CLUSTAL format seed alignment for MF_01205

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

YMDB_ENTCC            MKPQIDVIHGDITTMHVDVIVNAANPSLMGGGGVDGAIHRAAGPQLLEACKTVRQQQGEC
YMDB_ENT38            MKPQIEVVVGDITTMEVDVIVNAANPSLMGGGGVDGAIHRAAGPQLLEACKTVRQQQGEC
A0A0H3FRB0_KLEAK      MVVQPEVVLGDITTLQVDVIVNAANPSLLGGGGVDGAIHRAAGPELLAACKIVRQQQGEC
A0A4R2Y937_RAOOR      MAVKPEVILGDITTLAVDVIVNAANPSLLGGGGVDGAIHRAAGPELLAACKIVRQQQGEC
YMDB_KLEP3            MAVQPEVILGDITTLEVDVIVNAANPSLLGGGGVDGAIHRAAGPALLAACKQVLQQQGEC
YMDB_KLEVT            MAVQPEVILGDITTLEVDVIVNAANPSLLGGGGVDGAIHRAAGPALLAACKQVLQQQGEC
YMDB_CROS8            MSGRINVVQGDITLIDVDVIVNAANPSLMGGGGVDGAIHRAAGPALLAACRQVRQQQGEC
YMDB_CROTZ            MSGRINVVQGDITRIDTDVIVNAANPSLMGGGGVDGAIHRAAGPSLLAACKVVRQQQGEC
A0A0J8VLJ4_9ENTR      MQNRIHIQEGDITAMEVDVIVNAANPSLLGGGGVDGAIHRAAGPALLAACKVVRQQQGEC
H5V129_ATLHE          MKPRIEVLQGDITLMTTDVIVNAANASLMGGGGVDGAIHRAAGPALMEACKQVRQQQGTC
A0A090V790_PSEVU      MQSRMEVIQGDITTLQVDVIVNAANPSLMGGGGVDGAIHRAAGPALLAACKAVREQQGEC
V5A7C7_ENTCL          MESRMQVIQGDITTLEVDVIVNAANASLLGGGGVDGAIHRAAGPALLEACKQVRQQQGEC
YMDB_ECOLI            MKTRIHVVQGDITKLAVDVIVNAANPSLMGGGGVDGAIHRAAGPALLDACLKVRQQQGDC
YMDB_SHIF8            MKTRIHVVQGDITKLAVDVIVNAANPSLMGGGGVDGAIHRAAGPALLDACLKVRQQQGDC
YMDB_SHIDS            MKTRIHVVQGDITKLAVDVIVNVTNPSLMGGGGVDGAIHRAAGPALLDACLKVRQQQGDC
YMDB_ESCF3            MKSRIHVLQGDITQLAVDVIVNAANSSLMGGGGVDGAIHRAAGPELLEACQKVRRQQGEC
YMDB_CITRI            MNSRIHVIHGDITTVAVDAIVNAANPSLMGGGGVDGAIHRAAGPELLEACMTVRRQQGEC
A0A0V9J6N0_9ENTR      MESRIHVIHGDITTVAVDVIVNAANASLMGGGGVDGAIHRAAGPELLEACMKVRQQQGDC
YMDB_CITK8            MKSRIHVQHGDITQLTVDVIVNAANASLLGGGGVDGAIHRAAGPTLLEACKKVRQQQGEC
A0A090TYL0_9ENTR      MQSRVHVLHGDITTIAVDVIVNAANSTLLGGGGVDGAIHRAAGPALLEACKQVIQQQGQC
YMDB_SALTY            MTSRLQVIQGDITQLSVDAIVNAANASLMGGGGVDGAIHRAAGPALLDACKLIRQQQGEC
YMDB_SALG2            MTSRLQVIQGDITQLSVDAIVNAANASLMGGGGVDGAIHRAAGPALLDACKLIRQQQGEC
YMDB_SALA4            MTSRLQVIQGDITQLSVDAIVNAANASLMGGGGVDGAIHRAAGPALLDACKLIRQQQGEC
YMDB_SALNS            MTSRLQVIQGDITQLSVDAIVNAANASLMGGGGVDGAIHRAAGPALLDACKLIRQQQGEC
A9MH17_SALAR          MTSRLQVIQGDITQLSVDAIVNAANASLMGGGGVDGAIHRAAGPALLDACKKIRRQQGEC
A0A0L0AMT5_9ENTR      MQSRIQVIRGDITTMQVDVIVNAANSSLMGGGGVDGAIHHAAGSALLDACKVVRQQQGEC
G9Z6X3_9ENTR          MRSRIEVIKGDITTLAVDVIVNAANPSLLGGGGVDGAIHHAAGPALLEACKVVRQQQGEC
L0M7C6_ENTBF          MTARIQVLQGDITQLDVDVIVNAANPSLMGGGGVDGAIHRAAGPALEEACAVVRQQQGTC
A0A0G3Q8B4_9GAMM      MQATMQVIQGDITTVSVDVIVNAANSSLLGGGGVDGAIHRAAGPALLEACRRVRQEQGDC
A0A085GH47_9ENTR      MSERMSVIQGDITRVEVDVIVNAANSSLMGGGGVDGAIHRAAGPAILEACKVIVRQQGEC
YMDB1_PANVC           -MKKITVIQGDITKVSAEAIVNAANSSLLGGGGVDGAIHRAGGPVILAECQLIRNRQGGC
YMDB2_PANVC           -MNKITVIQGDITNIASEAIINVANSSLLGGGGVDGAIHRAGGPVILAECQAIRSRQGGC
                            :  **** :  :.*:*.:*.:*:**********:*.*. :   *  :  .** *

YMDB_ENTCC            PPGHAVITLAGDLPAKAVIHAVGPIWHGGDRHEASILEEAYRNCLRLAADNGYKTMAFPA
YMDB_ENT38            APGHAVITIAGDLPAKAVIHAVGPVWQGGENHEARTLQDAYLNCLRLAAANGYKTLAFPA
A0A0H3FRB0_KLEAK      PPGHAVITSAGNLPASAVIHAVGPVWHGGDEQEAELLTDAYRNSLLLAAANNYRSIAFPA
A0A4R2Y937_RAOOR      APGHAVITTAGQLPASAVIHAVGPVWHGGDRQEAELLADAYKNSLQLAAANSYRSIAFPA
YMDB_KLEP3            PPGHAVITIAGDLPASAVIHTVGPVWHGGDRMEAQTLADAYKNSLQLAAANNYRSIAFPA
YMDB_KLEVT            PPGHAVITIAGDLPASAVIHTVGPVWHGGDRMEAQTLADAYKNSLQLAAANNYRSIAFPA
YMDB_CROS8            QPGHAVITEAGDLAAKAVVHTVGPVWRGGQDNEPQLLADAYRNSLQLVAANGYNSVAFPA
YMDB_CROTZ            QPGHAVITEAGDLAAKAVIHTVGPIWRGGHDNEPQLLADAYRNSLELVTANGYNSVAFPA
A0A0J8VLJ4_9ENTR      APGHAVITEAGQLRAKAVIHTVGPIWRGGSDNEAQLLGDAYRNSLQLVSANGYRSVAFPA
H5V129_ATLHE          PTGHAVITGAGNLAAKAVVHAVGPVWRDGNQHEAQLLSDAYRNSLQLVSANVFKSVAFPA
A0A090V790_PSEVU      PPGHAVITLAGALPAKAVIHTVGPIWRGGEEHEQRLLEDAYRNSLKLAEANGYHSVAFPA
V5A7C7_ENTCL          PPGHAVITAAGNLNAKAVIHAVGPVWRGGNDNEAHLLEDAYRNSLKLADANGYASIAFPA
YMDB_ECOLI            PTGHAVITLAGDLPAKAVVHTVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFPA
YMDB_SHIF8            PTGHAVITLAGDLPAKAVVHTVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFPA
YMDB_SHIDS            PTGHAVITLAGDLPAKAVVHTVGPVWRGGEQNEDQLLQDAYLNSLRLVAANSYTSVAFPA
YMDB_ESCF3            PTGHAVITIAGNLPARAVIHTVGPVWRDGEHNEDQLLHDAYLNSLKLAQANGYKSIAFPA
YMDB_CITRI            PPGHAVITAAGRLPAKAVIHTVGPIWRGGEHNEAQLLHDAYLNSLNLALANGYQSIAFPA
A0A0V9J6N0_9ENTR      PTGHAVITAAGRLPAKAVIHTVGPVWRGGEHNEAQLLHDAYFNSLNLALANGYQSIAFPA
YMDB_CITK8            PAGHAVITLAGNLPAKAVIHTVGPVWRGGDHNESQLLEDAYFNSLQLVLANGYRSVAFPA
A0A090TYL0_9ENTR      PTGHAVITLAGALPAKAVIHTVGPVWQGGEHHEAERLEEAYLNTLQLALANGYQSIAFPA
YMDB_SALTY            QTGHAVITPAGKLSAKAVIHTVGPVWRGGEHQEAELLEEAYRNCLLLAEANHFRSIAFPA
YMDB_SALG2            QTGHAVITPAGKLSAKAVIHTVGPVWRGGEHQEAELLEEAYRSCLLLAEANHFRSIAFPA
YMDB_SALA4            QTGHAVITPAGKLSAKAVIHTVGPVWRGGEYQEAELLEAAYRNCLLLAEANHFRSIAFPA
YMDB_SALNS            QTGHAVITPAGKLSAKAVIHTVGPVWRGGEHQEAELLEEAYRNCLLLAEANHFRSIAFPA
A9MH17_SALAR          PTGHAVITPAGKLSAKAVIHTVGPVWRGGEHQEAELLEEAYRNCLLLAEANRYRSIAFPA
A0A0L0AMT5_9ENTR      APGHAVITLAGDLPAKAVIHTVGPVWRGGEHNEARLLEDAYRNSLQLARDNDFHSIAFPA
G9Z6X3_9ENTR          PPGHAVITVAGNLPAKAVIHTVGPVWHGGQHHEARLLEDAYRNSLMLALANGYQSIAFPA
L0M7C6_ENTBF          PPGHAVITHAGNLKAKAVIHTVGPVWKGGDAHEASLLEQAYRNSLQLALDNGYQSVAFPA
A0A0G3Q8B4_9GAMM      PPGHAVITTAGKLPAKAVVHTVGPVWHGGDDHDVHLLEDAYRNSLMLAEANDFESIAFPA
A0A085GH47_9ENTR      APGHAVITEAGNIPVKAVIHAVGPVWQGGEKHEAQLLEQTYRNCLDLAAANGYRTIAFPA
YMDB1_PANVC           KVGDAVITGAGNLPADYVIHTVGPRWSDGRHDEDALLKRAYQSCFKLVDYHGIKTVSFPN
YMDB2_PANVC           KVGEAVITGAGTLPADYVIHTVGPRWSDGRHNEDTQLKSVYLSCFKLVGHHGIKTVSFPN
                        *.**** ** : .  *:*:*** * .*   :   *  .* . : *.  :   :::** 

YMDB_ENTCC            ISTGVYGYPKAAAATIAVDTVYRYLSLKPMPEKVTFVCFDEETLHLYQRLLTQRGQELEI
YMDB_ENT38            ISTGVYGYPKAAAAEIAVDTVSEFLTRKPLPERVYFVCYDEENAQLYQRLLIQRGLTPDA
A0A0H3FRB0_KLEAK      ISTGVYGYPKQAAAEIAVKTVKAFLTRYNPLERVCFVCFDNETAEIYQRLLQAE------
A0A4R2Y937_RAOOR      ISTGVYGYPKQAAAEIAVRTVNAFLTRYNPLERVCFVCFDAETAEIYHRLLQAQ------
YMDB_KLEP3            ISTGVYGYPKEEAAEIAVRTVTAFLTRYNPLERVLFVCFDEETAAIYRRLLASYP-----
YMDB_KLEVT            ISTGVYGYPKEEAAEIAVRTVTAFLTRYNPLERVLFVCFDEETAAIYRRLLASYP-----
YMDB_CROS8            ISTGIYGYPKAAAAQIAFETVSDYLTRHPQPKQVYFVCYDEENFLLYQRLLGQYDEQPGA
YMDB_CROTZ            ISTGIYGYPKAAAAQIAFETVSDYLTRRPQPKQVYFVCYDEENFLLYQRLLGQYDE----
A0A0J8VLJ4_9ENTR      ISTGIYGYPKAAAAQIAMDTVSDYLTRHPLPEQVYFVCYDEENARLYQRLLTQRFPV---
H5V129_ATLHE          ISTGIYGYPKPAAAEIAVNTVSDYLTRHALPEQVYFVCYDEENTRLYQRLLAQLTPEQDP
A0A090V790_PSEVU      ISTGIYGFPKPAAAEIAVATVSDYLTRHPSIGQVYFVCYDDENTRLYQRLLTQQGDEPDA
V5A7C7_ENTCL          ISTGVYGYPKAAAAEIAINTVSDYLTRYSLLRQIYFVCYDDETLRLYQRLLTQHGADPAR
YMDB_ECOLI            ISTGVYGYPRAAAAEIAVKTVSEFITRHALPEQVYFVCYDEENAHLYERLLTQQGDE---
YMDB_SHIF8            ISTGVYSYPRAAAAEIAVKTVSEFITRHALPEQVYFVCYDEENAHLYERLLTQQGDE---
YMDB_SHIDS            ISTGVYGYPRAAAAEIAVKTVSEFITRHALPEQVYFVCYDEENAHLYERLLTQQGDE---
YMDB_ESCF3            ISTGVYGFPRAAAAEIAVKTVSDFITRHALPEQIYFVCYDEENSRLYNRLLTQQGDE---
YMDB_CITRI            ISTGVYGYPRAAAAEIAVNTISEFITRRASPEQIYFVCYDEETTRLYQRLLTQQGDQ---
A0A0V9J6N0_9ENTR      ISTGVYGYPRAAAAEIAVNTVSDFITRRASPEQIYFVCYDEETTRLYQRLLTQQGDE---
YMDB_CITK8            ISTGAYGYPRPAAAEIAVNTVADFLARHALPEQVYFVCYDEETARLYERLLTQQGDE---
A0A090TYL0_9ENTR      ISTGAYGYPRAAAAEIAVNTVLKFITRRTLPDQIYFVCFDEENAQLYKRLLAQQGDNNGL
YMDB_SALTY            ISTGVYGYPRAQAAEVAVRTVSDFITRYALPEQVYFVCYDEETARLYARLLTQQGDDPA-
YMDB_SALG2            ISTGVYGYPRAQAAEVAVRTVSDFITRYALPEQVYFVCYDEETARLYARLLTQQGDDPA-
YMDB_SALA4            ISTGVYGYPRAQAAEVAVRTVSDFITRYALPEQVYFVCYDEETARLYARLLTQQGDDPA-
YMDB_SALNS            ISTGVYGYPRAQAAEIAVRTVSDFITRYALPEQVYFVCYDEETARLYARLLTQQGDDPA-
A9MH17_SALAR          ISCGVYGYPRAQAAEIAVRTVSDFITRYALPEQVYFVCYDEETARLYARLLTQQGDDPA-
A0A0L0AMT5_9ENTR      ISTGIYGYPKAAAAEIAFNAVSDYITRRPQPEQIYFVCYDEENAELYERLLTRQGHKPVA
G9Z6X3_9ENTR          ISTGAYGYPKAAAAEIAVNTVSQYATFHATPAKIYFVCIDDENARLYTRLLTQEGDDPVE
L0M7C6_ENTBF          ISTGVYGYPKPAAAEIAFHTVERFLTFHRTPEKVWFVCYDEENARLYKRLLSQQGDD-VD
A0A0G3Q8B4_9GAMM      ISTGVYGYPKAAAAEVAINTVAAFLADHPQIRRVVFVCFDEENTALYRRLLTQRGAEKNA
A0A085GH47_9ENTR      ISTGAYGYPKDEAAKIAIDTVYRYIGLRPLPEQVIFVCFDDENTQIYQQLLAQL------
YMDB1_PANVC           ISTGIYGFPKERAATIALDVIKHCIAENRTLENVNLVCFDAENYDLYLKLLN--------
YMDB2_PANVC           ISTGIYGFPKKRAAAIALDVIKHCIAENRTIEKVNLVCFDAENYDLYLKLLN--------
                      ** * *.:*:  ** :*. .:           .: :** * *.  :* :**         

YMDB_ENTCC            -
YMDB_ENT38            -
A0A0H3FRB0_KLEAK      -
A0A4R2Y937_RAOOR      -
YMDB_KLEP3            -
YMDB_KLEVT            -
YMDB_CROS8            -
YMDB_CROTZ            -
A0A0J8VLJ4_9ENTR      -
H5V129_ATLHE          -
A0A090V790_PSEVU      -
V5A7C7_ENTCL          -
YMDB_ECOLI            -
YMDB_SHIF8            -
YMDB_SHIDS            -
YMDB_ESCF3            -
YMDB_CITRI            -
A0A0V9J6N0_9ENTR      -
YMDB_CITK8            -
A0A090TYL0_9ENTR      I
YMDB_SALTY            -
YMDB_SALG2            -
YMDB_SALA4            -
YMDB_SALNS            -
A9MH17_SALAR          -
A0A0L0AMT5_9ENTR      -
G9Z6X3_9ENTR          -
L0M7C6_ENTBF          A
A0A0G3Q8B4_9GAMM      -
A0A085GH47_9ENTR      -
YMDB1_PANVC           -
YMDB2_PANVC           -