVF
SEPF_LACLS       AATVSTIAIKEPRAYADIM----ESARIVKNGECVLVNFKFM-GDAQARRSIDFMTGVVF
SEPF_LACLA       AATVSTIAIKEPRAYADIM----ESARIVKNGECVLVNFKFM-GDAQARRSIDFMTGVVF
SEPF_STRA1       -REQVTIALKYPRKYEDAQ----EIVDLLIVNECVLIDFQYM-LDAQARRCLDYIDGASR
SEPF_STRA5       -REQVTIALKYPRKYEDAQ----EIVDLLIVNECVLIDFQYM-LDAQARRCLDYIDGASR
SEPF_STRA3       -REQVTIALKYPRKYEDAQ----EIVDLLIVNECVLIDFQYM-LDAQARRCLDYIDGASR
SEPF_STRP1       CSDQTTIALKYPRKYEDAQ----EIVDLLIVNECVLIDFQFM-LDAQARRCLDFIDGASK
SEPF_STRPG       CSDQTTIALKYPRKYEDAQ----EIVDLLIVNECVLIDFQFM-LDAQARRCLDFIDGASK
SEPF_STRP6       CSDQTTIALKYPRKYEDAQ----EIVDLLIVNECVLIDFQFM-LDAQARRCLDFIDGASK
SEPF_STRPD       CSDQTTIALKYPHKYEDAQ----EIVDLLIVNECVLIDFQFM-LDAQARRCLDFIDGASK
SEPF_STRPB       CSDQTTIALKYPRKYEDAQ----EIVDLLIVNECVLIDFQFM-LDAQARRCLDFIDGASK
SEPF_STRPC       CSDQTTIALKYPRKYEDAQ----EIVDLLIVNECVLIDFQFM-LDAQARRCLDFIDGASK
SEPF_STRP3       CSDQTTIALKYPRKYEDAQ----EIVDLLIVNECVLIDFQFM-LDAQARRCLDFIDGASK
SEPF_STRP8       CSDQTTIALKYPRKYEDAQ----EIVDLLIVNECVLIDFQFM-LDAQARRCLDFIDGASK
SEPF_STRPM       CSDQTTIALKYPRKYEDAQ----EIVDLLIVNECVLIDFQFM-LDAQARRCLDFIDGASK
SEPF_STRPF       CSDQTTIALKYPRKYEDAQ----EIVDLLIVNECVLIDFQFM-LDAQARRCLDFIDGASK
SEPF_STRMU       AQEKTTIALKLPRKYEDAE----EIVDLLIRNECVLIDFQYM-LEAQARRCLDFIDGASK
SEPF_STRT2       NTTKTTIAIKYPKKYEDAQ----EIVELLIENECVLIDFQYM-LEAQARRCLDFIDGASK
SEPF_STRT1       NTTKTTIAIKYPKKYEDAQ----EIVELLIENECVLIDFQYM-LEAQARRCLDFIDGASK
SEPF_STRTD       NTTKTTIAIKYPKKYEDAQ----EIVELLIENECVLIDFQYM-LEAQARRCLDFIDGASK
SEPF_STRR6       ATDKVIIDVRYPRKYEDAT----EIVDLLAGNESILIDFQYM-TEVQARRCLDYLDGACH
SEPF_STRP2       ATDKVIIDVRYPRKYEDAT----EIVDLLAGNESILIDFQYM-TEVQARRCLDYLDGACH
SEPF_STRPN       ATDKVIIDVRYPRKYEDAT----EIVDLLAGNESILIDFQYM-TEVQARRCLDYLDGACH
SEPF_STRSV       ADEKITIDVRYPRRYEEAT----EIVDLLLANESILIDFQYM-TEVQARRCLDYLDGARY
SEPF_STRGC       TSEKVTIDVRYPKKYEDAP----AIVDLLLANESVLIDFQYM-TEVQARRCIDYLDGAKQ
SEPF_STRSY       EIVKTTIDIKFPKRYEDAP----EMVNLLLDNASILIDFQYM-SEQQARRCLDYLDGARS
SEPF_STRS2       EIVKTTIDIKFPKRYEDAP----EMVNLLLDNASILIDFQYM-SEQQARRCLDYLDGARS
SEPF_RUBXD       -QRPTRVSVVEPSSFNDAQ----ALADRFKRQQPVILNLQNV-NSDLSRRMVDFCAGLTY
SEPF_CALS8       ---QTEVTVYNLKLFDEVV----KVCDALRENKIVVFNLEQV-AEDHIQRIIDFVSGAVY
SEPF_LACP7       PQKGLEVCIMKPTSFEDSQ----DICDMLLSGRAAVINLEGF-DVDLAQRVMDFISGAVY
                       .                            :.:             .:   *   

SEPF_CARHZ       ALGGHLHKINPQIYLFAPQNVLI--EGEMREFRD--------------------------
SEPF2_DESRM      ALDGSAKKINGEIFLFVPSGVDIVGAGDLRTFNENVEPL---------------------
SEPF_MOOTA       ALGGRVRKVTSGIFLFTTSNVDL--SGDLEDQIPGGLNW---------------------
SEPF_ALKMQ       ALDGNIQKVASGIFILAPNNVDISGNIKEEL-----------------------------
SEPF_ALKOO       ALDGNIQKVSSGIFILAPNNVDISGNIKEEL-----------------------------
SEPF_CLOD6       VLDGSIQKVSKSIFILAPNNVDIDANMKKEL-----------------------------
SEPF_HUNT2       ALDGSIQKVSNDIFIVAPHNVDIMGDFKGDI-----------------------------
SEPF_CALS4       ALNGEITKISGYIFLVAPENFDVTGDIKEEV-----------------------------
SEPF_CLOAB       VLNGELLEIDKGVYLLSPSNVDISRDLKNDL-----------------------------
SEPF_CLONN       ALGGSLDEIDKGVYIVSPSNVEITNELKNEL-----------------------------
SEPF_CLOBH       ALGGSLEEVEKSVYILAPSTVEVTNELKSQLI----------------------------
SEPF_CLOBL       ALGGSLEEVEKSVYILAPSTVEVTNELKSQLI----------------------------
SEPF_CLOPE       ALCGELQEVEKGVFIVSPSNVEVSNELKSEL-----------------------------
SEPF_CLOP1       ALCGELQEVEKGVFIVSPSNVEVSNELKSEL-----------------------------
SEPF_CLOPS       ALCGELQEVEKGVFIVSPSNVEVSNELKSEL-----------------------------
SEPF_CLOB8       ALGGELQQIEKGVYILSPSNVEVTNELKNEL-----------------------------
SEPF_CLOTE       SLNGTLEEIEKGIYILSPSNVEVDSELKNQL-----------------------------
SEPF1_DESRM      ALNGDMQKVGQNIFLFVPSNIDIANDTARET-----------------------------
SEPF_PELTS       ALNGSLQKVGSGIFLFVPNNMDIASDLKDPQ-----------------------------
SEPF_DESHY       ALGGNMQKVGNGIFLFVPNNVDISGEMKDDF-----------------------------
SEPF_SYMTH       ALNGETQRVSAGIFFYAPPGIDVSTMGRGLTGTAIGGGAVDLPPGVLEKLMGTASGSQEG
SEPF_NOSS1       ALDGHQERIGESIFLFTPSCVQVSTQGGVIHEVPQPPARPARPA----------------
SEPF_TRIV2       ALDGHQERIGESIFLFTPSCVQVSTQGGVIHEVPQPPARPARPA----------------
SEPF_TRIEI       ALDGHQERIGESIFLFTPSCVQVRTQTGLVNEMSQTQPRPRVPN----------------
SEPF_SYNY3       AMDGHQERIGESIFLFTPNCVKVSSLAGRSQESNE---TSSSVS----------------
SEPF_PROM1       AIDGHQERVGESIFLFAPSCVTVTNSFQEEASPSNMSNKGNDLI----------------
SEPF_PROMT       AIDGHQERVGESIFLFAPSCVTVTNSFQEEASPSNMSNKGNDLI----------------
SEPF_PROMA       AIDGHQERVGESIFLFAPSCVTVTNSFQEEPSPSSVMNKDNEGP----------------
SEPF_PROM3       AIDGHQERVGESIFLFAPSCVTVSNTSYDEASAPSMVSQDHDSVPS--------------
SEPF_PROMM       AIDGHQERVGESIFLFAPSCVTVSNTSYDEASAPSMVSQDHDSVPS--------------
SEPF_SYNSC       AIDGHQERVGESIFLFAPSCVTVTNTGHDEASAPTVVSREADAA----------------
SEPF_SYNS9       AIDGHQERVGESIFLFAPSCVTVTNASQDETSAPTVVSREIDVA----------------
SEPF_SYNPX       AIDGHQERVGESIFLFAPSCVTVTNTSHDEASTPTVVSRDAEAE----------------
SEPF_SYNPW       AIDGHQERVGESIFLFAPSCVTVTNSAHEEASTPTVVTKDVEQA----------------
SEPF_PROMS       AIDGHQERVGESIFLFAPSCVNVTSSSPEEASPSSVSTENTPQY----------------
SEPF_PROM0       AIDGHQERVGESIFLFAPSCVNVTSSSPEEASPSSVSTEKTPQY----------------
SEPF_PROM2       AIDGHQERVGESIFLFAPSCVNVTSSSPEEASPSSVPTENTPQY----------------
SEPF_PROM9       AIDGHQERVGESIFLFAPSCVNVTSSSPEEASPSSVSPKNTPQY----------------
SEPF_PROM5       AIDGHQERVGESIFLFAPSCVNVTSSFPEEVSPSNISSKKTSPY----------------
SEPF_PROMP       AIDGHQERVGESIFLFAPSCVNVTSSFPEEASPSNVSSKKTSQY----------------
SEPF_SYNR3       AIDGHQERVGESIFLFAPSCVTVTTASSEESAAPSVMAREEEAT----------------
SEPF_SYNP6       AIDGHQERVGESIFLFTPSCVHVTTQGGEQYLNESPAQPVQTTT----------------
SEPF_SYNE7       AIDGHQERVGESIFLFTPSCVHVTTQGGEQYLNESPAQPVQTTT----------------
SEPF_THEEB       TIDGHQERIGESIFLFTPSCVQVSTQVGGVRPSATPT-----------------------
SEPF_SYNJB       AIDGHQERIGENIFLFTPSTVMVSTPSSQVVQPLQRPLQSPTPL----------------
SEPF_SYNJA       AIDGHQERIGENIFLFTPSTVTVSTPSSQGMPPLQRPLQSPTPL----------------
SEPF_GLOVI       AIDGHQERVGDGIFLFTPSSVMISTEMPSQLRQANQAFGGNFRL----------------
SEPF_SYNWW       SLEGHSQQLGKNIFIFTPSNVEIAKDHRSLMRKHGFANPFGGEK----------------
SEPF_BACVZ       AIGGDIQRIGSDIFLCTPDNVDVSGTISELINEDEHQ-RW--------------------
SEPF_BACSU       AIGGDIQRIGSDIFLCTPDNVDVSGTISELISEDEHQ-RW--------------------
SEPF_BACLD       ALGGDIQRIGADIFLCTPENVDVSGTISELI-EEEHQ-RW--------------------
SEPF_BACP2       AIGGDIQRIGSNIFLCTPDNVDVSGTISELLTEEEPQ-RW--------------------
SEPF_GEOKA       AIGGDIQQVGTKIFLCTPENVDVSGSISLDGEDDRPMKRW--------------------
SEPF_GEOTN       AIGGDIQQVGTKIFLCTPENVDVSGAISLDGEDDRPMKRW--------------------
SEPF_BACSK       AIGGDIQKIGPGIFLCTPDNVEITGSISDWVTRQTDSTV---------------------
SEPF_BACHD       AIGGDIQKLGMNIFLCTPDNVDVTGTITDMIQDGYRS-----------------------
SEPF_LISIN       ALGGDIQRVGNNIFLCTPDNVEVNGSISEMLDEQNFM-----------------------
SEPF_LISW6       ALGGDIQRVGNNIFLCTPDNVEVNGSISEMLDEQNFM-----------------------
SEPF_LISMO       ALGGDIQRVGNNIFLCTPDNVEVDGSISEMLDEQNFM-----------------------
SEPF_LISMF       ALGGDIQRVGNNIFLCTPDNVEVDGSISEMLDEQNFM-----------------------
SEPF_OCEIH       AVKGDIQKLGAETFLCTPDNVEVSGTITEMLYEQEEYDKGW-------------------
SEPF_BACAH       AIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEDTNIKRW------------------
SEPF_BACHK       AIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEDTNIKRW------------------
SEPF_BACCZ       AIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEDTNIKRW------------------
SEPF_BACAN       AIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEDDTNIKRW------------------
SEPF_BACC1       AIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEDTNIKRW------------------
SEPF_BACCR       AIGGDIQKIGPKTFMCTPENVDIVGAISELFGEEEETNIKRW------------------
SEPF_BACCN       AIGGDIQKLGPKTFMCTPENVDIVGAISELFGEEEETNIKRW------------------
SEPF_STAAU       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAAB       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAAC       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAA2       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAA9       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAAS       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAA1       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAAM       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAAW       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAAN       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAA8       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAAE       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAAT       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAA3       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEHSFD---------------------
SEPF_STAAR       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENVEHSFD---------------------
SEPF_STAEQ       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIENMEQHYE---------------------
SEPF_STAHJ       AIGGDIQRVGTDIFLCTPDNVEVAGSITDHIEQMESQHYE--------------------
SEPF_STAS1       AIGGDIQRVGSDIFLCTPDNVEVAGSITDQIENMEYQGE---------------------
SEPF_LACAC       TLNGEIQRIGDKIFLATPPKFVTDGKISDLVDKKDNLS----------------------
SEPF_LACH4       ALNGEIQRIGDKIFLATPPKFVTDGKISDLVDKKDNLS----------------------
SEPF_LACGA       ALNGEIQRVGDKIFLATPPKFETDGKIAELVEKKDKMD----------------------
SEPF_LACJO       ALNGEIQRVGDKIFLATPPKFETDGKIAELVEKKDKMD----------------------
SEPF_LACDA       ALNGEIQRIGDKIFLATPPKFETDGKIT--------------------------------
SEPF_LACDB       ALNGEIQRIGDKIFLATPPKFETDGKITELLDKKDTLG----------------------
SEPF_LACBA       AVGGEIKRIGEQIFLCTPHNFEVSGDVAA-----NLGTQVTR------------------
SEPF_LACSS       AINGEIQRVGEQIFLCTPPNYEIDGNLSDIIDQNDFDSEVN-------------------
SEPF_LACP3       AINGEIKRVGESIFLVTPANFEIDGSLASTIDSDGLNLSSQH------------------
SEPF_LACPL       AINGEIERIGDEIFLCIPENYEVSGSTTSQFDTSKL------------------------
SEPF_LACRD       AIDGEMKRIGKEIFLCTPKNYEISGSLTSNLKNDGDKF----------------------
SEPF_ENTFA       ALDGDIQRVGNEIFLCTPANMEIDSATAQSLANKQFFDF---------------------
SEPF_LEUMM       AVNGEIERIGQSIFLVTPNTFEISGT--LTDNLEPNSRY---------------------
SEPF_OENOB       AVEGSIEKISDEIWLIAPNNYAVSGSGSAANSMGRNARF---------------------
SEPF_LACS1       AVNGDMQRIGEKIFLCTPKNFKIEGD--LSNLTGR-------------------------
SEPF2_STRAW      GLHGSIERVTQKVFLLSPANVDVTAED--KA---RIAEGGFFNQS---------------
SEPF2_STRCO      GLHGSIERVTQKVFLLSPANVDVTAED--KA---RIAEGGFFNQS---------------
SEPF_THEFY       GLHGSIERVTNKVFLLSPANVEVTAED--KA---RIAERGFFNQS---------------
SEPF_ACIC1       GLRGSIERITSKVFLLSPRNVEVTAED--KR---RMAEGGFFNQS---------------
SEPF_NOCSJ       ATRGTIERITNKVFLLSPPNVSVAAED--KQ---RIAEGGFFNQS---------------
SEPF_CUTAK       GLRGTIERVTSKVFLLCPRNVNVTPED--KA---RIASGGFFNQS---------------
SEPF_FRAAA       GLRGDIEKVTNKVFLLSPHNVEVTETD--KR---RIREGGFYNQS---------------
SEPF_FRACC       GLRGDLEKVTNKVFLLSPHNVEVTETD--KR---RIREGGFYNQS---------------
SEPF_SALAI       GLRGTIERVTNRVFLLSPANVQVTAED--KA---KIAEGGFFSLS---------------
SEPF3_STRAW      GLRGTIERVATRVFLLTPANTEIVSGE--AA---GRPTDGFFNQS---------------
SEPF1_STRCO      GLRGSIERVSTRVFLLSPADTQVISGE--SA---AHRSDGFFNQS---------------
SEPF_PAEAT       GLHGSIERVTNKVFLLSPSYVEVIGDDK-KA---SETQASFFNQS---------------
SEPF_ARTS2       GLRGSIERVTNKVFLLSPSYVEVIGDDK-KV---SETQASFFNQS---------------
SEPF_RENSM       GLHGSIERVTNKVFLLSPVFVEVIGDDK-KA---SENQASFFNQS---------------
SEPF_KINRD       GLHGAIERVTNKVFLLSPANVEVASQEE-ER---P-TERTFFNQS---------------
SEPF_MYCA1       ALRGSFDKVATKVFLLSPADVDVSPEE--RR---RIAETGFYAYQ---------------
SEPF_MYCPA       ALRGSFDKVATKVFLLSPADVDVSPEE--RR---RIAETGFYAYQ---------------
SEPF_MYCTU       ALRGSFDKVATKVFLLSPADVDVSPEE--RR---RIAETGFYAYQ---------------
SEPF_MYCTA       ALRGSFDKVATKVFLLSPADVDVSPEE--RR---RIAETGFYAYQ---------------
SEPF_MYCBO       ALRGSFDKVATKVFLLSPADVDVSPEE--RR---RIAETGFYAYQ---------------
SEPF_MYCBP       ALRGSFDKVATKVFLLSPADVDVSPEE--RR---RIAETGFYAYQ---------------
SEPF_MYCUA       ALRGSFDKVATKVFLLSPADVDVTPEE--RR---RIAETGFYAYQ---------------
SEPF_MYCLE       ALRGSFDKVATKVFLLSPADVDVSPEE--RR---RIAETGFYAYQ---------------
SEPF_MYCGI       ALRGSFDKVATKVFLLSPADVDVTAEQ--RR---RIAEAGFYSYQ---------------
SEPF_MYCVP       ALRGSFDKVATKVFLLSPADVDVTAEQ--RR---RIAEAGFYSYQ---------------
SEPF_MYCS2       ALRGSFDKVATKVFLLSPADVDVTAEE--RR---RIAEAGFYSYR---------------
SEPF_MYCSJ       ALRGSFDKVATKVFLLSPADVDVTADE--RR---RIAEAGFYAYQ---------------
SEPF_MYCSK       ALRGSFDKVATKVFLLSPADVDVTADE--RR---RIAEAGFYAYQ---------------
SEPF_MYCSS       ALRGSFDKVATKVFLLSPADVDVTADE--RR---RIAEAGFYAYQ---------------
SEPF_NOCFA       ALRGSFDKVATKVFLLSPADVDVSAEE--RR---RIAETGFYNQK---------------
SEPF_RHOJR       ALRGSFDKVATKVFLLSPADIDVSAEE--RR---RIAETGFYSQK---------------
SEPF_SACEN       ALRGSIEKVTNRVFLLSPPNVDVAAED--KR---RLAEGAFFNYG---------------
SEPF_CLAM3       GLYGKIERVTAKVFLLSPSHVAVSGEQSATE---AEVEASFFGR----------------
SEPF_CLAMS       GLYGKIERVTAKVFLLSPSHVAVSGEQSATE---AEVEASFFGR----------------
SEPF_LEIXX       GLYGKIERVTPKVFLLSPSHIVVSGEHGGQE---AEVDASFFAQA---------------
SEPF_TROW8       GLVGKIERVVGKVFLLSPEHISISTESKKEE-----------------------------
SEPF_TROWT       GLVGKIERVVGKVFLLSPEHISISTESKKEE-----------------------------
SEPF_BIFAA       GVRGSIERVTPRVFLLSPAQVNIKVEEPEDK---GPAHDLFAD-----------------
SEPF_BIFLO       GVRGSLERVTPRVFLLSPAQVNIKVEEPTKP---ASAHDLFAD-----------------
SEPF1_STRAW      GLASGMHRVDRNVFLLTPPGTEVQGLME-GV---GVPGI---------------------
SEPF3_STRCO      GLASGMHRVDRNVFLLTPAGTEVNGLMESAA---GVPGV---------------------
SEPF_LACLM       TLDGDIQNVGGQIFLMTPANITVDAAKEMSI--LAGQNFESYDIY---------------
SEPF_LACLS       TLDGDIQNVGGQIFLMTPANITVDAAKEMSI--LAGKNFESYDIY---------------
SEPF_LACLA       TLDGDIQNVGGQIFLMTPANITVDAAKEMSI--LAGQNFESYDIY---------------
SEPF_STRA1       VLYGSLQKVGSSMFLLTPANVMVDIEEMNIP---KTGQETSFDFDMKRR-----------
SEPF_STRA5       VLYGSLQKVGSSMFLLTPANVMVDIEEMNIP---KTGQETSFDFDMKRR-----------
SEPF_STRA3       VLYGSLQKVGSSMFLLTPANVMVDIEEMNIP---KTGQETSFDFDMKRR-----------
SEPF_STRP1       VLYGSLQKVGSSMYLLAPSNVSVNIEEMTIP---HTTQDIGFDFDMKRR-----------
SEPF_STRPG       VLYGSLQKVGSSMYLLAPSNVSVNIEEMTIP---HTTQDIGFDFDMKRR-----------
SEPF_STRP6       VLYGSLQKVGSSMYLLAPSNVSVNIEEMTIP---HTTQDIGFDFDMKRR-----------
SEPF_STRPD       VLYGSLQKVGSSMYLLAPSNVSVNIEEMTIP---HTTQDIGFDFDMKRR-----------
SEPF_STRPB       VLYGSLQKVGSSMYLLAPSNVSVNIEEMTIP---HTTQDIGFDFDMKRR-----------
SEPF_STRPC       VLYGSLQKVGSSMYLLAPSNVSVNIEEMTIP---HTTQDIGFDFDMKRR-----------
SEPF_STRP3       VLYGSLQKVGSSMYLLAPSNVSVNIEEMTIP---HTTQDIGFDFDMKRR-----------
SEPF_STRP8       VLYGSLQKVGSSMYLLAPSNVSVNIEEMTIP---HTTQDIGFDFDMKRR-----------
SEPF_STRPM       VLYGSLQKVGSSMYLLAPSNVSVNIEEMTIP---HTTQDIGFDFDMKRR-----------
SEPF_STRPF       VLYGSLQKVGSSMYLLAPSNVSVNIEEMTIP---HTTQDIGFDFDMKRR-----------
SEPF_STRMU       VLAGNLQKVGASMYLLTPINVIVDAEEMTLA---ANGQDVSFNYDMKRR-----------
SEPF_STRT2       VLTGNLQKVGSSMYLLTPINVVVDIEEIGLS---HGNQESTFDFDMKRR-----------
SEPF_STRT1       VLTGNLQKVGSSMYLLTPINVVVDIEEIGLS---HGNQESTFDFDMKRR-----------
SEPF_STRTD       VLTGNLQKVGSSMYLLTPINVVVDIEEISLS---HGNQESTFDFDMKRR-----------
SEPF_STRR6       VLAGNLKKVASTMYLLTPVNVIVNVEDIRLP---DEDQQGEFGFDMKRNRVR--------
SEPF_STRP2       VLAGNLKKVASTMYLLTPVNVIVNVEDIRLP---DEDQQGEFGFDMKRNRVR--------
SEPF_STRPN       VLAGNLKKVASTMYLLTPVNVIVNVEDIRLP---DEDQQGEFGFDMKRNRVR--------
SEPF_STRSV       VLAGNLKKVASTMYLLTPINVVVNVEDIRLP---NDVEISEFDFDMKRSR----------
SEPF_STRGC       VLMGNLRRVSGTMYLLTPVNVVVNIEDIKLP---DGVH-SEFDFDMKRR-----------
SEPF_STRSY       VLSGNLKKVSNTMWLLTPVNVTVNIEELRNAGTTTGVADSNFEFDIKR------------
SEPF_STRS2       VLSGNLKKVSNTMWLLTPVNVTVNIEELRNAGTTTGVADSNFEFDIKR------------
SEPF_RUBXD       ALDGHIQTVANRVFLLTPRDVEVSAEERKMLAERAFFNQL--------------------
SEPF_CALS8       VLDAKIHKVSKKIFVVVPRSIDLEVDEQLKEEFRTKGVFAWLK-----------------
SEPF_LACP7       SLNGKLHQISSYIFIISPDSVDISGDYLDLIRQNGFEVPTLNKDF---------------
                    .    :    :.  .                                          

SEPF_CARHZ       -------------------KTFFNPFK--------
SEPF2_DESRM      -----------------EEKVNSRWFKTETA----
SEPF_MOOTA       -----------------LEAAGRGR----------
SEPF_ALKMQ       -----------------KNKGVFPWQK--------
SEPF_ALKOO       -----------------KNKGVFPWQK--------
SEPF_CLOD6       -----------------ESKAFFPWQNK-------
SEPF_HUNT2       -----------------TGKAVFPWLK--------
SEPF_CALS4       -----------------NALYNLN-----------
SEPF_CLOAB       -----------------ASKSIFNWSK--------
SEPF_CLONN       -----------------STKGILNWTK--------
SEPF_CLOBH       -----------------SSKGIFNWNK--------
SEPF_CLOBL       -----------------SSKGIFNWNK--------
SEPF_CLOPE       -----------------SNKGMFNWASK-------
SEPF_CLOP1       -----------------SNKGMFNWASK-------
SEPF_CLOPS       -----------------SNKGMFNWASK-------
SEPF_CLOB8       -----------------SSKALFNWSK--------
SEPF_CLOTE       -----------------SSKGMFSWNR--------
SEPF1_DESRM      -----------------KEKSIFAWAKS-------
SEPF_PELTS       -----------------KEKGIFTWMRS-------
SEPF_DESHY       -----------------KEKGFFWSLTK-------
SEPF_SYMTH       DLLARTARRSEEGDRTGADRSKFDWRNQ-------
SEPF_NOSS1       ------------------STNPPAWGNETNRMAQ-
SEPF_TRIV2       ------------------STNPPAWGNETNRMAQ-
SEPF_TRIEI       ------------------S-GSQVWQPEQIQMIQ-
SEPF_SYNY3       ------------------SDNFPTWGYETSRLAQ-
SEPF_PROM1       -------------SKETSPAPEPAWGETVATAL--
SEPF_PROMT       -------------SKETSPAPEPAWGETVATAL--
SEPF_PROMA       -------------VSESVMAPEPAWGASVPSAI--
SEPF_PROM3       ------------SSQQTGAAPVPAWEVTRAGGL--
SEPF_PROMM       ------------SSQQTGAAPVPAWEATSAGGL--
SEPF_SYNSC       ------------DVDEYASAPSPAWGAAAL-----
SEPF_SYNS9       ------------EPSESASAPSPAWGAAAL-----
SEPF_SYNPX       ------------QQQEAAAAPSPAWGATAL-----
SEPF_SYNPW       -------------SAEASVAPAPAWAAPGAAAL--
SEPF_PROMS       -------------SLGKNTTPEPAWGNSKLSAYS-
SEPF_PROM0       -------------SLGKNTTPEPAWGNSKLSAYS-
SEPF_PROM2       -------------SLGKNTTPEPAWGNSKLSAYS-
SEPF_PROM9       -------------SVENNTAPEPAWGNSKLSAFS-
SEPF_PROM5       -------------SLETNTTPEPAWGESKLSAFS-
SEPF_PROMP       -------------KFETNTTPEPAWGESKLSAYN-
SEPF_SYNR3       ----------------APAAPSPAWGTQDAING--
SEPF_SYNP6       -------------SFGRTATPTPAWGTDSRYAAQ-
SEPF_SYNE7       -------------SFGRTATPTPAWGTDSRYAAQ-
SEPF_THEEB       ------------------PTPPSAWGMDAQQHHSA
SEPF_SYNJB       --------------------WPSTYEHLQAVGQH-
SEPF_SYNJA       --------------------WPSGYEHLQAVGQH-
SEPF_GLOVI       -------------------NPEAPRRAQG------
SEPF_SYNWW       -----------------------------------
SEPF_BACVZ       -----------------------------------
SEPF_BACSU       -----------------------------------
SEPF_BACLD       -----------------------------------
SEPF_BACP2       -----------------------------------
SEPF_GEOKA       -----------------------------------
SEPF_GEOTN       -----------------------------------
SEPF_BACSK       -----------------------------------
SEPF_BACHD       -----------------------------------
SEPF_LISIN       -----------------------------------
SEPF_LISW6       -----------------------------------
SEPF_LISMO       -----------------------------------
SEPF_LISMF       -----------------------------------
SEPF_OCEIH       -----------------------------------
SEPF_BACAH       -----------------------------------
SEPF_BACHK       -----------------------------------
SEPF_BACCZ       -----------------------------------
SEPF_BACAN       -----------------------------------
SEPF_BACC1       -----------------------------------
SEPF_BACCR       -----------------------------------
SEPF_BACCN       -----------------------------------
SEPF_STAAU       -----------------------------------
SEPF_STAAB       -----------------------------------
SEPF_STAAC       -----------------------------------
SEPF_STAA2       -----------------------------------
SEPF_STAA9       -----------------------------------
SEPF_STAAS       -----------------------------------
SEPF_STAA1       -----------------------------------
SEPF_STAAM       -----------------------------------
SEPF_STAAW       -----------------------------------
SEPF_STAAN       -----------------------------------
SEPF_STAA8       -----------------------------------
SEPF_STAAE       -----------------------------------
SEPF_STAAT       -----------------------------------
SEPF_STAA3       -----------------------------------
SEPF_STAAR       -----------------------------------
SEPF_STAEQ       -----------------------------------
SEPF_STAHJ       -----------------------------------
SEPF_STAS1       -----------------------------------
SEPF_LACAC       -----------------------------------
SEPF_LACH4       -----------------------------------
SEPF_LACGA       -----------------------------------
SEPF_LACJO       -----------------------------------
SEPF_LACDA       -----------------------------------
SEPF_LACDB       -----------------------------------
SEPF_LACBA       -----------------------------------
SEPF_LACSS       -----------------------------------
SEPF_LACP3       -----------------------------------
SEPF_LACPL       -----------------------------------
SEPF_LACRD       -----------------------------------
SEPF_ENTFA       -----------------------------------
SEPF_LEUMM       -----------------------------------
SEPF_OENOB       -----------------------------------
SEPF_LACS1       -----------------------------------
SEPF2_STRAW      -----------------------------------
SEPF2_STRCO      -----------------------------------
SEPF_THEFY       -----------------------------------
SEPF_ACIC1       -----------------------------------
SEPF_NOCSJ       -----------------------------------
SEPF_CUTAK       -----------------------------------
SEPF_FRAAA       -----------------------------------
SEPF_FRACC       -----------------------------------
SEPF_SALAI       -----------------------------------
SEPF3_STRAW      -----------------------------------
SEPF1_STRCO      -----------------------------------
SEPF_PAEAT       -----------------------------------
SEPF_ARTS2       -----------------------------------
SEPF_RENSM       -----------------------------------
SEPF_KINRD       -----------------------------------
SEPF_MYCA1       -----------------------------------
SEPF_MYCPA       -----------------------------------
SEPF_MYCTU       -----------------------------------
SEPF_MYCTA       -----------------------------------
SEPF_MYCBO       -----------------------------------
SEPF_MYCBP       -----------------------------------
SEPF_MYCUA       -----------------------------------
SEPF_MYCLE       -----------------------------------
SEPF_MYCGI       -----------------------------------
SEPF_MYCVP       -----------------------------------
SEPF_MYCS2       -----------------------------------
SEPF_MYCSJ       -----------------------------------
SEPF_MYCSK       -----------------------------------
SEPF_MYCSS       -----------------------------------
SEPF_NOCFA       -----------------------------------
SEPF_RHOJR       -----------------------------------
SEPF_SACEN       -----------------------------------
SEPF_CLAM3       -----------------------------------
SEPF_CLAMS       -----------------------------------
SEPF_LEIXX       -----------------------------------
SEPF_TROW8       -----------------------------------
SEPF_TROWT       -----------------------------------
SEPF_BIFAA       -----------------------------------
SEPF_BIFLO       -----------------------------------
SEPF1_STRAW      -----------------------------------
SEPF3_STRCO      -----------------------------------
SEPF_LACLM       -----------------------------------
SEPF_LACLS       -----------------------------------
SEPF_LACLA       -----------------------------------
SEPF_STRA1       -----------------------------------
SEPF_STRA5       -----------------------------------
SEPF_STRA3       -----------------------------------
SEPF_STRP1       -----------------------------------
SEPF_STRPG       -----------------------------------
SEPF_STRP6       -----------------------------------
SEPF_STRPD       -----------------------------------
SEPF_STRPB       -----------------------------------
SEPF_STRPC       -----------------------------------
SEPF_STRP3       -----------------------------------
SEPF_STRP8       -----------------------------------
SEPF_STRPM       -----------------------------------
SEPF_STRPF       -----------------------------------
SEPF_STRMU       -----------------------------------
SEPF_STRT2       -----------------------------------
SEPF_STRT1       -----------------------------------
SEPF_STRTD       -----------------------------------
SEPF_STRR6       -----------------------------------
SEPF_STRP2       -----------------------------------
SEPF_STRPN       -----------------------------------
SEPF_STRSV       -----------------------------------
SEPF_STRGC       -----------------------------------
SEPF_STRSY       -----------------------------------
SEPF_STRS2       -----------------------------------
SEPF_RUBXD       -----------------------------------
SEPF_CALS8       -----------------------------------
SEPF_LACP7       -----------------------------------