CLUSTAL format seed alignment for MF_01201

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

ALR_SHEB9       ------------------------MNPFPRAEISSSALQTNLAAL-RQQAPASRVMAVVK
ALR_SHESM       ------------------------MKPFPRAEISSSALQNNLAVL-RQQASRSQVMAVVK
ALR_SHEPW       ------------------------MKPFPRAEISRKALKHNLARL-HELAPSSKVMAVVK
ALR1_ECOLI      -------------------------MQAATVVINRRALRHNLQRL-RELAPASKMVAVVK
ALR_CHRSD       ------------------------MSRPLIADIDLDALRRNYCLA-RDQAPHSRAIAVVK
ALR_XANC5       -------------------------MRPAQASIDLEALRHNYRLA-RRLG-GSKALAVVK
ALR_XANOR       -------------------------MRPAQASIDLEALRHNYRLA-KRLG-GSKALAVVK
ALR_XYLFA       -------------------------MRPAHAVIDLDALRHNYRFA-RRLG-GGKALAVVK
ALR_AROAE       -------------------------MRPARALIDLDALRHNYHLA-RSRH-GGRALAVVK
ALR_NEIG1       -------------------------MRPLNVQIRLGNLRHNYRIL-KEMH-GGKLLAVVK
ALR_CUPNH       ------------------------MPRPIHAVIHQPALANNLDII-RGKAPESRIWAVVK
ALR_RALSO       ------------------------MPRPIQAVIHGPALVNNLQVV-RRHAADSRVWAVIK
ALR_BURM7       ------------------------MPRPISATIHTAALANNLSVV-RRHAAQSKVWAIVK
ALR2_ECOLI      ------------------------MTRPIQASLDLQALKQNLSIV-RQAATHARVWSVVK
ALR_DELAS       ------------------------MPRPILATIHSAALRHNLERV-RQAVPDAKLWAVVK
ALR_JANMA       ------------------------MPRPLIATIDIAALRSNLALA-KARAPHSKAWAVVK
ALR_WIGBR       ------------------------MPRKTTIRISSNALASNLRTI-KNYANKSKVWSVIK
ALR_COXBR       -------------------------MNRATATINVTALKHNLSQI-KALAPKSLAWAMIK
ALR_MARHV       ------------------------MPRPTVARIDLDALKHNFRRA-RELAGTAYAMAVVK
ALR_MARMS       ------------------------MARPLTATVDLEAILQNYRYA-KKLQPTCKAFAVVK
ALR_DICNV       -------------------------MRALKKIINLNALRHNWALI-KQRSLPATPMVVLK
ALR_BRUME       ----MSLPFSQDE---------RDLAAGGILTIDLAALRHNYSAIATRIAP-TRTAAVVK
ALR2_RHILO      ----MNDAVNPTAAKTVTGWPVSEAAAGAILTIDLGAIRENYRRLKALLGG-VHCAGVVK
ALR3_SALTI      ---MMKLAEIQ--------------AACGVLCVDLAAVVDNYQTLARHVAP-AQCGAVLK
ALR_RHOSK       -------------------------MATATLTIDLDAIAANWRALDQMTASDCQTGAVVK
ALR_JANSC       -------------------------MATGTLTVDLGALVANYRTLDRLGPG--ATAAVVK
ALR_CAUVC       ------------------MTD----AQDTRITIDLDALAHNYAALRARAGD-AEVAPAVK
ALR_RHIME       ------------------MQSPEFLSASSRLTVDLTALADNWRAMNERSGK-ARAAAVLK
ALR_ACICJ       -------------------------MNHPTLTIDPGAVAANWQALAARH-T-GEVAGVVK
ALR_RICTY       -------------------------MSLCTLEINLSAIKNNYRLLQDICTT-ALVGAAVK
ALR_RICPR       -------------------------MSLCTLEINLSAIKNNYRLLQDICKT-ALVGAVVK
ALR3_RHILO      -------------------MLTSVRPADVVLEIDLSAIQANFQTISALVGPQVRVAAVVK
ALR1_RHILO      ------------------MMLSIVRSVDVVLEIDLAAIRANFQKISTLVGDKVKVAAVVK
ALR_DESVM       ---------------------MSIAYNKIAVRVRLGALRRNFETLRRMSPA---AMPVIK
ALR_LAWIP       -----------------------MYSSSVCIKIHLERLRYNLRILRSRYPN---VMPVIK
ALR_LACRD       --------------------MVNGRLRDTSLIVDLDALRHNIQEQKKVLPENSKILAVVK
ALR_LACF3       --------------------MVSARLRKTDLVVDLKALGANVQRQREQLAPGSRILAVVK
ALR_LACPL       -------------------MVVIGEHRHTQVTVDLQAIKTNISNEMAQKDELTELWAVVK
ALR_STRP8       --------------------MISSFHRPTVARVNLQAIKENVASVQKHIPLGVKTYAVVK
ALR_STRPZ       --------------------MISSFHRPTVARVNLQAIKENVASVQKHIPLGVKTYAVVK
ALR_STRP2       --------------------MKASPHRPTKALIHLGAIRQNIQQMGAHIPQGTLKLAVVK
ALR_LACLA       --------------------MKTSPHRNTSAIVDLKAIRNNIEKFKKHIHPNAEIWPAVK
ALR_LACDB       --------------------MITAVNRPAALHINLAAIKENTRQAKAHLKPGQKLFCVVK
ALR_GEOSE       ---------------------MNDFHRDTWAEVDLDAIYDNVENLRRLLPDDTHIMAVVK
ALR1_STAAN      --------------------MSDKYYRSAYMNVDLNAVASNFKVFST-LHPNKTVMAVVK
ALR1_STAA8      --------------------MSDKYYRSAYMNVDLNAVASNFKVFST-LHPNKTVMAVVK
ALR_STAEQ       --------------------MSEKFYRATYLNVNLDAILANYQNFNQ-LHANKTVISVIK
ALR_MACCJ       --------------------MSDRYYRPTFVNVNLDAISSNFKHIEK-LHPNKTVIAVIK
ALR_CLOPS       ---------------------MDICVRPVWAEIDLDIIANNMKEIRNLVGEK-EIIAVVK
ALR2_BACSU      ---------------------MIKLCREVWIEVNLDAVKKNLRAIRRHIPHKSKIMAVVK
ALR1_CALS4      --------------------MKFDGVRPTRVEVYLDAITHNFREIKKIVGKNVKIMAVIK
ALR_HELP2       -----------------------MLKRASFVEVNTASLRHNFSAVKSIVPKDAHIMAVVK
ALR_GEOBB       -----------------------MDSRPTVVEIDLAALRHNFSLVQKRVPEGCGLLAVVK
ALR_GEOSL       -----------------------MDSRPTIAEVDLAALRHNYDLVVRTIPRGCGILAVVK
ALR_SYNFM       -------------------------MAHSWVEIDLAALRHNYSRAKERLAPGSRILGVVK
ALR_TREPA       ----------MACNQ---------------ALIHLANLRHNLGEI--MSRTRARVCLPVK
ALR_CHLTE       ----------MSASHEQNSAAAPNGPNLSEALISLGNLRHNLACIRAITGPQCRVMGIVK
ALR_CUTAK       ----------MPRCPSP-----------SHAIIDLSAIAANLAVVRKRAGDR-KVLFAVK
ALR_COREF       -------------------------MNLLTTRIDLDAIAHNTRLLKNRVGAA-KLMAVVK
ALR_CORGL       -------------------------MNLLTTKIDLDAIAHNTRVLKQMAGPA-KLMAVVK
ALR_MYCA1       ---------------MAVTPISLTPGVLAEALVDLGAIEHNVRLLCEQARGA-QVMAVVK
ALR_CAMC5       ---------------------------MSEIRLNKKAYIHNLMQISNKAGGKERVMLVLK
ALR_CAMC1       ---------------------------MSEIHLNKAAYIHNLTKICDKAGGKENVIVVLK
ALR_CAMJE       ---------------------------MSLIKIDQKAYEYNLRHIAKKIGSFQRLICVFK
ALR_CAMJD       ---------------------------MSLIKIDQKAYEYNLRHIAKKIGSFQRLICVFK
ALR_NITSB       ---------------------------MAYVKLSEKALKHNLETVSKKAGGSDKIAAVLK
ALR_ARCB4       ---------------------------MAKILLSKENLFYNLDVISKKAGSKEKVAVVLK
ALR_FRATO       ---------------------------MNILKISKQTLRNNIKIIREYIGN-AKMCFPVK
ALR_FRATN       ---------------------------MNVLEISAQTLRNNIRIIKEYVGS-AKICFPVK
ALR_FRAP2       ---------------------------MNILKISKQTLTNNIKIIREYVGN-AKICFPVK
ALR2_STAA8      ------------------------------MTATWSVNKKIFLQNAITVKNNQPLMAVVK
ALR2_STAAM      ------------------------------MTATWSVNKKIFLQNAITVKNNQPLMAVVK
ALR_PROMA       ------------MATTSMPLNKIDPRQRAWVEVSPDAIKANTLAIRSLLDEQCLLMAVVK
ALR_PSYWF       -------------------------MRSASIILDSKALTHNLNCVIDTVPDTTKVLAMVK
ALR_DEIRA       ------------------------MLPRAVAHISAAALDHNLSALAQRSG--TRLLLPVK
ALR_LEPIC       ------------MQDINSGSSSMKDTYSSWIEISKRSLSNNLDNFRSILRPNSTLTAILK
ALR_AQUPY       -------------------------MRRAVLEILEERIIHNVKEIHRFSGK--RIIAVVK
ALR_FUSNN       --------------------------MRTWIEIDKENLKYNVLKLKEIANN-KEILGVVK
ALR_BORBZ       ------------------MYNNKTMGSNKTIIINLNNLEHNLNLIKNKIGE-KEIVATLK
ALR_COPPD       -------------------------MWNKWAEVSRMNLKNNVELIRQKLPD-LEPIAVVK
ALR2_CLOAB      MEKKTVYNITNSIAISEEEAVNCNIPEVNKAEINLSQLKRNFDIIQGFLKPNTKFMAVLK
                                                                          .*

ALR_SHEB9       ANGYGHGLLNVANCLVS--ADGF-GLARLDEALELRAGGVT--ARLLLLEGFFRATDLPL
ALR_SHESM       ANGYGHGLLNVANCLHT--ADGF-GLARLEEALELRAGGVK--ARLLLLEGFFRSTDLPL
ALR_SHEPW       ANGYGHGLLNVAQCLDN--ADGF-GLARLEEALALRTGGVT--AKLLLLEGFFRIGDLTT
ALR1_ECOLI      ANAYGHGLLETARTLPD--ADAF-GVARLEEALRLRAGGIT--KPVLLLEGFFDARDLPT
ALR_CHRSD       ADAYGHGAVACADALRDL-APAF-AVACLEEALTLREAGIT--QPIVLLEGFFDAAELSL
ALR_XANC5       ADAYGHGAVRCAQALEPE-ADGF-AVACIEEALELRQAGIR--APILLLEGFFEHDELRL
ALR_XANOR       ADAYGHGAVPCAQALEPE-ADGF-AVACIEEALELRQAGIR--APILLLEGFFEHDELRL
ALR_XYLFA       ADAYGHGAVRCAQALEAE-VDGF-AVACIEEALELRQAGIQ--APILLLEGFFEAEELEL
ALR_AROAE       ANAYGHGAAQCARALAAD-ADGF-AVGFLEEALELRAAGID--QPILLLEGVFAPAELDE
ALR_NEIG1       ADAYGHGAVRCAFALADL-ADGF-AVATIDEGIRLRESGIT--HPIVLLEGVFEASEYEA
ALR_CUPNH       ANAYGHGIRRVFAALRG--ADGF-GLLDLNEAVLLRDLGWQ--GPILLLEGFFQPQDVAV
ALR_RALSO       ANAYGHGIERAYEGLRQ--ADGF-GLLDLDEAVRLRQLGWQ--GPILLLEGFFKPEDLAL
ALR_BURM7       ANAYGHGLARVFPGLRG--TDGF-GLLDLDEAVKLRELGWA--GPILLLEGFFRSTDIDV
ALR2_ECOLI      ANAYGHGIERIWSAIGA--TDGF-ALLNLEEAITLRERGWK--GPILMLEGFFHAQDLEI
ALR_DELAS       ANAYGHGIENVFEALRG--ADGF-AMLDLAEAERVRQLGWR--GPILLLEGVFEPRDLEL
ALR_JANMA       ANAYGHGLERGMRGFAA--ADGL-GLIELDAAARLRELGWN--KRILLLEGFFDASDTKL
ALR_WIGBR       SNAYGHTIKAALKGLKE--TSGF-AVLELNEAVLLRENGWN--GPILLLEGFFEESDLLE
ALR_COXBR       SNGYGHGLVRVAKALSD--ANAF-GVACIDEALTLREVGIK--SPIIVMKGFYNEAELSQ
ALR_MARHV       ADGYGHGIRSVADALAPE-TSRF-AVACIEEAIAIRGAGHR--HSVVLLQGTHQKDDLAE
ALR_MARMS       SNAYGHGAVEVSRYLDKE-VDAF-AVAAIEEAIALREAGIV--SPILLLEGVFEGEEWAL
ALR_DICNV       ADAYGHGMTTVAKTLDD--ARYF-AVSCIEEAIALRHLGID--TPVVLLEGVYRADELLL
ALR_BRUME       ADAYGLGASRVAPAFYEAGCRDF-FVAHLGEAVALKPFLKP-DATLYVLNGLQ-PGTEAA
ALR2_RHILO      ANGYGLGAAKVAAALTREGCDIF-FVALLAEGIALRKAVGT-GPDIYVLNGLP-PGSEPE
ALR3_SALTI      ANGYGLGAEAIAPALYAANCRIF-FVAQLSEGVALRNILSA-DAMVVLLNGVM-PQAMPF
ALR_RHOSK       ADSYGLGAAKVAHALARAGARRF-FVATCEEGADVRRALGS-GPQICVFSGHM-EGDTAL
ALR_JANSC       ADGYGLGAGLVSTGLAKAGACQF-FVATAEEGVGLRQVLGP-APEINVFAGHM-AGDTPL
ALR_CAUVC       ADAYGLGAAPVADRLWAEGARSF-YVARLAEGVALRRSLGDREATIYVLDGAT-PGSGEA
ALR_RHIME       ADAYGLGVVHAAPALYAAGARDF-FVASVEEGADLRPLVPD--GRIYILAGMW-PGNEEL
ALR_ACICJ       ADAYGLGAALIAPALAAAGCRSF-FVATLDEALSLRALLPA--ARIGVLNGCP-PGEEGT
ALR_RICTY       ANGYGIGAMQIAKALIEENCQYF-FVATSEEGINLRKALNN-DITILVLNGVF-THDALE
ALR_RICPR       ANGYGLGAMQIAKALIKENCQYF-FVATSEEGINLRKVLNN-DITILVLNGVF-THDALE
ALR3_RHILO      SDAYGLGLVKVAGALIDAGCDLL-FVGNLHEALLLRSSHIS--AAVAVFCDEF-ARYGEH
ALR1_RHILO      SDAYGLGLVDIARTLIDAGCDLL-FVANLDEALLLRSSFSR--VAIAVFRDEF-DRFGTW
ALR_DESVM       SDAYGHGLLPVARTLEAAGADAF-AAGTVGECAQLRDGGIP-GRIVALLGATD-AADAEC
ALR_LAWIP       ANAYGHGIRVVANVLRDEGVQHM-AVGSITEGFLLRQEGHQ-AFLLALLGPFS-EEDARI
ALR_LACRD       ANAYGNGLIPVAQTAMTSGASGL-CVAILDEALELRDNGIEAM---TLVLGITSVEDALI
ALR_LACF3       ANAYGNGMVPVASALARAGVEGF-CVALLDEAIELRDSGIQEL---VLVLGITPVEYAPL
ALR_LACPL       ANGYGHGIIQVAQAAKEAGATGF-CVAILDEALALRAAGFAEP---ILVLGITEPEYAPL
ALR_STRP8       ADAYGHGAVQVSKALLPQ-VDGY-CVSNLDEALQLRQAGIDKE---ILILGVLLPNELKL
ALR_STRPZ       ADAYGHGAVQVSKALLPQ-VDGY-CVSNLDEALQLRQAGIDKE---ILILGVLLPNELEL
ALR_STRP2       ANAYGHGAVAVAKAIQDD-VDGF-CVSNIDEAIELRQAGLSKP---ILILGVSEIEAVAL
ALR_LACLA       ADAYGHGSVEVSKAVSDL-VGGF-CVSNLDEAIELRNHLVTKP---ILVLSGIVPEDVDI
ALR_LACDB       ANAYGHGAARLAPVMEEAGADGF-CVAMLDEGLELRRAQIVKP---ILVLGLQPAEESAL
ALR_GEOSE       ANAYGHGDVQVARTALEAGASRL-AVAFLDEALALREKGIEAP---ILVLGASRPADAAL
ALR1_STAAN      ANAYGLGSVKVARHLMENGATFF-AVATLDEAIELRMHGITAK---ILVLGVLPAKDIDK
ALR1_STAA8      ANAYGLGSVKVARHLMENGATFF-AVATLDEAIELRMHGITAK---ILVLGVLPAKDIDK
ALR_STAEQ       ANGYGLGSVKIAQHLMRHGATFF-AVATLDEAIELRMHGVDAK---LLVLGVVPTEDIEK
ALR_MACCJ       ANGYGLGSVNIAKHLMTSGTDFF-AVATLDEAIELRMHGIKAK---ILVLGVVDPKHIRQ
ALR_CLOPS       ANAYGHGALDIASTLLENGASRL-AVAIITEADELRDAGITAP---IMILGYTPINFAEN
ALR2_BACSU      ANGYGHGSIEVARHALEHGASEL-AVASVEEGIVLRKAGITAP---ILVLGFTSLSCVKK
ALR1_CALS4      GDAYGHGASYVAKFLEKEGVDYF-GVATTEEALELREKGIKTP---ILIFGYTPPTQLRQ
ALR_HELP2       ANAYGAGAIKASEIFLQEGANYL-GVAALDEALELRSHFPKTP---ILILGYSPNANASM
ALR_GEOBB       ADAYGHGFQYVSEELEKLGVDAF-AVAFLAEGVQLRMSGITRP---VLILGGIYPGEERR
ALR_GEOSL       ADAYGHGFMDIARELETLGVTAF-GVAFLAEGIQLRKSGIDRP---VLILGGVYPGQERK
ALR_SYNFM       SDAYGHGMIPVARELVACGASFL-AVSKHWEAVDLRAAGIRLP---ILCLLGVEPSEMAE
ALR_TREPA       ADAYGHGACDVAQAALSCGVHSF-AVACVQEASQLRAAGVRAP---ILCLSTPTAEEISS
ALR_CHLTE       ANAYGHGATQVTATLEAEGVRDF-GVANIYEAIELLQEHRMLPDSRILAFASPLAGHIDL
ALR_CUTAK       ADAYGHGAVEVSRYVEKHRYADWLAVATVAEGQELVEAGITLP---ILKLSPADPWDMDA
ALR_COREF       ADGYNHGMDRVAPVMAANGADAF-GVATIAEALALRATGITTP---ILCWIWSPEQDWAA
ALR_CORGL       ANAYNHGVEKVAPVIAAHGADAF-GVATLAEAMQLRDIGISQE---VLCWIWTPEQDFRA
ALR_MYCA1       ADGYGHGAVQTARAALAAGAAEL-GVATVDEALALRAAGISAP---VLAWLHPPGIDFRP
ALR_CAMC5       DNAYGHGAKLIAAAASEFGIKFC-AVKSQSEALEIQR---------NFEKILILSHIANG
ALR_CAMC1       DNAYGHGARLIASEAKKFGIKNC-AVKSECEANEIAD---------IFENILILSHVPTG
ALR_CAMJE       DNAYGHGAKLLAPLAKNLGVSFV-AVKSEEEAREIEE---------FFENILILSHRPHG
ALR_CAMJD       DNAYGHGAKLLAPLAKNLGVSFV-AVKSEEEAREIEE---------FFENILILSHRPHG
ALR_NITSB       DNAYGHGIEGFAKKISRLGIKKA-VVRTYEEALKIAD---------FFPYILILSDTPRH
ALR_ARCB4       DNAYGHGLVEIATLAKEFGIKKA-VVRTIDDALKIEK---------LFDFILVLAEKSFH
ALR_FRATO       ANAYGHGIEDIVENTHD--LVDFFAVANSLEAFRVTAVAKN----PVLVFGVIYYEYIEK
ALR_FRATN       ANAYGHGLELIVEHSHD--LVDFFAVANVLEAFRVLDVVEK----PVMIFGVIEYNYIDR
ALR_FRAP2       ANAYGHGIEEIVENTHD--LVDFFAVANSLEAFRVTAITKK----PVLVFGVIYYEYLER
ALR2_STAA8      NNAYHYDLEFAVTQFIHAGIDTF-STTSLREAIQIRQLAPD-----ATIFLMNAVYEFDL
ALR2_STAAM      NNAYHYDLEFAVTQFIHAGIDTF-STTSLREAIQIRQLAPD-----ATIFLMNAVYEFDL
ALR_PROMA       ADGYGHGSETVAEAALAGGATNL-GVATLQEALELRKAGIV--CPILVLGNLINPEDLDA
ALR_PSYWF       ADAYGHGIAHCLPALKDADGLGV---ACFTEAQHIRELGWD--KILVLIEGVFSETEWQQ
ALR_DEIRA       ADAYGHGMELVGRLAAAHPDVWGLAVATPQEAETLARLDLG---KPLLLLTPPAPEELGA
ALR_LEPIC       SNAYGHGIEPMTRLCIEAGISRI-GVNSIEEALLIRNIDSK--IPILIMGEIQNPEKRKN
ALR_AQUPY       ANAYGIGVREVSRILEGLEEVDAFAVACTQEGVELRECGIK---KKILILGGILEEDVKL
ALR_FUSNN       ANAYGLGSIEIAKILKEVEVKLF-GVANLEEAIELQEAGIK---DKILILGASFEDELVE
ALR_BORBZ       GDAYGHGLINIFKFLKSKNINYF-GLSNIEDAKTLKKIDKN---IKILMYIKVDKKEIKN
ALR_COPPD       DDAYGHDAAVVVPELLKNGITKF-AVVYAKDALMLSEFGAE---WILVLDDPPLSNMCSE
ALR2_CLOAB      GDAYGHGIRPIAKELINLKCDVF-GVVRLIEAFTLRKAGIK---TPIMLLAPISPSQAAW
                 :.*                              :                         

ALR_SHEB9       LVGHDIDTVVHHSSQLEMLEQTVLSKP-----VTVWLKVDSGMHRLGFTPEQFSTVYDRL
ALR_SHESM       LVAHDIDTVVHHESQIEMLEQATLSKP-----VTVWLKVDSGMHRLGVTPEQFAQVYARL
ALR_SHEPW       LVEHDIETVVHHESQLEMLESINLTKP-----VTVWLKVDSGMHRLGFSPAQFDATYQRL
ALR1_ECOLI      ISAQHFHTAVHNEEQLAALEEASLDEP-----VTVWMKLDTGMHRLGVRPEQAEAFYHRL
ALR_CHRSD       IDAHRLWTAVHSDWQIDALLAYRPRQP-----IPTWLKLDSGMHRLGFAPEAFEARWQRL
ALR_XANC5       IAEHDLWTVAATQQQVRALAEFQSPRP-----LRVWLKMDSGMHRLGLSPEDFRAAWLRL
ALR_XANOR       IAEHDLWTVAATPQQVRALAAFQSPRP-----LRVWLKMDSGMHRLGLSPEDFRAAWLRL
ALR_XYLFA       IAKHNLWTVIASSWQVRALAAFHSPSP-----IGVWLKLDSGMHRLGLEPKEFRDAWMSL
ALR_AROAE       VVRHDLWIVVHHAEQLRIIDHARPALP-----LEVWLKMNSGMNRAGFLSHELRPAWQRL
ALR_NEIG1       VEQYSLWPAVGNQWQLEALLSRHWKKP-----VKVWLKMDSGMHRTGFFPHDYTSAYAAL
ALR_CUPNH       IEQYRLTTAIHCDEQLRMLESARAKGP-----LAIQLKLNTGMNRLGFHPAAYRTAWERA
ALR_RALSO       VEQYRLTTTVHCEEQLRMLELARLKGP-----VSIQLKINTGMSRLGFAPAAYRAAWEHA
ALR_BURM7       IDRYSLTTAVHNDEQMRMLETARLSKP-----VNVQLKMNSGMNRLGYTPEKYRAAWERA
ALR2_ECOLI      YDQHRLTTCVHSNWQLKALQNARLKAP-----LDIYLKVNSGMNRLGFQPDRVLTVWQQL
ALR_DELAS       CSRLSIWHAVHCDAQIDWLAAHKTQNG-----HRVFLKMNSGMNRLGFTPERYRAAWARL
ALR_JANMA       LAEHRLDTVIHCEEQLLMLEQAKLRTQ-----IDVHLKLNSGMNRLGFTPARYRAAYERL
ALR_WIGBR       ICQYKITTVIHNDWQLNYIKQYDIKSP-----IDVYLKLNSGMNRLGFNEKDFIRTWYDL
ALR_COXBR       FARHRLGAVIHCSDQVSLLEKTNLTSS-----LSVWLKIDTGMNRLGFSVEQSPAVYNQL
ALR_MARHV       CERSGFEPVLHCQQQLSWLGAGRS--------PRFWIKVNTGMNRLGFRPEELPEVMAGL
ALR_MARMS       CEKHGFWSALENAQQLDELQASHAKI------EKVFLKLDSGMHRLGVDKETAPVFVSAL
ALR_DICNV       CEYYQFDTLVHNFRQMQWLKEFNGS-------VKAWLKVDSGMHRLGFTQDEIAEAFAQA
ALR_BRUME       CAREGILPVLNSLEQVENWAALATRLG---KKLPALLQFDTGMSRLGLSAKE-FDRLLEN
ALR2_RHILO      AVAAGLCAVINSGAQLKAWRAAVHDAG---RRLPAAIQVDSGMSRLGMAPAE-VEALAGD
ALR3_SALTI      CCAQQITPLLNSVDQVMTWLALQEARS---QRRPVLIQLDSGMSRLGVTPEQ-LARLAAI
ALR_RHOSK       IRDFDLTPMLNSIDQLTRHFEALGGQ-------PFGLQLDSGMNRLGLEPGE-WEAVAG-
ALR_JANSC       IRDAHLTPMLNSPKQVQRHRHVLPGH-------PYGIQLDTGMHRLGVQPAD-WPALRD-
ALR_CAUVC       LEGAQLVPVLNSLPQVEAWNVQARS-----GRLRAALHIDTGMNRLGLRPEE-LKVLVGS
ALR_RHIME       FFENDLVPIINSEEQLAVFMAALSER----GDHPCVLHVDTGMNRLGLSPEE-ALALAHD
ALR_ACICJ       MRARELRPVLGSLAACARWRGAAGDD----KAPPSFLHLDTGMNRLGLDRDE-AAHLIAH
ALR_RICTY       LIQYNLTPVLNNLKQIEIWQKFSNLKE---KILPCYLHFNTGLNRFGLNYDE-IEQLIND
ALR_RICPR       LIQYNLTPVLNNLSQIEIWQKFSNLKG---KILPCYLHFNTGLNRFGLNSDE-IEQLIND
ALR3_RHILO      YRSNGLIPVVNNSVELDAICGAREPQ-------AYFLNVETGLSRLGLAFDD-VRRRYL-
ALR1_RHILO      YRSHGLIPVVNNCKELHAVGTAGEPQ-------SYFLNVETGFSRFGLSVGD-IQREYL-
ALR_DESVM       CVARSIVPAVYSADQLEMLAGRAAP----GQQVDIALKFDTGMARLGFSEAD-LPALLDR
ALR_LAWIP       AVVHNITPVIHNIESLQSIVHYSRVHQG-GTAVPVAIKIDTGMGRLGFSSND-YISLIDL
ALR_LACRD       AAQAGVSLTVGSLDWLEQYHQLAQVAK-PKKPLKVHLGIDSGMGRIGFTEVAAFKQAVKL
ALR_LACF3       AAAQGISLTVGSLEWLKNYQRLAKEEG-IKQPLKVHLALDTGMGRIGFTTPEDFKEALQL
ALR_LACPL       VAEKDISLAVGTQDWLTTAAAILAANQ-VTTPLHVHLALDTGMGRIGFQTPEELATAVTT
ALR_STRP8       AITRQVTVTVASLEWLAMAKQEWPD----LKGLKVHIKIDSGMGRIGLRSVTEVDNLIAG
ALR_STRPZ       AVANAITVTIASLDWIALARLEKKE----CQGLKVHVKVDSGMGRIGLRSSKEVNLLIDS
ALR_STRP2       AKEYDFTLTVAGLEWIQALLDKEVD----LTGLTVHLKIDSGMGRIGFREASEVEQAQDL
ALR_LACLA       AAALNISLTAPSLEWLKLVVQEEAE----LSDLKIHIGVDSGMGRIGIRDVEEANQMIEL
ALR_LACDB       AAANDISLPVSSLDWLKKAEKVLRKE---GLQLKIHLAIDSGMGRIGFSEDEDFKAVNEY
ALR_GEOSE       AAQQRIALTVFRSDWLEEASALYSG----PFPIHFHLKMDTGMGRLGVKDEEETKRIVAL
ALR1_STAAN      AIQHRVALTVPSKQWLKEAIKNISGEQ--EKKLWLHIKLDTGMGRLGIKDTNTYQEVIEI
ALR1_STAA8      AIQHRVALTVPSKQWLKEAIKNISGEQ--EKKLWLHIKLDTGMGRLGIKDTKTYQEVIEI
ALR_STAEQ       AIQHRVALTVPSKAWLKETIKQIPDDN--QKNLWLHVKLDTGMGRIGMKDIDEYKEVVDL
ALR_MACCJ       ASRHRLALTAPDAKWVEDASRYIEAE---DKPVWLHIKVDSGMGRIGVQTKQAYDMVVDK
ALR_CLOPS       LINNEIEQTVYDVEYAKELSDFALK---LGKKAKIHIAIDTGMGRIGFLPNEEGLNKVLE
ALR2_BACSU      SAAWNITLSAFQVDWMKEANEILEKEA-SANRLAIHINVDTGMGRLGVRTKEELLEVVKA
ALR1_CALS4      IVKHDLTQTVYDIKYAKELEKESLK---QNKRAKVHIKIDTGLGRIGYIDFDLAQKEILE
ALR_HELP2       LIDNDLSAMVFSLEQAEVFSQMALK---SQKRLKVHLKIDTGMHRLGLEPNFKSIETIKK
ALR_GEOBB       CIGLNISTALFSLEQAAALDQAALEIK-CYRKAHIHLKVDTGMGRLGVPYHEVPEFLAKL
ALR_GEOSL       CVGFNLSTALFSLEQARVLDDAAGRL---YRRARVHAKIDTGMGRLGIPHEEASAFFSAL
ALR_SYNFM       AIRNEIRPVIYRIDHARRLSDTARSL---NATATVHVKLDTGMGRLGIPCRHLEAFLNEL
ALR_TREPA       LIEHRVHTVISERAHIALIARALRQSADTGATCGVHVKIDTGMGRIGCAPDEACALVQMV
ALR_CHLTE       YLQHGVEMTVCDHETA---RAAESIAAACGRRLQVQLKVDTGMGRLGVTPEEAAELLELI
ALR_CUTAK       AITSGIRLTVVDFDTL---EAVSKAAVRLGITAKIHIAVDSGMGRIGLRPECLAELTAAA
ALR_COREF       AVEAGIDLAVISPRHA---RVLVDAP-PTSRAIRVSVKVDTALHRSGVDEQDWDAVFTLL
ALR_CORGL       AIDRNIDLAVISPAHA---KALIET---DAEHIRVSIKIDSGLHRSGVDEQEWEGVFSAL
ALR_MYCA1       ALLAGVQIGLSSQRQL---DELLTAVRDTGRTATVTVKVDTGLNRNGVPPAQYPSMLTAL
ALR_CAMC5       DEDQNFIYAINDMKGLNRIKRGTR----------IHLVIDTNMHRNGLKFSELEAAFGPI
ALR_CAMC1       DESAKFTYAINDIDALLKIKENTK----------INLAIDTGMHRNGLDISELDYAFEIL
ALR_CAMJE       NENSRFIYALNDISQVKNYKQDIK----------IHLKIDTGMHRNGICVENLEHAINLI
ALR_CAMJD       NENSRFIYALNDISQVKNYKQDIK----------IHLKIDTGMHRNGICVENLEHAIDLI
ALR_NITSB       ---DSFHYAINDLDTLQVLEPGTK----------VHLKIDTGMHRNGIALEEIEKAFELL
ALR_ARCB4       TYSHTFHIALNSLEDIDKLPNNSN----------VHIKVDTGMHRNGIYPEDLEKAFLGL
ALR_FRATO       MISENIRVSIQDYEYIEKLEQIAKELD---KKVYAHININTGMNRMGVDYNDACRTIQRA
ALR_FRATN       ILSKNIRVSIQDYNDIEKLEKFAKYYN---KKPFVHVNLNTGMNRMGVDYNDACRTIQRA
ALR_FRAP2       MVSENIRVSIQDYDDIEKLEQIAKELN---KKIYVHINVNTGMNRMGVCYNDVCRTIKRA
ALR2_STAA8      VREHQIHMTLPSLTYYYNHKNDLAGIH-------VHLEFENLLHRSGFKDLNEIKEVLKD
ALR2_STAAM      VREHQIHMTLPSLTYYYNHKNDLAGIH-------VHLEFENLLHRSGFKDLNEIKEVLKD
ALR_PROMA       CIHWDLMPTLSSAREALLCNQIAESHD---KEFCVHIKVDTGMTRLGCDLRLASELIQLV
ALR_PSYWF       SIEAQCQSIIHHQDQVQWALNHLPPEN--SPCRTVWLKLNTGMNRLGFESDELGDVAQSL
ALR_DEIRA       LADLGVRLPVSTLAEVEALPAHAQA----------HLKVDTGMNRLGARPADAVAVGRAL
ALR_LEPIC       VLSDPNFWIVFSRPETARILSSFLPAP------KLHLKIDTGMGRLGSHGETLKQTLSEL
ALR_AQUPY       LEEYDLTPVISDPEHLKVLKDRNIK---------FHVKYDTGMGRLGFTNEIIKDPRVE-
ALR_FUSNN       ATKRGVHVAISSMGQLQFLVSKNLNPN-------IHLKFDTGMTRLGFEVDDAEKVIEYC
ALR_BORBZ       LIKFELVPFVSDFEYLFLIEKECALQK---NKIKVHLKIDIGMNRYGIKIDDALEIATYI
ALR_COPPD       YEKRGIRFCITDSKWLSDGLLELPIKF--------HLFVDVGMHREGVPWYETNTIREIC
ALR2_CLOAB      VIRYNIIPMVDSEEIVEALDQSASQND---TIVKLHVKINTGLNRYGVNPENAVKFIREI
                                                       :  : * *             

ALR_SHEB9       MACSN---VAKPIHLMTHFACADEPDNTY---TSVQM-----AAFNTLTAGLPG-FRTLA
ALR_SHESM       TACDN---VAKPIHLMTHFACADEPENHY---TQVQM-----QTFNQLTADLPG-FRTLA
ALR_SHEPW       MANDN---VAKPIHLMTHFACADEPSNPS---TAEQQ-----RVFDTLIKGLPG-DRTLA
ALR1_ECOLI      TQCKN---VRQPVNIVSHFARADEPKCGA---TEKQL-----AIFNTFCEGKPG-QRSIA
ALR_CHRSD       AAATE---HVTDLHLMTHFATADALDAAY---FRRQM-----ACIASLRQRLEA-PVCLA
ALR_XANC5       RGLPQ----IASLVLMTHLARADELDCSR---TDEQA-----VAFALTAGGMRA-ETSLR
ALR_XANOR       RGLPQ----IASLVLMTHLARADELDCSR---TDEQA-----VAFALTAGGMRA-ETSLR
ALR_XYLFA       HRLPQ----VGEIVLMTHLARADELDNPR---TNEQA-----SVFAQASQGMVA-PASVC
ALR_AROAE       KDSGK----VGGITLMTHFARADEPQVLA---TTEQL-----TAFDTATRELPG-PRSLA
ALR_NEIG1       KQSEY----VDSIVKFSHFSCADEPESGM---TEIQM-----EAFDLGTKGLEG-EESLA
ALR_CUPNH       RAMPC----VGSIVHMTHFSDADSARG-----VAHQI-----EAFDAATANLPG-EASLS
ALR_RALSO       RAISG----IGTIVHMTHFSDADGPRG-----IDHQL-----AAFEQATQGLPG-EASLS
ALR_BURM7       RACPG----IGQITLMTHFSDADGERG-----VAEQM-----ATFERGAQGIAG-ARSFA
ALR2_ECOLI      RAMAN----VGEMTLMSHFAEAEHPDG-----ISGAM-----ARIEQAAEGLEC-RRSLS
ALR_DELAS       NALPQ----VEEISFMTHFSDADAGAGQP--GISAQL-----QRFHDATRDLPG-ERSVG
ALR_JANMA       RAIPA----VRHISFVTHFANAEDPDNPVL-PVQEQV-----RRFKEATRDLPG-EKSLA
ALR_WIGBR       SNLKK----ISSLTLMSHFSLGFSTKT-----VNKQM-----NIIRKIFKILNP-TLCLA
ALR_COXBR       KTSSS---IQKPIGLMTHLADADNENKTF---TELQI-----KRFFSVTEKMIG-PKSIV
ALR_MARHV       EEAGL---KHLAIGFVTHFACADDSDSEM---TGLQT-----RIFERAVAPWPDLMRSVG
ALR_MARMS       KDSG----QVGEVVLMTHFSCADDLSDLT---TMQQL-----AYFEQARQSIGEIEASVA
ALR_DICNV       HSLPV---NIQWQGVITHFACSDEDDLTH---AKKQL-----ACMDRLVLPAHW-KRCYA
ALR_BRUME       VTLLS---RIDIKFAISHLANGDEPGNAV---NARQL-----AKMTALLARLPKLPAALA
ALR2_RHILO      SSAFD---GIDIKYVMSHLACADEPRHPA---NEQQR-----LAFERLRAMLPRAPASLA
ALR3_SALTI      FRQRG---WAAPDYIISHLANADRPDHAL---NVYQH-----TLLQQAKKAFPTSRYSLA
ALR_RHOSK       --FAL---EAGPELLMSHLACSDDPDHPM---NAEQL-----GAFRAMTDGT-GVPRSLS
ALR_JANSC       --QLH---DA--TLLMSHLACADAPDHPQ---NAAQL-----AQFRALTDGI-QTPRSLA
ALR_CAUVC       FDRLK---RLDVELVVSHLACADTPEHPL---NATQL-----ARFQEAAALLPGVRRSLA
ALR_RHIME       PARPA---SFSPVLVMSHLACADDPGHPM---NRYQL-----QRFREVTAAFEGVPASLA
ALR_ACICJ       PTLLD---GLGLTHVMTHLVAAEEPDASA---NAAQR-----ERFAAFAARFPWLRTSLA
ALR_RICTY       RDLLK---GLDLQYIISHLAASEEMDNPY---NLAQL-----NRFKDYLEYFPNVKASLA
ALR_RICPR       RDLLK---GLDLQYIISHLAASEETGNPY---NLIQL-----NRFKVYLEYFPNVKASFA
ALR3_RHILO      GGIFK---RRPPSVVLSHLACSERAGDAM---NLLQW-----NRFRATSDLLKPTLLSLA
ALR1_RHILO      LRTFE---RYRPSIVLSHLACGECISDPM---NQLQR-----DRFRTVYDLLKPTRGSLS
ALR_DESVM       LHARP---MLRPVLVMSHLAVSDDPSRSD---FTRQQGEAFGRILAGVRADWPAAQGSLA
ALR_LAWIP       LRHTP---EVNPILLLSHLVAPEISSLDN---VTHNQVEQFARAYKAIKEAFPTIKTSLT
ALR_LACRD       LDSPE----FEFEGMFTHFATADSPDEN---YFNQQVQRWHQFVASLA---ELPPYVHMA
ALR_LACF3       VAAPC----FEFEGIFTHFATADEEDAT---YFERQRARFDDFMAVVT---KRPPFVHVA
ALR_LACPL       LRQPQ--SPFDFEGIFTHFATADQADDT---YFTHQLNNWKHLIAVVD---ELPRYVHVS
ALR_STRP8       LKSMG----ADVEGIFTHFATADEADDT---KFNQQLQFFKKLIAGLE---DKPRLVHAS
ALR_STRPZ       LKELG----ADVEGIFTHFATADEADDT---KFNQQLQFFKKLIAGLE---DKPRLVHAS
ALR_STRP2       LQQHG----VCVEGIFTHFATADEESDD---YFNAQLERFKTILASMK---EVPELVHAS
ALR_LACLA       ADKYA----INFEGIFTHFATADMADDT---KFKDQQARFNKIMAGLS---RKPKFVHST
ALR_LACDB       LQGND---AFFVEGMFTHFASADSADAS---YFDYQVKRFKHMESLLT---VKPKWIHVD
ALR_GEOSE       IERHP---HFVLEGLYTHFATADEVNTD---YFSYQYTRFLHMLEWLP---SRPPLVHCA
ALR1_STAAN      IQQYE---QLVFEGVFTHFACADEPGD----MTTEQYQRFKDMVNEA----IKPEYIHCQ
ALR1_STAA8      IQQYE---QLVFEGVFTHFACADEPGD----MTTEQYQRFKDMVNEA----IKPEYIHCQ
ALR_STAEQ       INKRD---HLVFEGVFTHFASADEPGS----SMNEQYTLFKEMVNQV----EKPIYIHCQ
ALR_MACCJ       VAAVE---QFIFEGVFTHFSSADEDNA----LTERAYDKFLGIIND-----NKPQYIHCQ
ALR_CLOPS       ICSLP---GVEVVGLFTHFSTSDEKDKT---YTYEQFSKLTNFNKALEDNGIHIPLKHAS
ALR2_BACSU      LKASK---FLRWTGIFTHFSTADEPDTT---LTKLQHEKFISFLSFLKKQGIELPTVHMC
ALR1_CALS4      MANMR---GLILEGIYSHFAAASEDDRD---YCKEQFDKFMNLISSLEKKRLKIPLKHIA
ALR_HELP2       IRALK---GLEVEGIFTHLSNADAKIKT---HAKNQMKAFNAFLEQLLDQKIEFQYRHAY
ALR_GEOBB       KQF---K-NLELEGIFSHFASADELDPEGIAFTKLQAERFNAAVEEARRQGYAPTYVHVA
ALR_GEOSL       REL---K-HLDLEGIISHFASADELDEDGRRYSDLQASRFAAAVAAARHEGFEPRYVHIA
ALR_SYNFM       LTL---P-AIRLEGVLSHFASADEADKTS---STLQLTRFREAMALLSARGLS-VLGHIA
ALR_TREPA       CAT---P-GLHLEGVCTHFSVADSVRAEDLQYTEMQRAHFMHCVQYIRKSGISIPLVHAA
ALR_CHLTE       EAC---P-NLELTGIYTHFAESDKPEG----FTARQLERFLHVTGAYERRTGKTVTKHAA
ALR_CUTAK       DRA---K-GVEVEGVFTHLPISDVPEGAE--FTRREIDTFMTAVSLIETHRGPFPLVHLA
ALR_COREF       RDC---G-HIEVTGLFTHLSCADEPGNPE---TDHQAETFRRAIDRARALGLEVPENHLC
ALR_CORGL       AAA---P-HIEVTGMFTHLACADEPENPE---TDRQIIAFRRALALARKHGLECPVNHVC
ALR_MYCA1       RRAVAEQ-AIVPRGLMSHMVYADQPANPV---NDVQAQRFTDMLAQAREQGVRFEVAHLS
ALR_CAMC5       KERGL-----ALEGAYTHFRASDEMNADYFVQRQNFKEAKAEILRLCEKFAMPHPIFHSH
ALR_CAMC1       ARRNL-----ELLGAYTHFRASDELNADYFVQRENFSAAKAKILALCDEFGIKKPIFHSH
ALR_CAMJE       QGSDL-----KLTGMFTHFASADEMDGSFFVQKENFQKAKKIVKKYFSNL-----LFHSY
ALR_CAMJD       RSSNL-----KLTGMFTHFASADEMDGSFFVQKENFQKAKKMVKKYFSNL-----LFHSH
ALR_NITSB       QKNRA-----HLTGVFTHFRSADELSSELFWQNEQWQTVKQHVIELIKKYNLQKPLFHAA
ALR_ARCB4       LERNI-----KVTGVFTHHRGADELSTDFFWQKENFSLVKKSVKNICEKLFLPIPLFHSC
ALR_FRATO       YESDW----LILEGVYSHLACADNRDHPT----NIKQKNRFDSIVKFTKGLSQDIICHLS
ALR_FRATN       YESDW----LILEGVYSHLACADNRDHPT----NIKQKNRFDSIVEFTKGLSQDIICHLS
ALR_FRAP2       YNSKW----IILEGVYSHLACADNRDHPT----NAKQKKRFSEIVEYAKELSQDIICHLS
ALR2_STAA8      HHHNQNA-KMIISGLWTHFGYADEFDVSD---YNVERSQWMEIVEALLSEGYQFDLIHAQ
ALR2_STAAM      HHHNQNA-KMIISGLWTHFGYADEFDVSD---YNVERSQWMEIVEALLSEGYQFDLIHAQ
ALR_PROMA       DNLKN----LSLRGIYSHLALADVEANGQANSFTSKQKEKFETLLSSVMPRGKPLYRHLA
ALR_PSYWF       VDAGY------ELILTSHFANADAPNHPS---NAKQIDTFTQALQQLREQVDPSIKASLC
ALR_DEIRA       AERGQ------LEGVYTHFATADEPDLSF---ALTQL-----VRFRSVLDALPPVLAHCA
ALR_LEPIC       KNVGI-----TLGGICTHFASTEDVLEHK--YSLMQTQKFEEAIFLAKSFGYNHLIRHAC
ALR_AQUPY       -------------GVMSHFSSPADRNFSK---------LQIKRFEEILKNYEKVKYIHLE
ALR_FUSNN       KNNNL-----NLVGIFSHLSDSDGNTIETKNFTLEQI-----EKFKKIVNSLNLEYIHIS
ALR_BORBZ       QNSKF----LELEGICSHLPSIENFKTTQ-----KQIEQFLFFLETLKQKNIHPKFVHIS
ALR_COPPD       KVVGN-----RLEGICSHLSNGLSDSQAL---ATEEE-----RFREVLSIAPEGLMVHLS
ALR2_CLOAB      HEKYL---HVQVDGVYTHFQDPDYNPDFT----HKQIECFNNIIFQLQKQKLRPRIIHAA
                                :*                                          

ALR_SHEB9       NSAGALYWPQ----SQGDWIRPGIALYGVSPVTG--------------------------
ALR_SHESM       NSAGALYWPK----SQGDWIRPGIALYGVSPVTG--------------------------
ALR_SHEPW       NSAGALFWQQ----SQADWIRPGIALYGVSPVFG--------------------------
ALR1_ECOLI      ASGGILLWPQ----SHFDWVRPGIILYGVSPLEDR-------------------------
ALR_CHRSD       NSPATLAWPE----AHGDWNRPGVMLYGSDPLEG--------------------------
ALR_XANC5       NSPGLLGWPA----LRNDWSRPGLMLYGANPFPQH-------------------------
ALR_XANOR       NSPGLLGWPA----LRNDWSRPGLMLYGANPFPQD-------------------------
ALR_XYLFA       NSSGLLGWAG----LYSDWGRPGLMLYGVNPIPQE-------------------------
ALR_AROAE       NSGAILGWPA----AHRDWARPGILLYGADPMPDE-------------------------
ALR_NEIG1       NSAAILNIPE----ARRDWGRAGLALYGISPFGGS-------------------------
ALR_CUPNH       NSAAVLWHPQ----AHRAWVRPGIILYGASPTGRD-------------------------
ALR_RALSO       NSAATLWHPR----AHRDWVRPGVILYGASPTGVA-------------------------
ALR_BURM7       NSAAVLWHPS----AHFDWVRPGIMLYGASPSGRA-------------------------
ALR2_ECOLI      NSAATLWHPE----AHFDWVRPGIILYGASPSGQW-------------------------
ALR_DELAS       NSAATLRQGDDAL-VRCDWVRPGIVLYGSSPDYPQ-------------------------
ALR_JANMA       NSATDLLHPA----AAADWIRPGIMLYGATPG--A-------------------------
ALR_WIGBR       NSTAIIFHTY----THKDWIRPGIILYGILPKENK-------------------------
ALR_COXBR       NSAGFFAYPN----ALVDWIRPGIILYGISPFGINYNSF---------------------
ALR_MARHV       NSAAHFRPNQ----PLYEWSRPGIMLYGASPMEGK-------------------------
ALR_MARMS       NSATIMKWSV----PEGGWIRPGIMLYGISPFAEV-------------------------
ALR_DICNV       NSAAIFALPQ----AHYDYTRSGIMLYGLSPFMHG-------------------------
ALR_BRUME       NSGGTFLGKT----YYFDLARPGIALYGIDPERQHDFSDKVAHE----------------
ALR2_RHILO      NSSGIFLGPS----YHHDLARPGAALYGINPTP---------------------------
ALR3_SALTI      NSCGMFLHPA----WREDLCRPGVALFGVAQPW---------------------------
ALR_RHOSK       ATGGILLGPA----WHFELTRPGIGLYGG-------------------------------
ALR_JANSC       ATGGTLMGPD----YHFDLIRPGVGLYGG-------------------------------
ALR_CAUVC       NSGGLFLGEA----YRFDQTRPGVSLYGGGPEG---------------------------
ALR_RHIME       NSGGVFLGAD----YHFDLTRPGIAVYGGEAVN---------------------------
ALR_ACICJ       NSSGLFLGPG----FGSDLARPGYALYGGNPTP---------------------------
ALR_RICTY       NSGGIFLGQD----YHFDLARPGAALYGLNSLIEVSYNLSYKEKFERNTPALATTVCINK
ALR_RICPR       NSGGIFLGQD----YHFDLARPGAALYGLNSLIEVSSNLSYTEEFESNTAALTTTACINK
ALR3_RHILO      ASAGVWLGKR----YHFDMVRVGSALYGLNSAGIR-------------------------
ALR1_RHILO      ASAGVWLGKS----YHFDMVRVGSALYGIHNAGVQ-------------------------
ALR_DESVM       NSAALLAHPE----LHFDVQRPGIALYGANPLRGTA------------------------
ALR_LAWIP       NSPGLLAWPN----YIGDFSRPGIALYGGNPFYGTS------------------------
ALR_LACRD       NSATGLWHRETI---TANTIRMGISMYGQNPS----------------------------
ALR_LACF3       NSATGLWHQKSI---VANTIRMGISMYGANPS----------------------------
ALR_LACPL       NSATSLWHQAC----NGNMVRFGVALYGLNPS----------------------------
ALR_STRP8       NSATSIWHSDT----IFNAVRLGIVSYGLNPS----------------------------
ALR_STRPZ       NSATSIWHSDT----IFNAVRLGIVSYGLNPS----------------------------
ALR_STRP2       NSATTLWHVET----IFNAVRMGDAMYGLNPS----------------------------
ALR_LACLA       NTAAALWHKEQ----VQAIERLGISMYGLNPS----------------------------
ALR_LACDB       NTAAILFDKDV----ASDIVRFGIGLYGLNPSSAPG------------------------
ALR_GEOSE       NSAASLRFPDR----TFNMVRFGIAMYGLAPSP---------------------------
ALR1_STAAN      NSAGSLLMDCQ----FCNAIRPGISLYGYYPSE---------------------------
ALR1_STAA8      NSAGSLLMDCQ----FCNAIRPGISLYGYYPSE---------------------------
ALR_STAEQ       NSAGSLLMDGQ----FCNAIRLGISLYGYYPSE---------------------------
ALR_MACCJ       NSAATLRYDCS----ECNAVRLGISLYGYYPSE---------------------------
ALR_CLOPS       NSGAIMDLPE----TYLDGVRCGIISYGYYPSEE--------------------------
ALR2_BACSU      NTAAAIAFPE----FSADMIRLGIGLYGLYPSAY--------------------------
ALR1_CALS4      NAAAILNLNY----SHLDMVRPGIILFGAYPSK---------------------------
ALR_HELP2       NSAGILSLCNGNENRFLNLYRPGIMLYGFYPSNE--------------------------
ALR_GEOBB       NSAAILTQDLP----YCNLARPGIILYGALPSGD--------------------------
ALR_GEOSL       NSAAAFGMDLP----FCNLVRPGIVLYGALPSGD--------------------------
ALR_SYNFM       NSAGLLDLPQA----HFDLARPGIMLYGSPPSLE--------------------------
ALR_TREPA       NSAALLCHPRA----HFDMVRPGLLAYGYAPESV--------------------------
ALR_CHLTE       NSGAIISMPDA----RLDMVRPGILLYGCHPVDA--------------------------
ALR_CUTAK       NSGAILGHDLG----KTSMVRAGIVGYGYDPNP---------------------------
ALR_COREF       NSPATLTRPDL----HMDMVRPGVALYGLEPIPG--------------------------
ALR_CORGL       NSPAFLTRSDL----HMEMVRPGLAFYGLEPVAG--------------------------
ALR_MYCA1       NSSATMSRPDL----AFDMVRPGIAVYGLSPVPE--------------------------
ALR_CAMC5       NSAALERFGEF----DDDMVRVGIAQHGYAQFD---------------------------
ALR_CAMC1       NSAALERASEI----KDEMVRVGIAQYGYAQFN---------------------------
ALR_CAMJE       NSAALFRGKIP----EDEYCRVGLVQFGYGD-----------------------------
ALR_CAMJD       NSAALFRGKIP----EDEYCRIGLVQFGYGD-----------------------------
ALR_NITSB       NSAALFRL-GC----EDDFARIGIALYGYTELDDL-------------------------
ALR_ARCB4       NSAALFRTENF----DEDFTRVGIATYGYLDDSDV-------------------------
ALR_FRATO       NSYGFLGQKG----ICYDMVRPGILSYGFLPEFYV-------------------------
ALR_FRATN       NSYGFLGQKG----ICYDMVRPGILSYGFLPEFYV-------------------------
ALR_FRAP2       NSYGFLGDKE----ICYDMVRPGILIYGFLPEFYV-------------------------
ALR2_STAA8      NSASFYREGQ-ILLPHHTHARVGIALYGSRPYSSL-------------------------
ALR2_STAAM      NSASFYREGQ-ILLPHHTHARVGIALYGSRPYSSL-------------------------
ALR_PROMA       NSAGTLRDKG----LHFDMVRVGLALYGYSPLKDL-------------------------
ALR_PSYWF       NSAGILNFKAC----HFDWVRPGIMLYGSSPVEGV-------------------------
ALR_DEIRA       NGGGVLSFGRI---EGMSLARPGLAAYGYVPEHLR-------------------------
ALR_LEPIC       ASASTMLFPNA----HFDMVRIGISLYGLWPSIQTRLSLNLTG-----------------
ALR_AQUPY       SSAGLIYRVPF-----TTHVRVGLAIYGEKPLKDY-------------------------
ALR_FUSNN       NSAGITNFHND---ILGNLVRLGIGMYSFTGNKK--------------------------
ALR_BORBZ       NSGHIINYKLN---PQFNMVRPGLILYGYCQSLKN-------------------------
ALR_COPPD       NSASLYNAKFP----YATHFRPGISLYGYGYPG---------------------------
ALR2_CLOAB      NSTGIIRYPEA----HYDMVRCGTLLFGLEHEQGQ-------------------------
                                    * *   ..                                

ALR_SHEB9       --------------DCGANHGLVPAMELVSQLIAVRDH-KANQPVGYGCFWTAKQD-TRL
ALR_SHESM       --------------DCGANHGLIPAMNLVSRLIAVRDH-KAGQPVGYGCYWTAKQD-TRL
ALR_SHEPW       --------------DLGAKHGLMPAMDLVSQLIAIREH-KAGESAGYGSYWTAEKD-TNL
ALR1_ECOLI      --------------STGADFGCQPVMSLTSSLIAVREH-KAGEPVGYGGTWVSERD-TRL
ALR_CHRSD       --------------ANDASRALEPVMTLRSEIIAVREL-AEGEAVGYGGRWRASRP-SRI
ALR_XANC5       ---------------TENTAQLRPVMTLRSRIISVREL-PAGEPVGYGARFVAERP-TRV
ALR_XANOR       ---------------TENTAQLRPVMTLRSRIILVRDL-PVGEPVGYGARFVAERP-TRV
ALR_XYLFA       --------------STSLSGPLRPVMMVYSRLIAVHEL-PAGEPVGYGACFVTERP-TRV
ALR_AROAE       ------------------PNGLRPVMTLESAVIAVREI-PAGAPLGYGARFHAERA-TRA
ALR_NEIG1       ------------------DDRLKPVMRLSTRIFGERVL-QPHSPIGYGATFYTSKS-TRV
ALR_CUPNH       --------------ADIAGTGLQPAMSLHSELISVQDL-QPGDTVGYGSLFTAERP-MRI
ALR_RALSO       --------------ADIEGTGLMPAMTLKSELIAVQDL-QPGATVGYGSRFEAEQP-MRI
ALR_BURM7       --------------ADIADRGLKPTMTLASELIAVQTL-AKGQAVGYGSMFVAEDT-MRI
ALR2_ECOLI      --------------RDIANTGLRPVMTLSSEIIGVQTL-KAGERVGYGGRYTARDE-QRI
ALR_DELAS       --------------HTAAHWDLQPTQTLSSRIIGVQQL-TEGQSVGYGSRFTAEGP-LRL
ALR_JANMA       --------------QSAEQFGLRAAMSLHSEIIGVQHI-VAGDAVGYGSAFVATAP-MTI
ALR_WIGBR       --------------KISKKFNLKPVMTLESRIISIQNI-KSKEYIGYGKNYYSNKS-NLI
ALR_COXBR       --------------KEKIEKKFRPVMTLSAKIIAIKNR-RQNDSVGYGCTWSCSED-MPI
ALR_MARHV       ---------------TGAELGLCPAMTLQAPLITTRVV-RAGESVGYGASWTASQD-TRM
ALR_MARMS       ---------------SGRSIGLRPAMTLSSKVISTRKL-KQGDKVGYGLGYVAAED-HVL
ALR_DICNV       ---------------DGSAYGLQPVMTVITEILAVRHL-EKNETAGYGQGFTAPES-GWL
ALR_BRUME       --------------NKKPKHSILPVLTLSARVIQVRDV-DKGATVGYGGTYVANGP-MRI
ALR2_RHILO      ---------------GEP-NPMLPVVWLQAKVAQTRRI-EKGAGIGYGHSYHADGP-LSL
ALR3_SALTI      -----------------FSTPLKPAFTLTLTILRVQDV-PVGTPIGYGSTVTTTRP-LRI
ALR_RHOSK       ----------------RPFEEARPVVRLSLPVIQVREV-EIGEPVGYSNTWTAEHT-STI
ALR_JANSC       ----------------LPFAGARPVVRLSLPVIQIRCV-NPGATIGYGATYTATTP-RQI
ALR_CAUVC       ----------------RPHPEIRAVATVEAPILQVRVV-PRGESIGYGAGWTASDN-TRV
ALR_RHIME       ----------------GAVNPMKAVVTAEARIVQVRTV-PSGGTASYGASVRFGRD-SRI
ALR_ACICJ       ----------------TAANPMRPAIALAAPILQIRAI-ASGETVGYNGTWRAARP-SRI
ALR_RICTY       CADVNTRLTYKVPLKGSY--RLQNPVTLKAPIIHLQNL-TLDSHIGYNMTFTTKRD-SII
ALR_RICPR       CPDVSVRLTPKLPLKGSYTVRLQNPVTLKAPIIDLQNL-TLDSHIGYNMTFTTKRD-SVI
ALR3_RHILO      ------------------PNPLKPVVGVKAKTLDARNV-ARSEAVGYGATFRTGRA-SRL
ALR1_RHILO      ------------------TNPLKPVVKLRARILDVRSV-PAGEAVGYGATFRTDRA-SRV
ALR_DESVM       --------------QEHLGDGLQPAMDVAAPILQVHPL-PAGRSISYGRTFTAPRD-MTV
ALR_LAWIP       --------------RVSLGKGFLPVMEVEAPVVAINTV-SAGSSIGYGCTYYAKED-IRV
ALR_LACRD       ------------GRDLKLTLDLQPVSSLVSSISFVKQL-KAGRSVSYGATYTAEQD-EWL
ALR_LACF3       ------------GVGIKESFPLEPVTSLVTHATYVKQL-KAGESVSYGATYTAKED-EWV
ALR_LACPL       ------------GRELSAPYPLQPALSLTARLTFVKRL-ARGKSVSYGATYTAAQD-EWI
ALR_STRP8       ------------GSDLSLPFPLQEALSLESSLVHVKMI-SAGDTVGYGATYTAKKS-EYV
ALR_STRPZ       ------------GSDLSLPFPLQEALSLESSLVHVKMI-SAGDTVGYGATYTAKKS-EYV
ALR_STRP2       ------------GAVLDLPYDLIPALTLESALVHVKTV-PAGACMGYGATYQADSE-QVI
ALR_LACLA       ------------GKTLELPFEIEPALSLVSELTHIKKI-AAGETVGYGATYETSEE-TWI
ALR_LACDB       ------------SRDLEPAFALEPAMSFVSELTYVKQI-HKGYGVGYGSTHIAEED-EWI
ALR_GEOSE       ------------GIKPLLPYPLKEAFSLHSRLVHVKKL-QPGEKVSYGATYTAQTE-EWI
ALR1_STAAN      ------------YVQQKVKVHLKPSVQLIANVVQTKTL-QAGESVSYGATYTATDP-TTI
ALR1_STAA8      ------------YVQQKVKVHLKPSVQLIANVVQTKTL-QAGESVSYGATYTATDP-TTI
ALR_STAEQ       ------------YVKDNVKVHLRPSAQLVSETVQVKTL-KVGETVSYGRTFIADEE-MTI
ALR_MACCJ       ------------FIRAVSNVKLQPAVQLVSTACFIKHI-KSGDTVSYGATYTAQSD-EVV
ALR_CLOPS       -------------VKKEN-LKLKPALTLKTNVAFVKEL-DEDMYVSYGRTYKTEKK-SKI
ALR2_BACSU      -------------IKQLNLVKLEPALSLKARIAYVKTMRTEPRTVSYGATYIAEPN-EVI
ALR1_CALS4      --------------RVERKVELRETLRFTTRVVHLKDV-PAGFFIGYGKSFVTKRK-SVI
ALR_HELP2       -------------MKESCPTILKNVISLKAQIVQIRSV-KKGEFIGYGEHFYTNEE-TLV
ALR_GEOBB       --------------FEGQVPS-QPVMRLKSRVAMLKWV-EPGTSISYGRRYVAAER-ALI
ALR_GEOSL       --------------FEGKMAL-KPIMRLRSSIAMLKWV-EPGTSISYARRFTAPDR-RLV
ALR_SYNFM       --------------LHKPADL-RPVMTFKSKIIQLKDV-QAGQPIGYGGTFVTAAP-GRI
ALR_TREPA       --------------HPAVRSVFLPVMELVTQVRAIKKI-PAGAYVSYQRLWRAHTE-THV
ALR_CHLTE       --------------APSTVPV-RPVMQFQSRVIFVKEV-PAGTAISYNRTWSAPKA-TRI
ALR_CUTAK       ---------------HADRADLHPALSWISHVTFVKTV-SVGDTIGYGRTWTASET-TKI
ALR_COREF       --------------L-DHGLR--PAMTWAGAITVVKPI-RKGEGTSYGLTWRAEAD-GFV
ALR_CORGL       --------------L-EHGLK--PAMTWEAKVSVVKQI-EAGQGTSYGLTWRAEDR-GFV
ALR_MYCA1       --------------LGDMGLV--PAMTVKCTVALVKSI-RAGESVSYGHTWTAQRD-TNL
ALR_CAMC5       -----------------DSLNLKPVLSLWAQKVSERVL-KAGQCVGYGAKFCADKD-INI
ALR_CAMC1       -----------------GSLNLKPVLSLWAKRVSRRVL-KSGQSVGYGAKFIAKDD-INV
ALR_CAMJE       -------------------SNLKRVLSLYAHRLSQRIL-QKGQSIGYGGIFTAAKD-MEV
ALR_CAMJD       -------------------SNLKRILSLYAHRLSQRIL-QKGQSIGYGGIFTAVKD-MEV
ALR_NITSB       ----------------YEPPALEPVASLWAQKIASREL-KKGSRVGYGGVFEARED-MII
ALR_ARCB4       ----------------FNFPKLKPVMSLWASRLSTRIL-KKGQSVGYGGTFTTTED-MLV
ALR_FRATO       ---------------DRVIREIKPIARLLSKVVKIITL-QEGEGVGYSLIYRGFEG-EQL
ALR_FRATN       ---------------DRVIREIKPIARLLSKVVKIITL-QEGEGVGYSLIYRGFEG-EQL
ALR_FRAP2       ---------------ERSIREIKPIARLLSKVVKIIEL-EEGDGVGYSMIYRGFDG-EKV
ALR2_STAA8      -----------------NQHDIVQSLTLKAHVIQVREV-QAGDYCGYSFAFEVTKNNTKL
ALR2_STAAM      -----------------NQHDIVQSLTVKAHVIQVREV-QAGDYCGYSFAFEVTKNNTKL
ALR_PROMA       ----------------RNNFSLQPALAVRAKVTLLRDV-PSDTGVSYGHTFITQRP-SRL
ALR_PSYWF       ---------------SAQMLKLKPVMSFKASLMAIHNI-AAGTSVGYGSRFVANRP-IVK
ALR_DEIRA       -----------------HVCALRPVMTVRARVNQLHTA-YPGETVSYGALWRAERE-TGV
ALR_LEPIC       ----------------NKNFQLNPILSWKSRIVHIQYH-PADSYIGYGSTFQTSYP-TKV
ALR_AQUPY       ------------------PLEVKPALRLRARLISVKEL-PENYPVSYGRTYITKRK-TKL
ALR_FUSNN       ------------------TPYLKNIFTIKSKILFIKKV-KKDSFVSYGRHYTLPAD-STY
ALR_BORBZ       ---------------KKPALNFKPVLSLFSKVIFIKNV-KKGEKISYSGIFQAKED-MKI
ALR_COPPD       ---------------------LKPVLSLKARVIHEHIL-EPGEGLSYGWTWRATEP-THV
ALR2_CLOAB      ---------------RNMPKGIKTLMELKGRIMKVRTI-RAGEAGGYGSTFVAKKD-SKV
                                                             .*             

ALR_SHEB9       GVVAIGYGDGYPRNAPEG-----------TPVWVNGRRVPIVGRVSMDMLTVDLGQDAQD
ALR_SHESM       GVVAIGYGDGYPRNAPEG-----------TPVWVNGRRVPIVGRVSMDMLTVDLGADATD
ALR_SHEPW       GVVAIGYGDGYPRNAPLG-----------TPVLVNGRIVPIVGRVSMDMLTVDLGIDAND
ALR1_ECOLI      GVVAMGYGDGYPRAAPSG-----------TPVLVNGREVPIVGRVAMDMICVDLGPQAQD
ALR_CHRSD       GVVAGGYGDGYDRHARDG-----------TPVLVEGQRVPLAGKVSMDMLTVDLTELPEA
ALR_XANC5       GVVAMGYADGYPQFAPNG-----------TPVLVDGQICPLIGRVSMDMLTVDLTDHPQA
ALR_XANOR       GVVAMGYADGYPQFAPNG-----------TPVLVDGQVCPLIGRVSMDMLTVDLTDHPQA
ALR_XYLFA       GVVAMGYADGYPYFAVNG-----------TPLLVDGRVCPLIGRVSMDMLTVDLTDHPQA
ALR_AROAE       GLVALGYADGYPRSVPNG-----------TPVAVDGLRTRLIGRVSMDLLTIDLTDLPDA
ALR_NEIG1       GLIACGYADGYPRRAPSN-----------SPVAVDGKLTRVIGRISMDMMTIEL-DASQE
ALR_CUPNH       GVVACGYADGYPRHASGWGE-------QRAPVLVDGVRTELVGRVSMDMLCVDLTPCPKA
ALR_RALSO       GIVACGYADGYPRHAPGWDG-------NYTPVLVDGVRTRMVGRVSMDMITVDLAEVPGA
ALR_BURM7       GVVACGYADGYPRIAPEG-----------TPVVVDGVRTRIVGRVSMDMLTVDLTPVPQA
ALR2_ECOLI      GIVAAGYADGYPRHAPTG-----------TPVLVDGVRTMTVGTVSMDMLAVDLTPCPQA
ALR_DELAS       GTVACGYADGYPRHCGTG-----------TPVLVNGVRTRTLGCVSMDMLAVDLTPVPDA
ALR_JANMA       GVVACGYADGYPRHAPSG-----------TPVIVDGVKTRMVGRVSMDMITVDLTPVAKP
ALR_WIGBR       GIVSCGYADGYPFSVPFSG----------TPVFVNGTRTQIIGSVCMDMLTIDLNDCPNA
ALR_COXBR       AIVSIGYGDGYPRHAPSG-----------TPVLLNGKICPLIGRVSMDMIAIDLRSQPNA
ALR_MARHV       GMVAIGYADGYPRHAGTG-----------TPAAVRGQRIRLLGRVSMDMLAVDLSAVPEA
ALR_MARMS       ATVAVGYGDGYPRHAVNG-----------TPLKIDGKPASLAGRVSMDMITVRMQDLADE
ALR_DICNV       ATIALGYGDGFARTITSGA----------VPVLIAGQRYPLVGRVAMDMAMVWLGSDRYA
ALR_BRUME       ATIAVGYADGLFRSLS-----------NKGAAFFGDTRLPIIGRVSMDSITLDVTSLPEG
ALR2_RHILO      ATISFGYADGWLRRSA-----------S--AAWFEGVRLPFLGRVSMDSIILDISALPPG
ALR3_SALTI      ATVSAGYADGIPRNLR-----------PPAGVCWRGVRLPVLGRVCMDSFMVDASAIMP-
ALR_RHOSK       ATVAAGYADGLPRTLS-----------SRATLYAGRVPCPLVGRVSMDLITVDVSHLPE-
ALR_JANSC       ATLSAGYADGLIRALS-----------SKATLWDGDTPCPLVGRVSMDLLTVDVTDCDT-
ALR_CAUVC       AIVAAGYADGVPRAA----------FPRGE-VWFDGARRPMLGRVSMDLIAVDVTDC--D
ALR_RHIME       ATVAIGYADGYHRSVSGGGVTLRQAMPSGAFGFLHGMKVPHVGRVTMDLSLFDVTDLPEA
ALR_ACICJ       ATIGVGYADGLPRSL-----------SNRLTARWQGKIIPVAGRLSMDLTTFDVTDH--P
ALR_RICTY       ATLPLGYADGFSRNFS-----------NQGEVFINSRSVPIVGRVSMDLINIDVTDLPPS
ALR_RICPR       ATLPLGYADGFSRNFS-----------SQGEVFINSCSVPIVGRVSMDLINIDVTDLPPS
ALR3_RHILO      AIAGIGYKHGLPWACA-----------NKISVRFAGYSAPLVGRVSMEYITIDVTDVPEA
ALR1_RHILO      AIVGIGYKHGLPWSCA-----------NKIFVRLAEYSAPSIGRISMEYMIIDITDVPAR
ALR_DESVM       AIVATGYADAYSRGLS-----------GKGAMTVHGRRVPILGRVCMQMTAVDVTDVPG-
ALR_LAWIP       AVIGAGYADGYSRSFS-----------NKGWVVIKGKRYRIVGRVCMQMLMVDITNSHSK
ALR_LACRD       ATLPIGYADGYPRCMTG------------YKVLVDGQFCDIAGRVCMDQMMIRLPK---Y
ALR_LACF3       ATLPVGYADGYPRRMQG------------FYVLVDGQRCEVLGRVCMDQMMVRLPK---E
ALR_LACPL       GTVPIGYADGYERRLQG------------FHVLVDGEFCEIVGRVCMDQLMVRLPH---E
ALR_STRP8       GTVPIGYADGWTRNMQG------------FSVLVDGQFCEIIGRVSMDQLTIRLSK---A
ALR_STRPZ       GTVPIGYADGWTRNMQG------------FSVLVDGQFCEIIGRVSMDQLTIRLSK---A
ALR_STRP2       ATVPIGYADGWTRDMQN------------FSVLVDGQACPIVGRVSMDQITIRLPK---L
ALR_LACLA       GTVPIGYADGWTRQMQG------------FKVLVNGEFCEIVGRVCMDQMMIKLDK---S
ALR_LACDB       GTVPVGYADGWIRKFQG------------FKVKVGDTYCPIVGRVCMDQFMVLLPK---E
ALR_GEOSE       GTIPIGYADGWLRRLQH------------FHVLVDGQKAPIVGRICMDQCMIRLPG---P
ALR1_STAAN      ALLPIGYADGYLRIMQG------------SFVNVNGHQCEVIGRVCMDQTIVKVPD---Q
ALR1_STAA8      ALLPIGYADGYLRIMQG------------SFVNVNGHQCEVIGRVCMDQTIVKVPD---Q
ALR_STAEQ       AILPIGYADGYLRSMQG------------AFVNVNGSQCEVIGRICMDQMIVKVPS---H
ALR_MACCJ       ATFPIGYADGLPRAMQG------------YNINLEGTEVPIIGRVCMDQMMARVPD---D
ALR_CLOPS       ATLPIGYADGYSRLLSGK-----------AKVIIKGQFANVIGRVCMDQCMVDVTHIE-D
ALR2_BACSU      ATLPIGYADGYSRALSNR-----------GFVLHRGKRVPVAGRVTMDMIMVSLGENG-E
ALR1_CALS4      ATIPVGYADGLDRRLSNN-----------YKLLLKGKYVPIVGRVCMDQCMIDVTDVE-G
ALR_HELP2       GVLALGYADGLMRALGNR-----------IQVAINNQLAPLIGKVCMDQCFVKLNNIQ-A
ALR_GEOBB       ASVPVGYADGYCRSLTNK-----------GEALIRGQRAKVAGTVCMDWIMLDVTN-VKG
ALR_GEOSL       ASIPVGYADGYSRSLTNR-----------GEVVVRGRRAPVVGTVCMDWIMADVTH-VSG
ALR_SYNFM       ATIPVGYDDGYPRLLSNR-----------GRVLVRGMSAPVVGRVSMNMITADVTH-IPS
ALR_TREPA       GILPIGYADGVMRALSPG-----------LQVCIGGKWYPVVGAICMDQCVVDLGT-PLR
ALR_CHLTE       ATISAGYADGFHRALSNQ-----------ARVSIGGKSFPQVGTITMDQTMVNLGS-DDS
ALR_CUTAK       ATVPVGYADGLSRGLSNK-----------GHVLIRGSVHPIVGRICMDQFMVDLGP-DSN
ALR_COREF       AVVPAGYADGVPRAAQDH-----------LRVHVNGHDYPQVGRVCMDQFVIFLGDNPHG
ALR_CORGL       AVVPAGYADGMPRHAQGK-----------FSVTIDGLDYPQVGRVCMDQFVISLGDNPHG
ALR_MYCA1       ALLPVGYADGIFRSLGGR-----------LQVSINGRRRPGVGRICMDQFVVDLGPGRPD
ALR_CAMC5       ATYDLGYGDGLLRYAGDGE-------------LPLANGKAMLGKMSMDSFSCEDAG----
ALR_CAMC1       ATYDLGYGDGLLRYNGLGE-------------LRLANGELILGKISMDSFSCKDSG----
ALR_CAMJE       ATYDLGYADGLFRYNGRGE-------------LVLGNGKAMLGKMSMDSFSCENSG----
ALR_CAMJD       ATYDLGYADGLFRYNGKGE-------------LVLGNGKAMLGKMSMDSFSCENSG----
ALR_NITSB       STYDAGYADGIFRFQKEI------------------EDGKILGRVSMDSILLEGEK----
ALR_ARCB4       STYDVGYGDGFLRLNERKS-------------YTTPKGYKVLGRVSMDNLSLNTDD----
ALR_FRATO       AVIPIGYGDGFPRELGDR-----------GFVNINDVMYPMAGRMSMDGLTVSLGINEYD
ALR_FRATN       AVIPIGYGDGFPRELGDR-----------GFVNINDVMYPMAGRMSMDGLTVSLGINEYD
ALR_FRAP2       AVIPIGYGDGFPRELGDR-----------GFVNIDNVMYPMAGRMSMDGLTVSLGHNEHN
ALR2_STAA8      AVVDIGYGDGILRTRAKH------------EALINGKRYP-IRALMMSHMFVEVDGNVHA
ALR2_STAAM      AVVDIGYGDGILRTRAKH------------EALINGKRYP-IRALMMSHMFVEVDGNVHA
ALR_PROMA       AVVGIGYADGISRALSGK-----------MSVLIDGKFYPQVGSITMDQLVIDITE---S
ALR_PSYWF       GIVSIGYGDGYPRVVDGSAWV-----SVQLAGEHSSYKCPVIGRVAMDMIAIDLTDVPNP
ALR_DEIRA       AVVGMGYADGYPRNATGR-----------AAVLIGGERRPVLGRICMDQMMVDVTGLDVG
ALR_LEPIC       AIVPVGYYEGLDRKLSSN-----------GDMLVLGKKARIIGRICMNMTMLDVTHIPGA
ALR_AQUPY       GVVAFGYADGLMKTLSNR-----------SFLIFEGRKVPIIGNITMDMTMVDLSGTEAR
ALR_FUSNN       AVLPIGYADGLKKYLSKG-----------GYVLINNHRCEIIGNICMDMTMIRVPKEIEN
ALR_BORBZ       GIIPIGYFDGIPQNISND-----------FYFLINNKKCKIRGKVCMNLTIVEIPKDLKV
ALR_COPPD       VTVPVGYGDGYNRKLSNK-----------AIAGSKAGNLQQIGTVTMDFTMFEAPKNVTV
ALR2_CLOAB      AIIAFGYGDGISRGWKEV--------------LVAGKRVPVVNYF-MDGLMVDISNIDET
                     ** ..                                  . *.            

ALR_SHEB9       KV---GDSALLWGKA------LPVEEVAEHIGTIAYELVTKLTPRVAVCLA---------
ALR_SHESM       LV---GDEALLWGAA------LPVEEVAEHIGTIAYELVTKLTPRVAVCLA---------
ALR_SHEPW       KV---GDLAVLWGKE------LPVEEVAEHIGTIAYELVTKLTPRVAVCLD---------
ALR1_ECOLI      KA---GDPVILWGEG------LPVERIAEMTKVSAYELITRLTSRVAMKYVD--------
ALR_CHRSD       GI---GSPVVLWGEG------LPIDEVARHCDTISYTLMTGVLPRVPRRYRNAETG----
ALR_XANC5       DI---GTPVQLWGDA------PQVSALAAQCNVSAYQLLCGLKRVPRIYVGEAAVGKLSA
ALR_XANOR       DI---GATVQLWGQA------PRVGPLATQCNVSAYQLLCGLKRLPRTYVGSAAVGEVAA
ALR_XYLFA       DV---GSQVQLWGVQ------PGVAELAAHCNLSAYQLLCGLKRVRRYYLGEMGAV----
ALR_AROAE       GL---GSRVELWGAN------IPVNRIAQAAKTISYELLCNVKRVRFEYSG---------
ALR_NEIG1       GL---GHEVELWGDT------VNINTVAEAAGTIPYELMCNIKRAKFTYIE---------
ALR_CUPNH       RV---GSPVTLWGQG------LPIDEVAQASGTVGYELMCALAPRVPTSVATITASDSAA
ALR_RALSO       RV---GAPVTLWGQG------LPIDEVAHAAGTVGYELMCALAPRVPVTVEPAGAADAGE
ALR_BURM7       GV---GARVELWGET------LPIDDVAARCMTVGYELMCAVAPRVPVRAE---------
ALR2_ECOLI      GI---GTPVELWGKE------IKIDDVAAAAGTVGYELMCALALRVPVVTV---------
ALR_DELAS       GM---GSEVTLWGRAS-NGAVLPIDEVAEAAGTLGYELMCAVAPRVNKTID---------
ALR_JANMA       RI---GSKVTLWGAS------LPIDEVANAAGTVGYELMCGLAPRVQIVEVN--------
ALR_WIGBR       KI---GSKVELWGNN------ISINEISKLANTTSYELMCRISSRVLVKIE---------
ALR_COXBR       QV---GDDVILWGEG------LPVEIIAEKAGTIAYELLCKITQRVQFIEIEK-------
ALR_MARHV       RE---GDMVELWGKT------VSVDEVATCAGTIGYELLTGVTSRVPRVHE---------
ALR_MARMS       PA--MGQDVVLWGGD------VPVEEVADYAGTIGYELVTRMTSRPHYRYIRGEGSQ---
ALR_DICNV       EG----TIVELFGSH------LPTEEVARAAGTIPHTLTTMLMPRVHVEIVGG-------
ALR_BRUME       TLKL-GSLVELIGPH------QRLEDVARDCDTIPYEILTALGNRYARVYVYVNGGGTST
ALR2_RHILO      RLRE-GDLVELLGPS------QSVDDAAGHAGTIGYEILASLGPRFHRHYV---GG----
ALR3_SALTI      --TS-GDVVEFIGVS------QTLEEVAAACDTIPYEIMARLGARFRRIMQPAEA-----
ALR_RHOSK       ---V-PETLDILGPH------QTPDDLADTAGTIGYEILTSLGRRYQRRYGALAA-----
ALR_JANSC       ---P-PEALDILGPH------QTIDQLAEAAGTIGYEILTSLGPRYRRALTP--------
ALR_CAUVC       AARP-GAMVELFGAN------LPVDDAADAAGTSAYERLTRLTLRGVRRYVGGAR-----
ALR_RHIME       AVRA-GDYIEVFGRN------VVIDDVARAGGTIGYELLTSLGRRYHRTYVGGA------
ALR_ACICJ       DIAP-GDVIELIGPG------HDIDAFAAEAGTIGYEILTSLGPRYRRVVKSV-------
ALR_RICTY       EVFL-GQEVEIIGNY------CTPDKIASIIGTVGYEVLTSLGSRYKRKYIS--------
ALR_RICPR       EVFL-GQEAEIIGNY------CTPDKIASIIGTIGYEVLTSLGSRYKRKYIS--------
ALR3_RHILO      LCGP-GTNVELLSDD------FTVDDLAASAGVHPQEVLTRLGVGCARQYLDGSSASAGF
ALR1_RHILO      RCSP-GTFAELLSED------FTVNDLGAAAGVSPQEALTRLGAGCTRKYLNLFPPSAAF
ALR_DESVM       VAAG-DDAYLLGGPG----EALTPDELADLWGTISYEVLCLLGMNPRTHRE---------
ALR_LAWIP       ISIG-DKAFLLGGGGS---LAIKPEELAEWWGTIPHEVCCSLGSSIGAQQKQLVII----
ALR_LACRD       YPV--GTPVVLMGKS--GDQEITATDLAERAGTINYEILTNI-SNRVHRIYRQSK-----
ALR_LACF3       YPV--GTEAVLMGRS--LDQEITVTDVAEYAHTINYEILTGM-GARLHRRYLG-------
ALR_LACPL       VPV--GAKVTLVGTD--GARTISLQDIADYCGTIHYEIACGL-APRVPRVYID-------
ALR_STRP8       YPL--GTKVTLIGSN--QQKNISTTDIANYRNTINYEVLCLL-SDRIPRIY---------
ALR_STRPZ       YPL--GTKVTLIGSN--QQKNISTTDIANYRNTINYEVLCLL-SDRIPRIY---------
ALR_STRP2       YPL--GTKVTLIGSN--GDKEITATQVATYRVTINYEVVCLL-SDRIPREYY--------
ALR_LACLA       YPL--GTKVTLIGRD--KTNEITTTDVADWRGTINYEVLCLL-SDRIKRIYK--------
ALR_LACDB       VPA--GTPVELISAD--PAAPNSLRRAADWLDTIHYEVACQF-NDRLDRIYDNE------
ALR_GEOSE       LPV--GTKVTLIGRQ--GDEVISIDDVARHLETINYEVPCTI-SYRVPRIFFRHKRIMEV
ALR1_STAAN      VKA--GDSVILIDNH--RESPQSVEVVAEKQHTINYEVLCNL-SRRLPRIYHDGDQRFVT
ALR1_STAA8      VKA--GDSVILIDNH--RESPQSVEVVAEKQHTINYEVLCNL-SRRLPRIYHDGDQRFVT
ALR_STAEQ       VKT--GEKVILMDNH--VDSPQSAEAVANKQGTINYEVLCNL-SRRLPRIYYYDNNEEVT
ALR_MACCJ       TLL--GAQCIIIDNN--ADSNQSLERVAQQLGTITYEVLTSL-SRRLPKRYYIGDDIEVY
ALR_CLOPS       VKI--GDEVILLGEE--NGLKFDANDMAEIMGTINYEILCMI-SHRVPRIYKKNNEIVKV
ALR2_BACSU      GKQ--GDEVVIYGKQ--KGAEISVDEVAEMLNTINYEVVSTL-SRRIPRFYIRDGEIFKV
ALR1_CALS4      VEI--GDEVVIIGTQ--NNETVSVESMADKIETIPQEVFSRI-SRRVPRVYFYDGIKIGE
ALR_HELP2       KE---GDEVILFGDK--SAKANDASEIAALLNTIPYETISTL-SKRLERVYI--------
ALR_GEOBB       VAV--GDDVTLLGPD-PMGDCISAEEMAEKAGTIPYEVLCGIATRRVRRVYLG-------
ALR_GEOSL       VTV--GDEVTLLGCD-QEGNCVRAEELAEWAGTIPYEIFCGI-SKRVPRVYLNPSIRHR-
ALR_SYNFM       ARE--DDEVVLLGA--QGTERVTAEEIAQLCGTISYEIYCSIGRNRFKSFHNGIANSN--
ALR_TREPA       VTV--GDRVTLFGPQDAGGPGQGADVLASHAGTIPYELLCAI-GKRVERVYIR-------
ALR_CHLTE       VKV--GDTAVLFGWD---GPSAGEQALA--AGTISYELLCSV-SRRVRRIVV--------
ALR_CUTAK       VTV--GDEVVLIGTQE--DETLTADDMAELLGTISYEITCAI-SKRVDRYWVGQ------
ALR_COREF       VTA--GDEAVIFG----GTG-MSATELADALATINYEVICRP-TGRTVRDYTGEGK----
ALR_CORGL       VEA--GAKAVIFG----ENG-HDATDFAERLDTINYEVVCRP-TGRTVRAYV--------
ALR_MYCA1       VAE--GDEAILFGPG--SNGEPTAQDWADLLGTIHYEVVTSP-RGRITRTYREAHTVES-
ALR_CAMC5       ------EWVCVFDDA---------NVWARYFDTINYDILVKLSPNIKRKFV---------
ALR_CAMC1       ------EWVCVFEDA---------NVWAEFFGTINYDILVKLSPNITRKFI---------
ALR_CAMJE       ------EEICVFKDA---------DIWADFFHTINYEILVKLNPNIQRVLV---------
ALR_CAMJD       ------EEICVFKDA---------DIWADFFHTINYEILVKLNPNIQRVLV---------
ALR_NITSB       ------KEICIFSDA---------KKMARKLGTISYELLVKMPAHLSRTWID--------
ALR_ARCB4       ------EKVCIFDDV---------RELAKIHDTITYEITTTLNPNIEKEII---------
ALR_FRATO       VKV--GDTVELISAIP--RNRNSAFSIAKQINTIEYDIMSTLNDRIIRKII---------
ALR_FRATN       VKV--SDTVELISAIP--RNRNSAFSIAKQTNTIEYDIMSTLNDRIIRKII---------
ALR_FRAP2       VKV--GDVVELISDIP--RNRNSAFLMAKQVNTIEYDIMSTLNDRIIREVI---------
ALR2_STAA8      Q-----DEVILYNND------IRIDEYTFKGVGANSEQLSAMNHDSLKKEYISNDC----
ALR2_STAAM      Q-----DEVILYNND------IRIDEYTFKGVGANSEQLSAMNHDSLKKEYISNDC----
ALR_PROMA       PQIQIGSVVTLLGVD--GDSAITPYDWSEISGSIPWEILCSFKYRLPRVVI---------
ALR_PSYWF       KV---GSQVMLWGDP--ELGAPSVDEIAESAHTLGYELLCRVTQRPLREVL---------
ALR_DEIRA       V----GDWAELWGEG-----DLSVTDVARWGDTIEYEVLTGLGSRVERRVG---------
ALR_LEPIC       EV---GSIVTIIGQD--GEESITADDLADRTHTINYEVMTRISESIPRIVVD--------
ALR_AQUPY       T----GDWVYIVNEE------RSFTPLARDAGTIPYEIMCNLSRRVERLVIKKR------
ALR_FUSNN       SIKI-GDEVTVINAD--------ILDNLNIPELCVWEFMTGIGRRVKRIIV---------
ALR_BORBZ       KT---GSKVEIVSEK------LSIDEMSKFSKRSHYELLCNIGKYEKRKYLD--------
ALR_COPPD       -----GDEIVLMGEW--EGGHFWADEMAQLVGTIPYEVLTSINPRVPRVLV---------
ALR2_CLOAB      VKEL--DEAVIVGNQ--GDESITWLEACKSLGSYVDEQIQCITERVPKKYFYEK------
                          .                                                 

ALR_SHEB9       --------------------------
ALR_SHESM       --------------------------
ALR_SHEPW       --------------------------
ALR1_ECOLI      --------------------------
ALR_CHRSD       --------------------------
ALR_XANC5       --------------------------
ALR_XANOR       R-------------------------
ALR_XYLFA       --------------------------
ALR_AROAE       --------------------------
ALR_NEIG1       --------------------------
ALR_CUPNH       PAVA----------------------
ALR_RALSO       TLGKAA--------------------
ALR_BURM7       --------------------------
ALR2_ECOLI      --------------------------
ALR_DELAS       --------------------------
ALR_JANMA       --------------------------
ALR_WIGBR       --------------------------
ALR_COXBR       --------------------------
ALR_MARHV       --------------------------
ALR_MARMS       --------------------------
ALR_DICNV       --------------------------
ALR_BRUME       TA------------------------
ALR2_RHILO      --------------------------
ALR3_SALTI      --------------------------
ALR_RHOSK       --------------------------
ALR_JANSC       --------------------------
ALR_CAUVC       --------------------------
ALR_RHIME       --------------------------
ALR_ACICJ       --------------------------
ALR_RICTY       --------------------------
ALR_RICPR       --------------------------
ALR3_RHILO      PGNLTNAGPGHDPRAILG--------
ALR1_RHILO      TANRPTEAMSNPSRAKSRPMDKQALI
ALR_DESVM       --------------------------
ALR_LAWIP       --------------------------
ALR_LACRD       --------------------------
ALR_LACF3       --------------------------
ALR_LACPL       --------------------------
ALR_STRP8       --------------------------
ALR_STRPZ       --------------------------
ALR_STRP2       --------------------------
ALR_LACLA       --------------------------
ALR_LACDB       --------------------------
ALR_GEOSE       RNAIGRGESSA---------------
ALR1_STAAN      NELLK---------------------
ALR1_STAA8      NELLK---------------------
ALR_STAEQ       NELLK---------------------
ALR_MACCJ       NELMK---------------------
ALR_CLOPS       RNYI----------------------
ALR2_BACSU      STPVLYV-------------------
ALR1_CALS4      VNYLK---------------------
ALR_HELP2       --------------------------
ALR_GEOBB       --------------------------
ALR_GEOSL       --------------------------
ALR_SYNFM       --------------------------
ALR_TREPA       --------------------------
ALR_CHLTE       --------------------------
ALR_CUTAK       --------------------------
ALR_COREF       --------------------------
ALR_CORGL       --------------------------
ALR_MYCA1       --------------------------
ALR_CAMC5       --------------------------
ALR_CAMC1       --------------------------
ALR_CAMJE       --------------------------
ALR_CAMJD       --------------------------
ALR_NITSB       --------------------------
ALR_ARCB4       --------------------------
ALR_FRATO       --------------------------
ALR_FRATN       --------------------------
ALR_FRAP2       --------------------------
ALR2_STAA8      --------------------------
ALR2_STAAM      --------------------------
ALR_PROMA       --------------------------
ALR_PSYWF       --------------------------
ALR_DEIRA       --------------------------
ALR_LEPIC       --------------------------
ALR_AQUPY       --------------------------
ALR_FUSNN       --------------------------
ALR_BORBZ       --------------------------
ALR_COPPD       --------------------------
ALR2_CLOAB      --------------------------