CLUSTAL format seed alignment for MF_01200_B

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

PYRF_LISIN      -------------MNKPIIALDFQTYQE---VEAFLAQFSG-ESLSVKVGMELFYSNG-P
PYRF_LISMO      -------------MNKPIIALDFQTYEE---VETFLAKFSG-ETLSVKVGMELFYSNG-P
PYRF_BACSU      -----------MKNNLPIIALDFASAEE---TLAFLAPFQQ-EPLFVKVGMELFYQEG-P
PYRF_BACCL      ------------MHTPFIVALDFPSKQE---VERFLRPFAG-TPLFVKVGMELYYQEG-P
PYRF_BACHD      ------------MIRPLIIALDVENRQN---MQELLKTLP--KPLFVKVGMELFYSEG-P
PYRF_STAAM      ------------MKDLPIIALDFESKEK---VNQFLDLFD--ESLFVKVGMELFYQEG-P
PYRF_LACLA      -----------MQENRPVIALDFPEFSD---VKDFLEKFDPSEQLYIKLGMELFYTAG-P
PYRF_LACLM      -----------MQENRPVIALDFPEFSD---VKDFLEKFDPSEKLYIKLGMELFYTAG-P
PYRF_STRPN      -----------MREHRPIIALDFPSFEA---VKEFLALFPAEESLYLKVGMELYYAAG-P
PYRF_STRP1      -----------MKEERPIIALDFSSFEE---TKAFLDLFPAEEKLYVKIGMELYYAQG-P
PYRF_LACPL      ------------MKRPIIIALDFPTAER---ALAFLDQFPADLHVTVKIGMELFYAAG-P
PYRF_HELPY      --------------MQLCVALDLEKKED---NLSLLQELKG-LDLWAKVGLRSFIRDG-A
PYRF_HELPJ      --------------MQLCVALDLEKKED---NLSLLQELKG-LDLWAKVGLRSFIRDG-A
PYRF_CAMJE      --------------MKLCVALDLSTKEE---CLQLAKELKN-LDIWLKVGLRAYLRDG-F
PYRF_AQUAE      -------------MARICVALDVPWERAIKIVKDLYDFFET-YPLILKIGHKIYLEKG-G
PYRF_ECOLI      MTLTASSSSRAVTNSPVVVALDYHNRDD---ALAFVDKIDP-RDCRLKVGKEMFTLFG-P
PYRF_ECO57      MTLTASSSSRAVTNSPVVVALDYHNRDA---ALAFVDKIDP-RDCRLKVGKEMFTLFG-P
PYRF_SALTI      MTFTASSSSCAITESPVVVALDYHERDK---ALAFVDKIDP-RDCRLKVGKEMFTLFG-P
PYRF_SALTY      MTFTASSSSCAITESPVVVALDYHERDK---ALAFVDKIDP-RDCRLKVGKEMFTLFG-P
PYRF_YERPE      MTSATKTNNSGSISSPIVVALDYANKDA---ALAFADQVSP-QDCRLKVGKEMFTLYG-P
PYRF_VIBCH      -----------MNDPKVIVALDYDNLAD---ALAFVDKIDP-STCRLKVGKEMFTLFG-P
PYRF_HAEIN      ------------MTSKIIVALDFEKEAE---ALALVDQIDP-SLCRLKVGKEMFTTLG-I
PYRF_PASMU      ------------MTSKIIVALDYEKEEE---ALCLVDQIDP-SLCRLKVGKEMFTTLG-T
PYRF_PSEAE      ---------MSACQSPIIVALDFPTREA---ALALADQLDP-KLCRVKVGKELFTSCA-A
PYRF_NEIMA      MNPLISDFQTPQQRTPVIVALDFSNEKD---TLGFVRNLDP-TLCQIKIGKELFTATG-R
PYRF_NEIMB      MNPLISDFQTPQQRTPVIVALDFSNEKD---TLGFVRNLDP-TLCQIKIGKELFTATG-R
PYRF_BUCAI      -----MLNPNIFHMPKIIIALDFCNKKS---AMKLVNLLNP-SIFYLKIGKEMFTILG-C
PYRF_NOSS1      -----------MSNDKIIVALDVPDTES---AIALIDKLES--VTFWKVGLELFTSSG-P
PYRF_SYNY3      -----------MTPDQVIVALDVPDLPK---AIALVDRLPG--VGFWKVGLELFVGAG-P
PYRF_RHIFH      --------MSTSARDRLIVGLDLPTIAE---AERIVSTLGD-DVAFYKIGYQLAFAGG-L
PYRF_RHIME      --------MSTSARDRLIVGLDLPTVTE---AEKIVSTLGE-EVLFYKIGYQLAFAGG-L
PYRF_RHILO      --MQAKSIQAQSIQERLIVGLDLPTVRE---AEQAVRELDG-VVSFYKIGYQLAFAGG-L
PYRF_AGRFC      ----------MTAREKLIVGLDVPTVQQ---AEDIVSKIGD-EVLFYKIGYQLVFAGG-L
PYRF_BRUME      ----MTTELHDDASGRLIVGLDVPTIAE---AEKVVEELGN-AVSFYKIGYQLVFAGG-L
PYRF_BRADU      -----MTPAEIAPKDRLIVALDLPSVDA---AEAMIARLGD-SVTFYKIGYRLAYAGG-L
PYRF_CAUVC      ----------MTADPRLIVPLDLPTVDD---ARAMVERLGD-AVSFYKIGLELLASDG-M
PYRF_XYLFA      --MMNHTPLLLGIRERLIFALDVPSRTQ---ALEWIDRLGD-AISFYKIGMELLASGEYF
                                  . **                .        *:* .        

PYRF_LISIN      AIVEKIKQQN--HAIFLDLKLHDIPNTVKSAMIGLAKLGVDMVNVHASGGKKMMEAAREG
PYRF_LISMO      VIVEKIKQQN--HEIFLDLKLHDIPNTVKSAMIGLAKLGVDMVNVHAAGGKKMMEAAKEG
PYRF_BACSU      SIVKQLKERN--CELFLDLKLHDIPTTVNKAMKRLASLGVDLVNVHAAGGKKMMQAALEG
PYRF_BACCL      AIVAFLKEQG--HAVFLDLKLHDIPNTVKQAMKGLARVGADLVNVHAAGGRRMMEAAIEG
PYRF_BACHD      AVIEQLKDEG--HQVFLDLKLHDIPNTVKRAMRQLATLGVDIVNVHVAGGVNMMAAAREG
PYRF_STAAM      QLINEIKERG--HDVFLDLKLHDIPNTVGKAMEGLAKLNVDLVNVHAAGGVKMMSEAIKG
PYRF_LACLA      QVVYYVKSLG--HSVFLDLKLHDIPNTVESSMHVLARLGVDMVNVHAAGGVEMMVAAKRG
PYRF_LACLM      QVVYYVKSLG--HSVFLDLKLHDIPNTVESSMRVLARLGVDMVNVHAAGGVEMMVAAKRG
PYRF_STRPN      EIVSYLKGLG--HSVFLDLKLHDIPNTVKSAMKILSQLGVDMTNVHAAGGVEMMKAAREG
PYRF_STRP1      DIVRYIKSLG--HNVFLDLKLHDIPNTVRAAMAVLKELDIDMATVHAAGGVEMLKAAREG
PYRF_LACPL      SIVTDVQARG--HAVFLDLKLHDIPNTVESAMRVIGRLGVTYTTVHAAGGHVMLSAAKRG
PYRF_HELPY      VFLDEIRKIDENFKIFLDLKLYDIPYTMANAALECAKLDIDMLTVHLSSAKSALTALMQR
PYRF_HELPJ      TFLDEIRKIDGNFKIFLDLKLYDIPYTMANAALECAKLDIDMLTVHLSSAKSALTILMQR
PYRF_CAMJE      KFIEELKKVD-DFKIFLDLKFHDIPNTMADACEEVSKLGVDMINIHASAGKIAIQEVMTR
PYRF_AQUAE      DAVKELKEDF-PYEVFLDLKLHDIPSVVGLAVEKISELGTDYTTVHLLGGPEMVKEAVKN
PYRF_ECOLI      QFVRELQQRG--FDIFLDLKFHDIPNTAAHAVAAAADLGVWMVNVHASGGARMMTAAREA
PYRF_ECO57      QFVRELQQRG--FDIFLDLKFHDIPNTAAHAVAAAADLGVWMVNVHASGGARMMTAAREA
PYRF_SALTI      QLVRDLQQRG--FDVFLDLKFHDIPNTTARAVAAAADLGVWMVNVHASGGARMMAAARDA
PYRF_SALTY      QLVRDLQQRG--FDVFLDLKFHDIPNTTARAVAAAADLGVWMVNVHASGGARMMAAARDA
PYRF_YERPE      ELIRDLHQRG--FDVFLDLKFHDIPNTTARAVAAAAELGVWMVNVHASGGARMMSAAKEA
PYRF_VIBCH      DFVRELHKRG--FSVFLDLKFHDIPNTCSKAVKAAAELGVWMVNVHASGGERMMAASREI
PYRF_HAEIN      NFVKQLHQRN--FDVFLDLKYHDIPNTVARAVRSAADLGVWMVDLHASGGLRMMEDAKKI
PYRF_PASMU      KFVKALHDRN--FDVFLDLKFHDIPNTVARAVRSAADLGVWMVDLHASGGLRMMEEAKKI
PYRF_PSEAE      GIVETLRGKG--FEVFLDLKFHDIPNTTAMAVKAAAEMGVWMVNVHCSGGLRMMAACRET
PYRF_NEIMA      NLAESLINQG--FKLFLDLKYHDIPHTVAQACKVAADMGVWMVDMHASGGRRMMEAAAEA
PYRF_NEIMB      NLAESLINQG--FKLFLDLKYHDIPHTVAQACKVAADMGVWMVDMHASGGRRMMEAAAEA
PYRF_BUCAI      KFVKELHQLG--FNIFLDLKFHDIPNTVFNATKAAADLGIWMLSVHASGGKEMLISAKKA
PYRF_NOSS1      RILEVLKSRQ--KRIFLDLKFHDIPNTVAGACRAAAGYGVDLMTIHATSGRDALKAAKEA
PYRF_SYNY3      VILAELKDRG--KRIFLDLKFHDIPNTMLGACLSASRYEVDLLTLHATAGSQALTLAAQA
PYRF_RHIFH      EFARDLAASG--KKVFLDMKLLDIDNTVAKGVENIVRMGMSMLTLHAYPKAMKAAVDAAK
PYRF_RHIME      DFARDLAASG--KQVFLDMKLLDIDNTVAKGVENIVKMGVSMLTLHAYPKAMKSAVEAAR
PYRF_RHILO      DFARELASGG--TKIFLDMKLLDIDHTVAKGVENIVKMGMTMLTIHAYPKAMRAAVEAAR
PYRF_AGRFC      EFARDLVQSG--KKVFLDMKLLDIDNTVASGVENIARMGMSMLTLHAYPKAMRAAVKAAE
PYRF_BRUME      DFAKSLVAAR--KKVFLDMKLLDIDNTIAKGVENVAKMGVSMLTLHAYPKAMRAAVEAAR
PYRF_BRADU      PLVARLADKG--KKVFLDLKLHDIGNTVAQGVESITRLGATFLTVHAYPQTMKGAVEGRG
PYRF_CAUVC      GLAHDLKASG--KSIFLDWKLHDIGATVERSARVLATSGCDLLTVHAEPQVMQAAVKARG
PYRF_XYLFA      QVLDDLASCG--KRVFVDLKFFDIPATVAGVIRRLSQWPISYCTIHGWHAPMMQAATEAN
                     :        :*:* *  **  .                 :*              

PYRF_LISIN      LEIGS-TSGK-RPKLIAVTQLTSTSETDMQKEQLVKASLLESVLHYSDLTKQAGLDGVVC
PYRF_LISMO      LEIGS-PSGK-RPKIIAVTQLTSTSETDMQTEQLIKTSLLESVMHYSNLSKQAGLDGVVC
PYRF_BACSU      LEEGT-PAGKKRPSLIAVTQLTSTSEQIMKDELLIEKSLIDTVVHYSKQAEESGLDGVVC
PYRF_BACCL      LDAGT-PSGRMRPRCIAVTQLTSTDERMLHEELWISRPLAETVAHYAALAKESGLDGVVC
PYRF_BACHD      LEAGT-VDGRNRPKLIGVTQLTSTNEAMLQKELLIQSNMNGAVSHYARLAKEAGLDGVVS
PYRF_STAAM      LRKHN-QHTK----IIAVTQLTSTTEDMLRHEQNIQTSIEEAVLNYAKLANAAGLDGVVC
PYRF_LACLA      LEAGT-PVGRQRPKLIAVTQLTSTSEEIMQNDQKIMTSLEESVINYAQKTAQAGLDGVVC
PYRF_LACLM      LEAGT-PIGRQRPKLIAVTQLTSTSEEIMQNDQKIMTSLEESVINYAQKTAQAGLDGVVC
PYRF_STRPN      L--G------SQAKLIAVTQLTSTSEAQMQEFQNIQTSLQESVIHYAKKTAEAGLDGVVC
PYRF_STRP1      L--G------QGPTLIAVTQLTSTSEDQMRGDQNIQTSLLESVLHYSKGAAKAQLDGAVC
PYRF_LACPL      LVAGAMAAGVTAPKLLAITQLTSTNQAILNQDQQIMGTVRASVVHYAKLARASDCDGVIC
PYRF_HELPY      LN----ALKK-RPLIMGVSALTSFSEE--EFLMVYNAPLKTQAIKLSAMGKESGIDGVVC
PYRF_HELPJ      LN----ALKK-RPLIMGVSALTSFSEE--EFLMVYNAPLKTQAITLSAIGKESGIDGVVC
PYRF_CAMJE      LS----KFSK-RPLVLAVSALTSFDEE--NFFSIYRQKIEEAVINFSKISYENGLDGMVC
PYRF_AQUAE      KG----SMK-----ILGVTILTSHDENYIKFLKSNFEDIKNFTLYLARVGIENGVDGVVC
PYRF_ECOLI      LV----PFGKDAPLLIAVTVLTSMEASD-LVDLGMTLSPADYAERLAALTQKCGLDGVVC
PYRF_ECO57      LV----PFGKDAPLLIAVTVLTSMEASD-LADLGVTLSPADYAERLAALTQKCGLDGVVC
PYRF_SALTI      LA----PFSKDAPLLIAVTVLTSMGTSD-LHDLGVTLSPAEHAERLARLTQQCGLDGVVC
PYRF_SALTY      LA----PFSKDAPLLIAVTVLTSMETSD-LHDLGVTLSPAEHAERLARLTQQCGLDGVVC
PYRF_YERPE      LL----PYGAQAPLLIAVTVLTSMDGED-LRDIGITISPAEQAERLAKLTWDCGLDGVVC
PYRF_VIBCH      LE----PYGKERPLLIGVTVLTSMESAD-LQGIGILSAPQDHVLRLATLTKNAGLDGVVC
PYRF_HAEIN      LE----PYGKDAPLLIAVTVLTSMEDLD-LLQIGINASPMEQVLRLAHLTQRAGLDGVVC
PYRF_PASMU      LE----PYGKDAPLLISVTVLTSMEDLD-LLQIGINASPMEQVIRLANLTQRAGLDGVVC
PYRF_PSEAE      LE----AFSGPRPLLIGVTVLTSMERED-LAGIGLDIEPQEQVLRLAALAQKAGMDGLVC
PYRF_NEIMA      VA----GYGT-KPLLIGVTVLTSMEQSD-LAEIGLNTAPEEQVIRLAKLAQSSGLDGVVC
PYRF_NEIMB      VA----GYGT-KPLLIGVTVLTSMEQSD-LAEIGLNTAPEEQVIRLAKLAQSSGLDGVVC
PYRF_BUCAI      LK----SFKK-APLLIAVTALTSFKEEA-LKEIGINISLTEYILKLSKLSNDCGLDGIVC
PYRF_NOSS1      VEEGAAQAGVKPPKLIAVTVLTSISARQLALDLKIPSELPEYALDMALMAQEMGLDGAVC
PYRF_SYNY3      MAPLP-----HPPKLLAITLLTSIGDRQLREELQQPLAVDDYVNAMARLARNAGIDGAVC
PYRF_RHIFH      GS---------DLCLLGVTVLTSMDAQD-VIDAGYGSDPHTLVLRRAEQARAAGMGGIVC
PYRF_RHIME      GS---------NLCLLGVTVLTSMDEQD-VIDAGYEYDPHSLVLRRAEQARAAGMGGIVC
PYRF_RHILO      GS---------DLCLLAVSVLTSMDEQD-MIDVGYEYDPHTLVLRRSEQALHAGMGGIVC
PYRF_AGRFC      GS---------GLCLLGVTVLTSMDDSD-LVEAGYASDARSLVLRRAEQAREAGMGGIVC
PYRF_BRUME      GS---------DLCLLGVTVLTSMDNAD-LREAGYFDNAETLVLKRARQAHEAGMGGIVA
PYRF_BRADU      GS---------NLKILAVTVLTSYNEDD-LHAAGFRLGVAELVEARAQQAQVLGIDGLVS
PYRF_CAUVC      DS---------SLKILAVTVLTSLTDAD-LVEMGYAFTARDLVERRVRQALACGVDGIVS
PYRF_XYLFA      TS---------NMHLLAVTVLTSMTRAD-LAKMGIDREPVDVVIERALAAHMAGMSGVIA
                               :.:: ***                                .* :.

PYRF_LISIN      SALEADEIKLQNG----SDFLRVTPGIR-LASDATDDQIRVVTPEKARSIGSSNIVVGRS
PYRF_LISMO      SALEAEDIKQQNG----ADFLRVTPGIR-LASDTADDQIRVVTPEKARLIGSSNIVVGRS
PYRF_BACSU      SVHEAKAIYQAVS----PSFLTVTPGIR-MSEDAANDQVRVATPAIAREKGSSAIVVGRS
PYRF_BACCL      SANEAAFIKERCG----ASFLAVTPGIR-FADDAAHDQVRVVTPRKARALGSDYIVVGRS
PYRF_BACHD      SAQEVPIIHEHCG----PSFLTVTPGIR-LKEDDKGDQTRIVTPEEARTLGSWAIVVGRS
PYRF_STAAM      SPLESRMLTEKLG----TSFLKVTPGIR-PKGASQDDQHRITTPEEARQLGSTHIVVGRP
PYRF_LACLA      SAHEVEKIKAATS----KEFICLTPGIR-PEGASKGDQKRVMTPKEARTIGSDYIVVGRP
PYRF_LACLM      SAHEVEKIKAATS----KEFICLTPGIR-PEGASKGDQKRVMTPKEARTIGSDYIVVGRP
PYRF_STRPN      SAQEVQVIKQATN----PDFICLTPGIR-PAGVAVGDQKRVMTPADAYQIGSDYIVVGRP
PYRF_STRP1      SAQEVEAIKAVTP----TGFTCLTPGIR-PKGSNIGDQKRVMTPNQARRIGSDYIVVGRP
PYRF_LACPL      SAQEVQAIHTAVG----ADFLGITPGIR-PASAQSDDQQRVMTPAAAAKAGSNGLVIGRP
PYRF_HELPY      SVFESLAIKEALG----KDFLTLTPGIR-LDQNDKEDQERVANAKEAKQNLSDFIVVGRP
PYRF_HELPJ      SVFESLAIKEALG----KGFLTLTPGIR-LDKNDKEDQERVANAKEAKQNLSDFIVVGRP
PYRF_CAMJE      SVFESKKIKEHTS----SNFLTLTPGIR-PFGETNDDQKRVANLAMARENLSDYIVVGRP
PYRF_AQUAE      SGEEVEFLKKNIE----KDFIAVVPGIR-IKKEKRHDQKRVLTPAEAKKRGADVIVIGRE
PYRF_ECOLI      SAQEAVRFKQVFG----QEFKLVTPGIR-PQGSEAGDQRRIMTPEQALSAGVDYMVIGRP
PYRF_ECO57      SAQEAVRFKQVFG----QEFKLVTPGIR-PQGSEAGDQRRIMTPEQALAAGVDYMVIGRP
PYRF_SALTI      SAQEAVRFKQAFG----AAFKLVTPGIR-PAGSEAGDQRRIMTPEQALSAGVDYMVIGRP
PYRF_SALTY      SAQEAVRFKQAFG----AAFKLVTPGIR-PAGSEAGDQRRIMTPEQALSAGVDYMVIGRP
PYRF_YERPE      SAHEAVRLKQVCG----EDFSLVTPGIR-PQGSEAGDQRRIMTPEQAVAVGVDYMVIGRP
PYRF_VIBCH      SAQEASLLKQHLG----REFKLVTPGIR-PAGSEQGDQRRIMTPAQAIASGSDYLVIGRP
PYRF_HAEIN      SPQEVEILRNACG----EDFKLVTPGIR-PIGTDFGDQRRVMTPTAAIRAGSDYLVIGRP
PYRF_PASMU      SPQEVEILRANCG----KDFKLITPGIR-PIGSDFGDQRRVMTPAGAIQAGSDYLVIGRP
PYRF_PSEAE      SAQEAPALKAAH-----PGLQLVTPGIR-PAGSAQDDQRRILTPRQALDAGSDYLVIGRP
PYRF_NEIMA      SAQEAAPLRRELG----QDFVLVTPGIRLDVADNNDDQRRIMTPAEALAAGSTYLVMGRP
PYRF_NEIMB      SAQEAAPLRRELG----QDFVLVTPGIRLDVAGNNDDQRRIMTPAEALAAGSTYLVMGRP
PYRF_BUCAI      PGKEAKKIKFLFG----NKYKIITPGIR-IAKDLLYDQNNIITPKEAKEYKIDYIVIGRS
PYRF_NOSS1      SPQEVAHLRQICG----DDFVLVCPGVR-PTWAEAGDQKRSLTPSQAIQAGADYLVIGRP
PYRF_SYNY3      SPQEVAKLRQTCG----PEFLLVTPGVR-PLWSAPGDQQRVMIPAQAIAAGANYVVIGRP
PYRF_RHIFH      SAEEATAVRRIIG----AEMAVVTPGIR-PTGAEKGDQKRVMTPAEAIRAGSSHLVVARP
PYRF_RHIME      SAEEAAAVRKIIG----GDMALVTPGIR-PAGAEKGDQKRVMTPADALRAGSSHLVVGRP
PYRF_RHILO      SAAEAEAVRRIVG----PDMAVVTPGIR-PAGSDHGDQKRVVTPAQAIRNGASHLVVARP
PYRF_AGRFC      SAEESTAVREILG----PDLAVVTPGIR-PAGADLGDQKRVMTPYDAIKAGSSHLVVARP
PYRF_BRUME      SAVEAQAIRQAVG----PDMAIVTPGIR-PAGSEKGDQKRVMTPADALRAGASHLIVARP
PYRF_BRADU      SPEEVGALRKIVG----HQMSLVTPGIR-PAGSASGDQKRIMTPGRAITAGADYLVVGRP
PYRF_CAUVC      SPHEAALAREIANDAGQPEFLIVTPGVR-PEWSAKNDQARAATPADALRAGATHLVCGRP
PYRF_XYLFA      SGQEAAAIRRAVG----SGFSIVCPGIR-TNHVPHNDQQRTMSITAAFANGADAIVVGRP
                .  *                  : **:*        ** .      *       :: .* 

PYRF_LISIN      ITRANDPVAAYNQVLKEWNA----------------------------------------
PYRF_LISMO      ITRANDPVAAYNQVLKEWNA----------------------------------------
PYRF_BACSU      ITKAEDPVKAYKAVRLEWEGIKS-------------------------------------
PYRF_BACCL      LTRAADPLGAYARLQHEWNGGERESTTPT-------------------------------
PYRF_BACHD      ITAAPDPAAAYEIIRKQWEG----------------------------------------
PYRF_STAAM      ITQSDNPVESYHKIKESWLV----------------------------------------
PYRF_LACLA      ITQAKDPVASYHAIKAEWNR----------------------------------------
PYRF_LACLM      ITQAKDPVSAYHAIKEEWNQ----------------------------------------
PYRF_STRPN      ITQAEDPVAAYHAIKDEWTQDWN-------------------------------------
PYRF_STRP1      ITQAKDPVAAYQAIKAEWAG----------------------------------------
PYRF_LACPL      ITQAAEPVQAYRDIMTEWSN----------------------------------------
PYRF_HELPY      IYQAKEPREVVLELLKDC------------------------------------------
PYRF_HELPJ      IYQAKEPREVVLELLKDC------------------------------------------
PYRF_CAMJE      IYKNENPRAVCEKILNKIHRKNISENDIEQNYEVIQQKEWDMCNHFEEWIKTRPDKEHAL
PYRF_AQUAE      ITESKNPVYVVERALKMMGEI---------------------------------------
PYRF_ECOLI      VTQSVDPAQTLKAINASLQRSA--------------------------------------
PYRF_ECO57      VTQSVDPAQTLKAINASLQRSA--------------------------------------
PYRF_SALTI      VTQSVDPAQTLKDINASLKREA--------------------------------------
PYRF_SALTY      VTQSVDPAQTLKDINASLKREA--------------------------------------
PYRF_YERPE      ITQSPDPEKTLREILASLTKVA--------------------------------------
PYRF_VIBCH      ITQAAHPEVVLEEINSSLV-----------------------------------------
PYRF_HAEIN      ITQADNPAEVLRSINVSIG-----------------------------------------
PYRF_PASMU      ITQADNPAEVLKSINASLPVNR--------------------------------------
PYRF_PSEAE      ISQAADPAKALAAIVAELG-----------------------------------------
PYRF_NEIMA      VTQAADPVAVLREVNRVANLEAN-------------------------------------
PYRF_NEIMB      VTQAADPVAVLREVNRVANLEAN-------------------------------------
PYRF_BUCAI      ITMSKNPIKKLDLIIKSMQ-----------------------------------------
PYRF_NOSS1      ITAAAEPELAWKRISQELTTVV--------------------------------------
PYRF_SYNY3      ITADPSPEAAWERLCQDLAV----------------------------------------
PYRF_RHIFH      IVKAADPLSASRAILAEMEGVLSA------------------------------------
PYRF_RHIME      IVAAPDPLAASRAILAEMESALSR------------------------------------
PYRF_RHILO      IVAASDRRAAAQAILDEMRSA---------------------------------------
PYRF_AGRFC      IVRAEDPKAAARAILDDMLRASFPANQ---------------------------------
PYRF_BRUME      IVGAPDRKAAALAILKEMRSIGRS------------------------------------
PYRF_BRADU      VVEAAEPKAIADAIQAEIGQALGA------------------------------------
PYRF_CAUVC      ITAANDPREAALKVVTEMAGI---------------------------------------
PYRF_XYLFA      IRMAEDPQAAAEAMQTEIMTALTEPST---------------------------------
                :                                                           

PYRF_LISIN      -----------
PYRF_LISMO      -----------
PYRF_BACSU      -----------
PYRF_BACCL      -----------
PYRF_BACHD      -----------
PYRF_STAAM      -----------
PYRF_LACLA      -----------
PYRF_LACLM      -----------
PYRF_STRPN      -----------
PYRF_STRP1      -----------
PYRF_LACPL      -----------
PYRF_HELPY      -----------
PYRF_HELPJ      -----------
PYRF_CAMJE      KEFYAKCGIKY
PYRF_AQUAE      -----------
PYRF_ECOLI      -----------
PYRF_ECO57      -----------
PYRF_SALTI      -----------
PYRF_SALTY      -----------
PYRF_YERPE      -----------
PYRF_VIBCH      -----------
PYRF_HAEIN      -----------
PYRF_PASMU      -----------
PYRF_PSEAE      -----------
PYRF_NEIMA      -----------
PYRF_NEIMB      -----------
PYRF_BUCAI      -----------
PYRF_NOSS1      -----------
PYRF_SYNY3      -----------
PYRF_RHIFH      -----------
PYRF_RHIME      -----------
PYRF_RHILO      -----------
PYRF_AGRFC      -----------
PYRF_BRUME      -----------
PYRF_BRADU      -----------
PYRF_CAUVC      -----------
PYRF_XYLFA      -----------