CLUSTAL format seed alignment for MF_01209

_____________________________________________________________________________

Features found in the protein:_____________________________________________________________________________

CARA_SACS2      -------------MKLENK---KGYLYLEDGTFIEGYSFGA---KGIKVGEVVFTTSMNG
CARA_SULTO      -------------MTLYCKRGYKGYLYLEDGTLIEGCGFGA---KGIRAGEVVFTTSMNG
CARA_PYRFU      -------------MGVHKK----GYLVLEDGSVIEGKAFGA---ETIRYGEVVFTTAMVG
CARA_PYRAE      ---------------------------MEDGSVFAGRLIGA---EKIAVGEVVFTTSVVG
CARA_SALTY      -------------------MIKSALLVLEDGTQFHGRAIGA---TGSAVGEVVFNTSMTG
CARA_SALTI      -------------------MIKSALLVLEDGTQFHGRAIGA---TGSAVGEVVFNTSMTG
CARA_ECOLI      -------------------MIKSALLVLEDGTQFHGRAIGA---TGSAVGEVVFNTSMTG
CARA_ECO57      -------------------MIKSALLVLEDGTQFHGRAIGA---TGSAVGEVVFNTSMTG
CARA_ECOL6      -------------------MIKSALLVLEDGTQFHGRAIGA---TGSAVGEVVFNTSMTG
CARA_YERPE      -------------------MIKSALLVLEDGTQFHGRAIGA---EGTAVGEVVFNTSMTG
CARA_YERPS      -------------------MIKSALLVLEDGTQFHGRAIGA---EGTAVGEVVFNTSMTG
CARA_PECAS      -------------------MIKSALLVLEDGTQFHGRAIGA---EGLAVGEVVFNTSMTG
CARA_PHOLL      -------------------MIKSAILVLEDGTQFHGRAIGA---EGAAVGEVVFNTSMTG
CARA_VIBVU      -------------------MSKSALLVLEDGTVFRGVSIGA---DGISVGEVVFNTSMTG
CARA_VIBVY      -------------------MSKSALLVLEDGTVFRGVSIGA---DGISVGEVVFNTSMTG
CARA_VIBPA      -------------------MSKLALLVLEDGTVFRGVSIGA---DGVSVGEVVFNTSMTG
CARA_VIBCH      -------------------MSKSALLVLEDGTVFRGVSIGA---DGISVGEVVFNTSMTG
CARA_PHOPR      -------------------MSKSALLVLEDGTVFRGISIGA---DGSAIGEVVFNTSMTG
CARA_SHEON      ---------------MEVALTKSALLVLEDGTVFTGTAIGA---DGLSVGEVVFNTSMTG
CARA_PSEAE      -------------------MTKPAILALADGSIFRGEAIGA---DGQTVGEVVFNTAMTG
CARA_PSEST      ---------------MTKPATTPAILALADGSIFRGESIGA---DGQTIGEVVFNTAMTG
CARA_PSESM      -------------------MTKPAILALADGSIFRGEAIGA---DGQTVGEVVFNTAMTG
CARA_PSEPK      -------------------MTKPAILALADGSIFRGEAIGA---DGQTVGEVVFNTAMTG
CARA_HALER      -------------------MSKPAILALEDGSVFHGTAIGA---DGQTSGEVVFNTAMTG
CARA_ACIAD      -------------------MSTPAILALADGTIFKGTSIGA---TGSTTGEVVFNTAMTG
CARA_NEIMB      -------------------MSTPALLVLADGSVFHGTSIGY---EGSTSGEVVFNTSMTG
CARA_NEIMA      -------------------MSTPALLVLADGSVFHGTSIGY---EGSTSGEVVFNTSMTG
CARA_NEIGO      -------------------MNTPALLVLADGSVFHGTSIGY---EGSASGEVVFNTSMTG
CARA_PASMU      -------------------MSEPAILVLADGSVFHGTSIG---AKGHTVGEVVFNTAMTG
CARA_HAEDU      -------------------MFNPAILVLADGSTFYGKSIGYQAVSAYSIGEVVFNTAMTG
CARA_RALSO      ----------------MLPSFPPAILALADGTVFRGYSIGA---AGHTIGEVVFNTAITG
CARA_RUBGI      ----------------MLPVLPPALLALADGTTFLGTSIGA---PGRTVGEVVFNTALTG
CARA_XANAC      -------------------MTQPAILVLEDGTVFEGESVGA---NGLSVGEVVFNTAMTG
CARA_XANCP      -------------------MTQPAILVLEDGTVFEGESVGA---NGLSVGEVVFNTAMTG
CARA_XYLFA      -------------------MTEPAILVLEDGTVFEGDAVGA---NGLSVGEVVFNTSLTG
CARA_XYLFT      -------------------MTEHAILVLEDGTVFEGDAVGA---NGLSVGEVVFNTALTG
CARA_BUCAI      ---------------MEGVLSQLAVLVLEDGTKFHGRAIGA---KGITVGEVVFNTSITG
CARA_BUCAP      ---------------MEDALGQLAVLVLEDGTRFHGRSIGA---KGTTVGEVVFNTSITG
CARA_BUCBP      ---------MKHVLRKEKTLEISATLVLKDGTIFYGKSVGI---QGETYGEIVFNTSMTG
CARA_WIGBR      ---------------MENILLNKALLILEDGTKFYGNSIGA---KGTSIGEVIFNTSITG
CARA_RHIME      ----------MTATPAWTIQKPTALLVLADGTVIEGKGIGA---TGTVQAEVCFNTALTG
CARA_AGRFC      ----------MTETAPWTTRKPTAMLVLADGTVIEGTGIGA---TGKVQAEVCFNTALTG
CARA_RHILO      ------------MTPAWATEKPTALLVLADGTVIEGRGLGA---TGSAVAEVCFNTALTG
CARA_BRUSU      ------MTETTPKTAPWTVQKRTAVLVLADGTVIEGKGLGA---TGAVEAEVVFNTALTG
CARA_BRUME      ------MTETTPKTAPWTVQKRTAVLVLADGTVIEGKGLGA---TGAVEAEVVFNTALTG
CARA_BRADU      -------MTQHDNDPAWPDHKPTALLVLADGTVLEGFGLGA---EGHAVGEVCFNTAMTG
CARA_CAUVC      -------------MSQDLLPGVTGVLALADGAILQGVGCGA---VGDAVGEVCFNTAMTG
CARA_ZYMMO      -------------------------MVLADGQMIWGRGFGA---TGAKVGEVCFHTAMTG
CARA_STRAW      -----MTTSTRGAAKVP------AVLVLEDGRTFRGRAYGA---VGVTFGEAVFSTGMTG
CARA_STRCO      -----MTTSTRGAHRTP------AVLVLEDGRIFRGRAYGA---VGATFGEAVFSTGMTG
CARA_BIFLO      -----MSQNESGTIAIPMYDKDDAVLVLEDGQVYVGKPYGA---LGETTGEIVFATGMTG
CARA_MYCTU      --------------------MSKAVLVLEDGRVFTGRPFGA---TGQALGEAVFSTGMSG
CARA_MYCBO      --------------------MSKAVLVLEDGRVFTGRPFGA---TGQALGEAVFSTGMSG
CARA_MYCPA      -------------------MSGKAQLVLEDGRVFTGTAFGA---IGQTLGEAVFSTGMSG
CARA_MYCLE      --------------------MSKALLVLEDGRVFTGMPFGA---IGQTLGEAVFSTGMSG
CARA_CORGL      -----MSKDTTTYQGVTEIGSVPAYLVLADGRTFTGFGFGA---IGTTLGEAVFTTAMTG
CARA_COREF      MSNETNANSTDSRQGVTNIGSVPAYLVLADGRTFKGFGFGA---IGTTLGEAVFTTAMTG
CARA_CORDI      ---------------MTSQDRSEAVLVLADGRIFKGESFGA---EGATLGEAVFTTAMSG
CARA_NOSS1      ---------------MPLSDAMPALLVLADGTAYRGWSFG---ATGTTIGEVVFNTGMTG
CARA_SYNY3      ---------------MPIAAAKPALLVLADGTPYPGWSFG---ADGTTVGEVVFNTGMTG
CARA_THEVB      -------------------MPTPALLVLADGSVFRGFSFG---APGTAIGEVVFNTGMTG
CARA_PARMW      ---------------MPHPSSRQAHLVLADGTVLTGDAFG---HRGSVVGEVVFNTGMTG
CARA_PORPU      -----------------MIKKIPAILVLEDGTYYKGWSFQAD-QSIVTIGEVVFNTGMTG
CARA_NEOYE      -----------------MMKRIPAILVLEDGAYYKGWSFQQD-KQEITIGEVVFNTGMTG
CARA_GRATL      ----------------MTYNLHPAILVLKDGKFYRGWTLI---NSIISFGEVVFNTGMTG
CARA_CYACA      -----------MEKFKLLKLGKPATLLLEDGTVFRGKSFS---NPQTVTGEIVFNTGMTG
CARA_LEPIN      ---------------------MKAFLVLDNGTIFEGESFG---YETESVGEIVFNTSMAG
CARA_LEPIC      --------------------MMKAFLVLDNGTIFEGESFG---YETESVGEIVFNTSMAG
CARA_HELPJ      ----------------------MVSLYLENGLFLQAQSFG---ASGTQVGELVFNTSMSG
CARA_HELPY      ----------------------MVSLYLENGLFLQAQSFG---ASGTQAGELVFNTSMSG
CARA_CAMJE      ---------------------MKAYIYLENDIFLSAKAFG---KSGTFFGELVFNTSLTG
CARA_HELHP      -----------------MSILKEAYLYFANGLFFKAQSFG---SDGTFVGEVVFNTSMSG
CARA_CHLTE      ------------------MQEIPAILVLENGSVYRGTAFGH---AGEATGEVVFNTSLTG
CARA_RHOBA      ---------------MMSSPAKAAKLALEDGTVYTGTSLGA---EGETTGEVVFNTSMTG
CARA_AQUAE      -------------------MRKTAILALEDGSYFVGYSFGA---EGETGGELVFNTSMTG
CARA_DESVM      ---------------------MRAFLALEDGFVLEGRSFTG---RGESGGEVIFNTGMTG
CARA_DEIRA      -----------------MIRKERAILALEDGTVYRGYAFGY---RGETVGEVVFNTSMTG
CARA_THET2      ----------------MAGVKERAVLVLEDGTVYHGYAFGA---RGKTVGEVVFNTAQTG
CARA_BACCL      ---------------------MKRQLILEDGSFFVGERFGS---LKETTGEVVFNTGMTG
CARA_BACSU      ---------------------MKRRLVLENGAVFEGEAFGS---LEHNMGEVVFNTGMTG
CARA_BACHK      ---------------------MKRQLILEDGTVLIGTGFGG---EIEKSGEVVFTTGMTG
CARA_BACAN      ---------------------MKRQLILEDGTVLIGTGFGG---EIEKSGEVVFTTGMTG
CARA_BACCZ      ---------------------MKRQLILEDGTVLIGTGFGG---EIEKSGEVVFTTGMTG
CARA_BACC1      ---------------------MKRQLILEDGTVLIGTGFGG---EIEKSGEVVFTTGMTG
CARA_BACCR      ---------------------MKRQLILEDGTVLIGTGFGG---EIEKSGEVVFTTGMTG
CARA_ALKHC      ---------------------MKRQLILEDGSVFVGKGFGS---DREMSGEVVFNTGMTG
CARA_OCEIH      --------------------MKKRKLILEDGTVFNGTAFGS---DAESSGEIVFNTGMTG
CARA_FUSNN      --------------------MYNRQLILEDGTVYKGYAFGA---DVENVGEVVFNTSMTG
CARA_LISMF      --------------------MTKRILMLEDGNYFIGDAIGS---EKETIGEVVFNTGMTG
CARA_LISMO      --------------------MTKRILMLEDGNYFIGDAIGS---EKETIGEVVFNTGMTG
CARA_LISIN      --------------------MTKRILMLEDGNYFIGDAIGS---EKETIGEVVFNTGMTG
CARA_STAEQ      -------------------MLEKRYLVLEDGSYYEGYRLGS---DDLSIGEIVFNTAMTG
CARA_STAES      -------------------MLEKRYLVLEDGSYYEGYRLGS---DDLSIGEIVFNTAMTG
CARA_STAHJ      -------------------MLERRYLVLEDGTYYEGYKLGS---NDLSVGEIVFNTAMTG
CARA_STAS1      -------------------MLKKRYLVLEDGSYYEGYPIGS---DQLTLGEIVFNTAMTG
CARA_STAAN      -------------------MQSKRYLVLEDGSFYEGYRLGS---DNLTVGEIVFNTAMTG
CARA_STAAM      -------------------MQSKRYLVLEDGSFYEGYRLGS---DNLTVGEIVFNTAMTG
CARA_STAAS      -------------------MQSKRYLVLEDGSFYEGYRLGS---DNLTVGEIVFNTAMTG
CARA_STAAC      -------------------MQSKRYLVLEDGSFYEGYRLGS---DNLTVGEIVFNTAMTG
CARA_STAAW      -------------------MQSKRYLVLEDGSFYEGYRLGS---DNLTVGEIVFNTAMTG
CARA_STAAR      -------------------MQSKRYLVLEDGSFYEGYRLGS---DNLTVGEIVFNTAMTG
CARA_STRP1      --------------------MTKRLLILEDGTIFEGEPFGA---DIDVTGEIVFNTGMTG
CARA_STRP6      --------------------MTKRLLILEDGTIFEGEPFGA---DIDVTGEIVFNTGMTG
CARA_STRP3      --------------------MTKRLLILEDGTIFEGEPFGA---DIDVTGEIVFNTGMTG
CARA_STRP8      --------------------MTKRLLILEDGTIFEGEPFGA---DIDVTGEIVFNTGMTG
CARA_STRMU      --------------------MGKRLLILEDGTIFEGQAFGA---DLDVTGEIVFNTGMTG
CARA_STRPN      --------------------MTKRILVLEDGTVFEGKAFGA---DIDVTGEIVFNTGMTG
CARA_STRR6      --------------------MTKRILVLEDGTVFEGKAFGA---DIDVTGEIVFNTGMTG
CARA_STRA3      ---------------------MKRLLLLEDGSVFEGEAFGA---DVETSGEIVFSTGMTG
CARA_STRA5      ---------------------MKRLLLLEDGSVFEGEAFGA---DVETSGEIVFSTGMTG
CARA_LACLA      --------------------MSKRLLILEDGTIFEGESLGA---NLDVTGELVFNTGMTG
CARA_LACLM      --------------------MSKRLLILEDGTIFEGEALGA---NLDVTGELVFNTGMTG
CARA_LACPL      ---------------------MKRYLVLEDGTIYPGTGFGA---TTATVGELVFNTGMSG
CARA_SYMTH      ---------------------------MEDGTLFAGAGFGA---PAVQAGEVVFNTGMTG
CARA_CALS4      ---------------------MKGYLKLEDGSIFEGELISK---NKKGYGEVVFTTGMTG
CARA_CLOAB      ---------------------MKGIIYLEDGTVFYGTGFGK---EGNEFGEIVFNTSMTG
CARA_CLOPE      ---------------------MKAKLILENGVVFEGKAFGY---LKECVGEVVFNTGMTG
CARX_BACSU      ---------------------MEGYLVLEDGTSFSGELDG----HENCTGEAVFFTGMTG
CARX_GEOSE      ---------------------MKAYLHVASGKTFSGELAAPL--EEKVSGEIVFFTGMTG
CARX_ALKHC      ---------------------MKAYLVLATGETFAGEIANA---KEDVYGEVVFFTGMTG
CARX_LACPL      ---------------------MNKYLTLADGTQWIGTAIGDC--QLEAAGRIVFNTGMTG
CARA_ARCFU      ---------------------MKAALALEDGTYLEGKAFGA---ERGGLGEIVFCTSMTG
CARA_METKA      ---------------------MRAALALEDGTIVHGELFGS---PREAEGEVVFNTSHTG
CARA_METAC      ---------------------MKAVLGLEDGTVIRGTGFGA---EGTACGELVFTTQFTG
CARA_METTH      -------------------MFKEAKLALEDGTIIRGEAFGS---ETVKTGEVVFATGMTG
CARA_METJA      ---------------------MEAVLILEDGTILKGKGFGA---EKEVFGELVFTTVMTG
CARA_HALSA      --------------------MSDAYLALETGDVVEATARAP----GMARGELVFTTAYTG
CARA_THEAC      ---------------------MKRYLITSDGTVIAGYGYGS---PVTGYGELVFTTSMTG
CARA_THEVO      ---------------------MKKYLVMEDGTVLSGQGYGS---YKEAYGELVFTTSMTG
                                              .    .             ..  * *   *

CARA_SACS2      YVESLTDPSYKGQILIITHPLVGNYGVPEK-KYEQGILTNFESE----RIQVEGLIVAEH
CARA_SULTO      YPESLTDPSYRGQILVITHPLVGNYGVPEK-QRVEGILTNFESE----QIQVEGLVVSEE
CARA_PYRFU      YPESLTDPSYKGQILIATNPLMGTYGVSSKSLKEHGLPLHYESD----SIKVEGFVISFL
CARA_PYRAE      YPQTLTDPSYKGQIITFTMPLIGNYGVSED---------QLESD----GIKAEGVVLFEA
CARA_SALTY      YQEILTDPSYSRQIVTLTYPHIGNVGTNKA---------DEES----SQVHAQGLVIRDL
CARA_SALTI      YQEILTDPSYSRQIVTLTYPHIGNVGTNEA---------DEES----SQVHAQGLVIRDL
CARA_ECOLI      YQEILTDPSYSRQIVTLTYPHIGNVGTNDA---------DEES----SQVHAQGLVIRDL
CARA_ECO57      YQEILTDPSYSRQIVTLTYPHIGNVGTNDA---------DEES----SQVHAQGLVIRDL
CARA_ECOL6      YQEILTDPSYSRQIVTLTYPHIGNVGTNDA---------DEES----SQVHAQGLVIRDL
CARA_YERPE      YQEILTDPSYSRQIVTLTYPHIGNVGTNAS---------DEES----SAVHAQGLVIRDL
CARA_YERPS      YQEILTDPSYSRQIVTLTYPHIGNVGTNAS---------DEES----SAVHAQGLVIRDL
CARA_PECAS      YQEILTDPSYSRQIVTLTYPHIGNVGANAN---------DEES----PSVQAQGLVIRDL
CARA_PHOLL      YQEILTDPSYSRQIVTLTYPHIGNVGVNSV---------DKES----LKVQAQGLVIRDL
CARA_VIBVU      YQEILTDPSYSQQIVTLTYPHIGNTGTTSE---------DEES----SSIHAQGLVIRDL
CARA_VIBVY      YQEILTDPSYSQQIVTLTYPHIGNTGTTSE---------DEES----SSIHAQGLVIRDL
CARA_VIBPA      YQEILTDPSYSQQIVTLTYPHIGNTGTNSE---------DEES----SSIHAQGLVIRDL
CARA_VIBCH      YQEILTDPSYSQQIVTLTYPHIGNTGTNSE---------DEES----TAIHAQGLVIRDL
CARA_PHOPR      YQEILTDPSYSQQIVTLTYPHIGNTGTNSE---------DEES----NSIHAQGLVIRDL
CARA_SHEON      YQEILTDPSYSRQIVTLTYPHIGNTGTNNE---------DVES----NGVHACGLIIRDL
CARA_PSEAE      YQEILTDPSYAQQIVTLTYPHIGNTGTTPE---------DAEA----NRVWAAGLIIRDL
CARA_PSEST      YQEILTDPSYAKQIVTLTYPHVGNTGTTPQ---------DAES----WKVWAAGLVIRDL
CARA_PSESM      YQEILTDPSYAQQIVTLTYPHIGNTGTTPE---------DAES----DRVWSAGLVIRDL
CARA_PSEPK      YQEILTDPSYAQQIVTLTYPHIGNTGTTPE---------DAES----SRVWSAGLVIRDL
CARA_HALER      YQEILTDPSYSRQIVTLTYPHIGNTGVNSE---------DVES----SSIAAAGLVIRDL
CARA_ACIAD      YQEILTDPSYAQQLVTLTYPHIGNTGCNEE---------DTESGR-IHKVWANGLIIRDL
CARA_NEIMB      YQEILTDPSYCKQIVTLTYPHIGNTGTNAE---------DEES----RSVYAAGLIIRDL
CARA_NEIMA      YQEILTDPSYCKQIVTLTYPHIGNTGTNAE---------DEES----RSVYAAGLIIRDL
CARA_NEIGO      YQEILTDPSYCKQIVTLTYPHIGNTGTNAE---------DEES----RSVYAAGLIIRDL
CARA_PASMU      YQEILTDPSYFRQIVTLTYPHIGNTGTNLE---------DCEA----NHVYASGLIIRDL
CARA_HAEDU      YQEILTDPSYAKQIVTLTYPHIGNTGTNDE---------DNES----NQIYASGLIIRDL
CARA_RALSO      YQEILTDPSYSRQIVTLTYPHIGNVGVNRE---------DVEA----TKVHAAGLIIKDL
CARA_RUBGI      YQEILTDPSYCRQIVTLTYPHIGNVGVNEE---------DVEA----AKVHAAGLVIKDL
CARA_XANAC      YQEVLTDPSYARQMVTLTYPHIGNTGFTDQ---------DDEA----RKIWAAGLIVRDV
CARA_XANCP      YQEVLTDPSYARQMVTLTYPHIGNTGFNDQ---------DDEA----KQVWAAGLIVRDV
CARA_XYLFA      YQEVLTDPSYAYQLVTLTYPHIGNTGCTDQ---------DDEA----NKVWAAGLIVRDV
CARA_XYLFT      YQEILTDPSYAYQLVTLTYPHIGNTGCTDQ---------DDEA----NKVWAAGLIVRDV
CARA_BUCAI      YQEIITDPSYSHQIVTLTHPHIGNVGTNSN---------DEES----SKIYIKGLIIRDL
CARA_BUCAP      YQEIITDPSYSHQIVTLTHPHIGNIGTNCN---------DEES----SKIHIRGLIIRDM
CARA_BUCBP      YQEILTDPSYSNQIITFTYPHIGNVGINKN---------DCES----NVIHAKGLIVRDI
CARA_WIGBR      YQEIITDPSYFNQIVAFTYPHIGNIGIEIN---------NNES----SKIQVKAVILYQT
CARA_RHIME      YQEILTDPSYLGQIVTFTFPHIGNIGANDE---------DIEDLTPAARHGAVGVIFKAD
CARA_AGRFC      YEEILTDPSYLGQIVTFTFPHIGNVGTNEE---------DIEDLTPAARRGAVGVIFKAD
CARA_RHILO      YQEILTDPSYAGQIVTFTFPHIGNIGTNGE---------DIEDLNPAARAGAVGAVFKAD
CARA_BRUSU      YEEILTDPSYAGQIVTFTFPHIGNVGANAE---------DIEDLTPANRHGAVGAIFKAD
CARA_BRUME      YEEILTDPSYAGQIVTFTFPHIGNVGANAE---------DIEDLTPANRHGAVGAIFKAD
CARA_BRADU      YEEILTDPSYAGQLITFTFPHIGNVGTNEE---------DIETVNMAATPGARGVILRTA
CARA_CAUVC      YQEILTDPSYMAQIVAFTFPHVGNVGVNGE---------DVEQITGVAETAARGALFRDV
CARA_ZYMMO      YEEIMTDPSFASQIINFTFPHIGNVGANRE---------DVE----AKTLHALGCIVRED
CARA_STRAW      YQETLTDPSYHRQVVVMTAPHVGNTGVNDE---------DPESK----RIWVSGYVVRDP
CARA_STRCO      YQETLTDPSYHRQVVVMTAPHVGNTGINDE---------DMESR----RIWVSGYVVRDP
CARA_BIFLO      YQETLTDPSYDRQIVVQTFPHIGDTGVNSE---------DPESS----RIWVAGYIVRDP
CARA_MYCTU      YQETLTDPSYHRQIVVATAPQIGNTGWNGE---------DSESRG--ERIWVAGYAVRDP
CARA_MYCBO      YQETLTDPSYHRQIVVATAPQIGNTGWNGE---------DSESRG--ERIWVAGYAVRDP
CARA_MYCPA      YQETLTDPSYHRQIVVATAPQIGNTGWNGE---------DAESRG--DKIWVAGYAVRDP
CARA_MYCLE      YQETLTDPSYHRQIVVATAPQIGNTGWNDQ---------DGESRD--DRIWVAGYAVRDP
CARA_CORGL      YQETMTDPSYHRQIVVATAPQIGNTGWNDE---------DNESRD--GKIWVAGLVIRDL
CARA_COREF      YQETMTDPSYHRQIVVATAPQIGNTGWNEE---------DNESHD--GSIWVAGLVIRDL
CARA_CORDI      YQETMTDPSYHRQIVVATAPQIGNTGWNDE---------DGESHG--DKIWVAGLVIRDL
CARA_NOSS1      YQEVLTDPSYRGQIVVFTYPELGNTGVNPE---------DEESA----RPQVRGAIARNI
CARA_SYNY3      YQEVMTDPSYCGQIVTFTYPELGNTGVNAE---------DEESI----HPHVKGVVARNI
CARA_THEVB      YQEVLTDPSYYGQIVTFTYPELGNTGTTPE---------DDESD----RPQVRGAVARNI
CARA_PARMW      YQEVLTDPSYAGQLVTFTYPELGNTGVNGD---------DQEAD----HPHARGVIARQL
CARA_PORPU      YQEIITDPSYFQQIVTFTYPEIGNTGINSE---------DIESQ----TISIKGLVAKNI
CARA_NEOYE      YQEIITDPSYFHQIVAFTYPEIGNTGINNQ---------DIESH----SISIKGLIAKNI
CARA_GRATL      YQEIMTDPSYAEQIITFTYPEIGNTGINHE---------DNESN----KIHVKGIITKNI
CARA_CYACA      YQEIFTDPSYNEQLVVLTYPEIGNTGTNLD---------DYESL----KIQAKGIILKNL
CARA_LEPIN      YQEILTDPSYCNQIITLTYPMIGNYGIHPD---------NMESS----KIQASGLIVKEY
CARA_LEPIC      YQEILTDPSYCNQIITLTYPMIGNYGIHPD---------NMESS----KIQASGLIVKEY
CARA_HELPJ      YQEVISDPSYKGQFVVFSMPEIGVVGANPK---------DDES-----FFSCAGVLARHY
CARA_HELPY      YQEVISDPSYKGQFVVFSMPEIGVVGANSK---------DDES-----FFSCAGVLARHY
CARA_CAMJE      YQEIISDPSYAGQFIVFSMPEIGIVGTNEN---------DNESK----EIFASGVLMREL
CARA_HELHP      YQEVITDPSYSGQFIVFSMPEIGIVGVNNQ---------DSESP----RAACTGVILSSY
CARA_CHLTE      YQEILTDPSYTGQMVVMTYPLIGNYGITPN---------DNESK----KIWASALIVREA
CARA_RHOBA      YQEILTDPSYRGQLVTMTYPEMGNYGINSI---------DLENR----GTSLAGFIIRNE
CARA_AQUAE      YQEILTDPSYKGQIVVMTYTQIGNYGVNDE---------DIESK----SVQVNGFVVKEA
CARA_DESVM      YQEVLTDPSYAGQMVCMTYPLIGNYGVTAE---------DMESG----KVHVEAFIVKEC
CARA_DEIRA      YQEIMTDPSYNGQIVTITYPHVGNYGVAIY---------DMESN----KPYVRGFISREF
CARA_THET2      YQEIMTDPSYHGQIVVMTYPHQGNYGVNVY---------DMQSN----RPWVRGFVAKEF
CARA_BACCL      YQEILSDPSYCGQIVTMTYPLIGNYGINRD---------DFEAI----RPHVHGFIVKEA
CARA_BACSU      YQEILSDPSYCGQIVTLTYPLIGNYGINRD---------DFESI----TPFVKGLIIKEL
CARA_BACHK      YQETLSDPSYCGQIVTFTYPLIGNYGINRD---------DFESI----HPSVNGLIVNEI
CARA_BACAN      YQETLSDPSYCGQIVTFTYPLIGNYGINRD---------DFESI----HPSVNGLIVNEI
CARA_BACCZ      YQETLSDPSYCGQIVTFTYPLIGNYGINRD---------DFESI----HPSVNGLIVNEI
CARA_BACC1      YQETLSDPSYCGQIVTFTYPLIGNYGINRD---------DFESI----HPSVNGLIVNEI
CARA_BACCR      YQETLSDPSYCGQIVTFTYPLIGNYGINRD---------DFESI----HPSVNGLIVNEI
CARA_ALKHC      YQEMLSDPSYCGQIVTLTYPLIGNYGINRD---------DFESM----NPAIHGLIVKEA
CARA_OCEIH      YQEVITDPSYCGQFVTLTYPLIGNYGINRD---------DFETV----TPFIHGLVVKEY
CARA_FUSNN      YQEILSDPSYNGQIVTLTYPLIGNYGINRD---------DFESM----KPCIKGMVVKEV
CARA_LISMF      YQETITDPSYYGQIITFTYPLVGNYGVNRD---------DFESI----NPAVKGVVVREA
CARA_LISMO      YQETITDPSYYGQIITFTYPLVGNYGVNRD---------DFESI----NPAVKGVVVREA
CARA_LISIN      YQETITDPSYYGQIITFTYPLVGNYGVNRD---------DFESI----NPAVKGVVVREA
CARA_STAEQ      YQETISDPSYTGQIITFTYPLIGNYGINRD---------DFESL----TPKLNGVVVKEA
CARA_STAES      YQETISDPSYTGQIITFTYPLIGNYGINRD---------DFESL----TPKLNGVVVKEA
CARA_STAHJ      YQETISDPSYTGQIITFTYPLIGNYGINRD---------DFEAL----TPTLNGVVVKEA
CARA_STAS1      YQETISDPSYTGQIITFTYPLIGNYGINRD---------DFEAL----VPTLNGVVVKEA
CARA_STAAN      YQETISDPSYTGQIITFTYPLIGNYGINRD---------DFESL----VPTLNGIVVKEA
CARA_STAAM      YQETISDPSYTGQIITFTYPLIGNYGINRD---------DFESL----VPTLNGIVVKEA
CARA_STAAS      YQETISDPSYTGQIITFTYPLIGNYGINRD---------DFESL----VPTLNGIVVKEA
CARA_STAAC      YQETISDPSYTGQIITFTYPLIGNYGINRD---------DFESL----VPTLNGIVVKEA
CARA_STAAW      YQETISDPSYTGQIITFTYPLIGNYGINRD---------DFESL----VPTLNGIVVKEA
CARA_STAAR      YQETISDPSYTGQIITFTYPLIGNYGINRD---------DFESL----VPTLNGIVVKEA
CARA_STRP1      YQESITDQSYNGQILTFTYPLIGNYGINRD---------DYESI----SPTCKGVVVSEV
CARA_STRP6      YQESITDQSYNGQILTFTYPLIGNYGINRD---------DYESI----SPTCKGVVVSEV
CARA_STRP3      YQESITDQSYNGQILTFTYPLIGNYGINRD---------DYESI----SPTCKGVVVSEV
CARA_STRP8      YQESITDQSYNGQILTFTYPLIGNYGINRD---------DYESI----SPTCKGVVVSEV
CARA_STRMU      YQESITDQSYNGQILTFTYPLVGNYGINRD---------DYESI----KPTCKGVVVSEN
CARA_STRPN      YQESITDQSYNGQILTFTYPLVGNYGINRD---------DYESI----IPTCKGVVVFEE
CARA_STRR6      YQESITDQSYNGQILTFTYPLVGNYGINRD---------DYESI----IPTCKGVVVFEE
CARA_STRA3      YQESITDQSYNGQIITFTYPLIGNYGINRD---------DYESI----RPTCKGVVIYEW
CARA_STRA5      YQESITDQSYNGQIITFTYPLIGNYGINRD---------DYESI----RPTCKGVVIYEW
CARA_LACLA      YQESITDQSYNGQILTFTYPIVGNYGVNRD---------DYESI----HPTCKAVVVHEA
CARA_LACLM      YQESITDQSYNGQILTFTYPIVGNYGVNRD---------DYESI----HPTCKAVVVHEA
CARA_LACPL      YQESITDQSYNGEILMFTYPLIGNYGINRD---------DHESI----KPTCKGVVVHEV
CARA_SYMTH      YQEVVTDPSYYGQIVVMTYPLIGNYGVTAA---------DGESR----QPWIRGLVVKEL
CARA_CALS4      YQEAITDPSYAGQIVVMTYPLIGNYGINKY---------DFQSE----KPHIRGFVVREY
CARA_CLOAB      YQEILTDPSYAGQIINMTYPLIGNYGVNES---------VNQSK----CVYAKGFIVKNI
CARA_CLOPE      YQEVLTDPSYYGQIVTMTYPLIGNYGINLE---------DLESK----EPKVRGFIVREK
CARX_BACSU      YQEVLTDPSYKGQIIVFTYPLIGNYGINEK---------DFESK----KPQVKAAVVYEA
CARX_GEOSE      YQEVLTDPSYKNQIIVFTYPLIGNYGINEN---------DFESK----RPHVEAVVVYEA
CARX_ALKHC      YQEVLSDPSFKGQLVVFTYPLIGNYGINAS---------DFESK----EPQAAGLIVSEQ
CARX_LACPL      YQETLTDPSYLNQMIAFTYPLIGNYGIDPT---------VAQAP----TIGAQAIIVHEL
CARA_ARCFU      YVEALTDPSYKGQILMMTYPLIGNYGVNRE---------DFESD----GVKVEGFVVKEL
CARA_METKA      FQEALTDPSYRGQILIMTFPMQGNYGILPE---------VGESD----RVQVEGFVVRYL
CARA_METAC      YEEALTDPSYKGQILMFTYPLIGNYGVSGE---------RFQSD----NIHAEGLVVREA
CARA_METTH      YVESLTDPSYRGQILMPTYPLQGNYGVTEE---------WYQSD----GIKAEGLIVREM
CARA_METJA      YVEVLTDPSYKGQIVMMTYPLEGNYGVKKD---------WFESD----GIKAEGFVVREV
CARA_HALSA      YEESLTDPSYEAQVLTFAYPLIGNYGVRPE---------RTESD-------------RVH
CARA_THEAC      YLESMTDPSYVGQILVFASPTIANYELRKG---------VMESD----RVKVSGIVTRDA
CARA_THEVO      YLETLTDPSYVGQMLVFASPTIANYALEMG---------KMESN----GVKVSALITKDA
                : : .:* *:  :.:  : .  .                  :                  

CARA_SACS2      T-YPSKWNSALTLDEWLKSENVPGVFDVDTRMIVKKIRTYGTMMG-IIASE---------
CARA_SULTO      T-DPFKWNSSKSLHEWLLSEGVPGLSDVDTRSIVKKVRSRGVMMG-VIASG---------
CARA_PYRFU      M-RPNHWSSEMTLDEWLRREGVPGLYGVDTRALVKKIREEGVMRGAIVTTE---------
CARA_PYRAE      T-FPSHYKSVMSLEEWLASSGVPGVARVDTRALVQMLREHGVMMGAIGPED---------
CARA_SALTY      PLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIA-------GDSP
CARA_SALTI      PLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIA-------GDSP
CARA_ECOLI      PLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIA-------GDNP
CARA_ECO57      PLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIA-------GDNP
CARA_ECOL6      PLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIA-------GDNP
CARA_YERPE      PLIASNYRNEEGLSEYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIV-------GELS
CARA_YERPS      PLIASNYRNEEGLSEYLKRHNIVAIADIDTRKLTRLLREKGAQNGCIIV-------GELS
CARA_PECAS      PLIASNYRSEESLSEYLKRNNIVAIADIDTRKLTRLLREKGAQNGCIIA-------GDAP
CARA_PHOLL      PLLTSNFRCEETLSDYLKRHNIVAIADIDTRKLTRLLREKGSQNGCIIA-------GKQI
CARA_VIBVU      PLIASNFRSEQSLSDYLKSQNIVGIADIDTRKLTRILREKGAQNGCIVA-------GNNL
CARA_VIBVY      PLIASNFRSEQSLSDYLKSQNIVGIADIDTRKLTRILREKGAQNGCIVA-------GNNL
CARA_VIBPA      PLIASNFRNEQSLSDYLKSQNIVGIADIDTRKLTRILREKGAQNGCIVA-------GNNL
CARA_VIBCH      PLIASNFRSEQSLSDYLKSQNIVGIADIDTRKLTRILREKGAQNGCIMA-------GDNL
CARA_PHOPR      PLLASNFRNERSLSDYLKSQNIVGIAEIDTRKLTRILREKGAQNGCIMA-------GDNL
CARA_SHEON      PLIASSFRNQQNLSDYLKANNVVGIADIDTRKLTRILREKGAQAGCIMA-------GADL
CARA_PSEAE      PLIASNWRSKQSLPDYLKANGTVAIAGIDTRRLTRILREKGSQNGCILA-------GADA
CARA_PSEST      PLLASNWRNKQSLPDYLKENDTVAIAGIDTRRLTRILREKGAQNGCILA-------GADA
CARA_PSESM      PLVASNWRNKMSLGDYLKANNVVAIAGIDTRRLTRILREKGAQNGCIMA-------GDNI
CARA_PSEPK      PLLASNWRNTQSLPEYLKANNVVAIAGIDTRRLTRILREKGAQNGCILA-------GDNI
CARA_HALER      PLLASSFRCEQSLSDYLAQQNVLGIADMHTRRLTRLLRDKGSQNGAILA-------GPDA
CARA_ACIAD      PLLHSNFRSEQSLAEYLIQHNVVAIADIDTRKLTRILRDKGAQNGCILA-------GENI
CARA_NEIMB      PLLHSNFRASESLHDYLVRNKTVAIADIDTRRLTTLLREKGAQGGAILT-------GADA
CARA_NEIMA      PLLHSNFRASESLHDYLVRNKTVAIADIDTRRLTTLLREKGAQGGAILT-------GADA
CARA_NEIGO      PLLHSNFRASESLHDYLVRNETVAIADIDTRRLTMLLREKGAQGGAILT-------GADA
CARA_PASMU      PLLHSNFRSSMSLRDYLQTHNVVAIADIDTRRLTRILRDKGAQAGCIMT-------GEID
CARA_HAEDU      PLLHSNFRATSSLSDYLIQHNIIAIADIDTRRLTRILRETGSQAGCIYI-------PNEN
CARA_RALSO      PILASNFRQEHSLSHYLKGEKVVAIAGIDTRKLTRILREKGAQNGCVLA-------GEDN
CARA_RUBGI      PLRVSNFRAAMPLSQYLEREGTVAIAGIDTRRLTRVLRTTGAQNGCIVSFAPGTVVGEAE
CARA_XANAC      PRRPSNWRSQVALPEWLQARGVVAISGIDTRKLTRLLRQKGAQNGALMA-------GDID
CARA_XANCP      PRRPSSWRNQVALPAWLQTRGVVAISGIDTRKLTRLLREKGAQNGALMA-------GEID
CARA_XYLFA      PRRPSNWRSQISLSDWLAARGVVAIAGIDTRKLTRILREKGAQHGALMA-------GEID
CARA_XYLFT      PRRPSNWRSQISLSDWLAARGVVAIAGIDTRKLTRILREKGAQHGALMA-------GEID
CARA_BUCAI      SLTASNYRNKKSFSSYLKENNIIAISDIDTRKLTRILRTKGSQNGCIIE-------DKKQ
CARA_BUCAP      SPISSNYRSEKSFSSYLKENNIVAISDIDTRKLTRILRTKGSQNGCIIE-------DKKE
CARA_BUCBP      SSIYSNHRSQMSLLNYLLNQKIIVISNIDTRKLTRILRTTGSQYGYIT--------TKKI
CARA_WIGBR      HNIISDFRNKLSFSRFLLLNNIIGISGIDTRKLTRLIRKSGTQYGYVSSE------GTNI
CARA_RHIME      ITEPSNYRAAKHLDAWLKARGIIGLCGIDTRALTAWIRENGMPNAVIAH-------DPAG
CARA_AGRFC      ITDPSNFRAVKHLDAWLKARGVIGLCGIDTRALTAWIRENGAPNAVIAH-------DPNG
CARA_RHILO      VTNPSNYRAAGHLDQWLKKRGIVALSGIDTRALTALIREKGMPNAVIAH-------APDG
CARA_BRUSU      ITAPSNFRAAEDLDSWLKHRGIIALAGIDTRALTALIRERGAQNAVIAH-------DPNG
CARA_BRUME      ITAPSNFRAAKDLDSWLKHRGIIALAGIDTRALTALIRERGAQNAVIAH-------DPNG
CARA_BRADU      ITDPSNYRATKHLDAWLKARGIIGLSGIDTRALTALIRSKGMPNAVIAH-------ARNG
CARA_CAUVC      PTVQANWRADGDFDAWMKARGVVGLAGVDTRALTRKIRETGMPHGVIAH-------SPDG
CARA_ZYMMO      VTAPSNFRSLWRFDSWLKDHDRIGLAGVDTRALTGLLRKKGAQNAVIAH-------DPKG
CARA_STRAW      ARVPSNWRSRRSLDEELRHQGVVGISGIDTRALTRHLRESGAMRVGIFS-------GSAL
CARA_STRCO      ARVPSNWRSTRSLDQELAAQGVVGISGIDTRALTRHLRERGAMRVGIFS-------GNAL
CARA_BIFLO      SPNVSNWRAEGSLDDDLAKNGIVGLSHIDTRKLVRHLRSAGVMRAGIFS-------GDAL
CARA_MYCTU      SPRASNWRATGTLEDELIRQRIVGIAGIDTRAVVRHLRSRGSMKAGVFS-------DGAL
CARA_MYCBO      SPRASNWRATGTLEDELIRQRIVGIAGIDTRGVVRHLRSRGSMKAGVFS-------DGAL
CARA_MYCPA      SPRVSNWRATGSLEDELIRQRIVGIARIDTRAVVRHLRTRGSMKAGVFS-------GDAL
CARA_MYCLE      SPCASNWRATGTLEDELVRQRIVGIAGIDTRAVVRHLRRYGSMKAGVFS-------GKAM
CARA_CORGL      AARVSNWRATTSLQQEMAGQGIVGIGGIDTRALVRHLRNEGSIAAGIFS-------GADA
CARA_COREF      AVRVSNWRATTTLQEEMAKQGVVGIGGIDTRALVRHIRNEGAVPAGIFS-------GADA
CARA_CORDI      STAVSNWRAKRSLEDEMREQNIVGISGVDTRAIVRHLRNFGSVAAGIFS-------GEAA
CARA_NOSS1      CHKPSNWRSTQSLPDYLKQHHIPGIFGIDTRALTRKIRMYGAMNGGISTE------ILDE
CARA_SYNY3      TRRPSNWRSTQSLPDYLVEHKIIGIYGIDTRALTRKLRSIGAMNGGISTE------ILEP
CARA_THEVB      CDIPSNWRSQQSLPDYLKAHRIPAIYGIDTRALTRKIRTVGAMNGGISTE------ILDP
CARA_PARMW      APCASNWRCSESLDNWMERHGLVGICGVDTRALVRRLRDGGAINGVISSD------GRSP
CARA_PORPU      CKISSSWRQQESLVQYLNRYKIPFIFGIDTRSLTQYLRRSGTMNGCISNK------NLNH
CARA_NEOYE      CKISSSWREQQSLVKYLSSNNIPFIFGIDTRSLTQYLRQFGTMNGCISTD------NLNH
CARA_GRATL      CFSPNNWRQQESFINYIFNNQIPHIFGIDTRALTKHLRKTGSMNGCISSQ------YLNP
CARA_CYACA      SNAYSNFRAMRSLLSFLKRHKVVEIHDIDTRALVLHIRNNKTMLAVISNET----YNLTF
CARA_LEPIN      VDLPSNFKSEKTLSQFLKEYKIPAIQGIDTRKLTRFIRTNGSPNGGIFVA------SEYS
CARA_LEPIC      VDLPSNFKSEKTLSQFLKEYKIPAIQGIDTRKLTRFIRTNGSPNGGIFVA------SEYS
CARA_HELPJ      NEFFSNSRADSSLSTYLKKRGVLGISGVDTRSLIKTLRHHGCLMMIASTI------EHDR
CARA_HELPY      NEFFSNSRADFSLSAYLKERGVLGVCGVDTRSLIKTLRHHGCLMMVASTI------EHDK
CARA_CAMJE      SSSFSNFRAKESLQDYLEKHGKIGIYELDTRYLVKMIRNNGNLRAVISTE------ISNK
CARA_HELHP      NDFVSNFRSEQSLSTYLKEHNIMGICGVDTRNLIKMLTTQGAMMMIASTQ------ITQE
CARA_CHLTE      SNVYSNYESTRSLDATLKEAGVMGLAGIDTRKLVREIRQKGAMRAVISTLC---------
CARA_RHOBA      SRMHSNYRSEGSLSDYLNSQGVVGIAGIDTRALVRRIRSEGAMRGVLSTTD---------
CARA_AQUAE      FFRYSNWRAKKSLDEYLKENNVVGIYGIDTRALVKKIREKGSMKGVISTVE---------
CARA_DESVM      CRTPSNWRAIMSLPDYLAQHGVMGIEGIDTRALTRHLRINGAMRGIISTET---------
CARA_DEIRA      SGEYSNYRAQQSLEAFMQQYGVVSIQGIDTRALVRRLRSGGVVKGVIAHRSF----THPE
CARA_THET2      SRVASNPRAQQTIGEFMEFYGVVGIEGIDTRALVRKIREGGVLKGTIAHASL----FGAP
CARA_BACCL      CVKPSNWRGELTLDEYLKEKGIPGLSGIDTRKLTRLIRQYGTLKGMICGLDVDPVE----
CARA_BACSU      CELPSNWRSAYTLDEYLKMKNIPGLQGIDTRKLTRMIRTAGALKGTFASSDEDIEA----
CARA_BACHK      CDHPSNFRNEISLNDYLKERNIPGLAGIDTRKLTRKIRQYGTLRGRLCNMDADVEY----
CARA_BACAN      CDHPSNFRNEISLNDYLKERNIPGLAGIDTRKLTRKIRQYGTLRGRLCNMDADVEY----
CARA_BACCZ      CDHPSNFRNEISLNDYLKERKIPGLAGIDTRKLTRKIRQYGTLRGRLCNMDADVEY----
CARA_BACC1      CDHPSNFRNEISLNDYLKERNIPGLAGIDTRKLTRKIRQYGTLRGRLCNMDADVEY----
CARA_BACCR      CNHPSNFRNEISLNDYLKERNIPGLAGIDTRKLTRKIRQYGTLRGRLCNMDADVEY----
CARA_ALKHC      CDIPSNWRSEESLDSLLKAKQIPGLSGIDTRKLTRLIRMHGTLKGQLCPLDVDVEQ----
CARA_OCEIH      SEFPSNFRNEETLDEFLQAHNIPGIANIDTRKLTRIIRKHGTMRAVMVDEQKNEQH----
CARA_FUSNN      CATPSNFRSEKTLDEALKDFGIPGIYGIDTRALTRKLRSKGVVKGCLVSIDRNVDE----
CARA_LISMF      AEFPSNWRNQITLDEFLKEKGIPGIAGIDTRKLTKLIRKEGTLKGILAAETANKEE----
CARA_LISMO      AEFASNWRNQITLNEFLKEKGIPGIAGIDTRKLTKLIRKEGTLKGILAAETADKEE----
CARA_LISIN      AEYPSNWRNQITLNEFLKEKGIPGIAGIDTRKLTKLIRKEGTLKGILSAATADKEE----
CARA_STAEQ      STHPSNFRHQKTLHETLAQYHIPGISGVDTRSITRKIRNHGVLRAGFTDNKDNIQE----
CARA_STAES      STHPSNFRHQKTLHETLAQYHIPGISGVDTRSITRKIRNYGVLRAGFTDNKDNIQE----
CARA_STAHJ      STHPSNFRNQKTLHDVLVQYKIPGISGVDTRSITRKIRQHGVLKAGFTDNRDDIDS----
CARA_STAS1      SRQPSNFRKQKTFHEVLQEYDIPGISGVDTRSITRKIRNNGVLKAGFTDEKSEIDS----
CARA_STAAN      SAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITRKIRQHGVLKAGFTDRKEDIDQ----
CARA_STAAM      SAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITRKIRQHGVLKAGFTDRKEDIDQ----
CARA_STAAS      SAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITRKIRQHGVLKAGFTDRKEDIDQ----
CARA_STAAC      SAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITRKIRQHGVLKAGFTDRKEDIDQ----
CARA_STAAW      SAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITRKIRQHGVLKAGFTDRKEDIDQ----
CARA_STAAR      SAHPSNFRQQKTLHDVLELHQIPGIAGVDTRSITRKIRQHGVLKAGFTDRKEDIDQ----
CARA_STRP1      SRLASNWRKQMTLDAFLKIKGIPGISGIDTRALTKIIRQHGTMKATMADDGDSIQH----
CARA_STRP6      SRLASNWRKQMTLDAFLKIKGIPGISGIDTRALTKIIRQHGTMKATMADDGDSIQH----
CARA_STRP3      SRLASNWRKQMTLDAFLKIKGIPGISGIDTRALTKIIRQHGTMKATMADDGDSIQH----
CARA_STRP8      SRLASNWRKQMTLDAFLKIKGIPGISGIDTRALTKIIRQHGTMKATMADDGDSIQH----
CARA_STRMU      ARRANNWRKQMTLDEFLKSKNIPGISGIDTRALTKIIRHHGTMKATLANEGDSIEH----
CARA_STRPN      ARRASNWRNQMTLDEFLKAKKIPGISGIDTRALTKIIRKHGTMRATLTHVGDSMDH----
CARA_STRR6      ARRASNWRNQMTLDEFLKAKKIPGISGIDTRALTKIIRKHGTMRATLTHVGDSMDH----
CARA_STRA3      AEYPSNWRQQMTLDEFLKLKGIPGISGIDTRALTKIIRKHGTMKACLINEGNSIHE----
CARA_STRA5      AEYPSNWRQQMTLDEFLKLKGIPGISGIDTRALTKIIRKHGTMKACLINEGNSIHE----
CARA_LACLA      ACRPSNWRMQMSFDEFLKAKNIPGITGVDTRAITKIVREHGTMKASLVQARDEVEH----
CARA_LACLM      ARRPSNWRMQMSFDEFLKSKNIPGITGVDTRAITKIVREHGTMKASLVQARDEVDH----
CARA_LACPL      ARRASNWRNAQSLDDYLKQNAIPGIMDIDTRAVTKHIRTKGAMKATIVD--NVLPD----
CARA_SYMTH      CDRPSHWQAVGSLSDYLAGCGVPILAGLDTRALTRHLRSHGTMRGVIATLPEGAEPGPAQ
CARA_CALS4      CDKPSNFQSEESLLSYLDNHNIPVLSGIDTRALTKKLRENGTMRGIITYN----PE----
CARA_CLOAB      DENPSNYTSEINIDQMLKNMGVVGVFGVDTRSITKKIRSYGTMKCIISNGELSIEE----
CARA_CLOPE      CQYPNNFRCELELETYLAQNKVLGLDGIDTRALTKILRNNGTMKGIIVLDNSNLED----
CARX_BACSU      CDHFSHYEAVYSLKEYLQKWNIPLLTHVDTRAVVKKIRANGTMGATVTAS----------
CARX_GEOSE      SREGFHYGAKYSLAEYLQHWNIPLLTHVDTRALVKEIRTAGTMMAELSLS----------
CARX_ALKHC      SEEGHHYEATQSLQQFCDQHQLPLLTGIDTRAVVKRIREQGDMPAVITTDLSR-------
CARX_LACPL      ATFNDHYTSRQSLASFLTIHHVAGIEGVDTRDLTIHIRQTGAQMAILSNH----------
CARA_ARCFU      CKNPSNWRSEMSVDELLKQYDVPGIEGVDTRMLTRKIRIYGSMKAAIGIGDVDR------
CARA_METKA      HDGPIHPRAEITLDEFLQDHGVPGIAGVDTRMLTRKIRTEGAMRGVLVPYEPDDQPS---
CARA_METAC      CKKPYHYKSTRSIHQFLEDEGKPGIEGVDTRMLTIGARERGTMRAALITGSDDGE-----
CARA_METTH      CPAPSHSLSEKTLPEFLEEYGIPGIAGVDTRALTIKIRDKGTMKGALATEEIDDD-----
CARA_METJA      --------TSKALDDFLKEYDIPGIQDIDTRFLTRKIRDKGVVKSCLKVAEEISDDE---
CARA_HALSA      PSAVVARELTDDVADWLRTEGVPAVDGIDTRDLVLDIRDGGAMQVGIAAGP---------
CARA_THEAC      HINMPAGTLGLDFDRFLRDEGIPAIDGVDTRLLVRKIRQGGVLRAYIADD----------
CARA_THEVO      HIELKKGGYGREFDEFLKEQGIPGIDGIDTRMLVRKIRANGVLRSYVVND----------
                            .           :  :.** :                           

CARA_SACS2      ----------LEIDDPRKYLEK--KYDEIDFTQFTSPKSPIFHP----------------
CARA_SULTO      ----------YEIEDPKKFLEK--KYDEIDFTQFTSPKAPIVHLG---------------
CARA_PYRFU      ----------TDLEEILENIRKI-SYESTNFVELVSPKNPIVHTPK--------------
CARA_PYRAE      ----------PAV--LMEALRKSPHYEDVVYVDMVSVKEPVLLG----------------
CARA_SALTY      ---------DAKLALEKAKAFPG--LNGMDLAKEVTTA-ETYRWTQGSWTLKDG------
CARA_SALTI      ---------DAKLALEKAKAFPG--LNGMDLAKEVTTA-ETYRWTQGSWTLKDG------
CARA_ECOLI      ---------DAALALEKARAFPG--LNGMDLAKEVTTA-EAYSWTQGSWTLTGG------
CARA_ECO57      ---------DAALALEKARAFPG--LNGMDLAKEVTTA-EAYSWTQGSWTLTGG------
CARA_ECOL6      ---------DAALALEKARAFPG--LNGMDLAKEVTTA-EPYSWTQGSWTLTGG------
CARA_YERPE      ---------DAALALEKAKAFPG--LKGMDLAKEVTTK-EMYQWLQGSWTLEGD------
CARA_YERPS      ---------DAALALEKAKAFPG--LKGMDLAKEVTTK-EMYQWLQGSWTLEGD------
CARA_PECAS      ---------DAVVALEKAKAFPG--LKGMDLAKEVTTA-ESYSWLQGSWTLEGE------
CARA_PHOLL      ---------DAQVALEKAQAFPG--LEGMDLAKEVTTK-QIYPWLQGSWKLAGG------
CARA_VIBVU      ---------DEALALAKAKEFPG--LKGMDLAKEVTTK-EAYQWKQGSWTLEGG------
CARA_VIBVY      ---------DEALALAKAKEFPG--LKGMDLAKEVTTK-EAYQWKQGSWTLEGG------
CARA_VIBPA      ---------DEALALAKAKEFPG--LKGMDLAKEVTTK-EAYQWKQGSWTLESG------
CARA_VIBCH      ---------DEALALAKAKEFPG--LKGMDLAKVVSTK-EAYAWKQGSWTLEGG------
CARA_PHOPR      ---------DEALALDKAKEFPG--LKGMDLAKVVTTA-ETYQWKQGSWTLLDG------
CARA_SHEON      ---------DEVKALAAAKAFPG--LKGMDLAKEVTTD-KAYPWRKGSWRLVGG------
CARA_PSEAE      ---------TEERALELARAFPG--LKGMDLAKEVTTA-ERYEWRSSVWNLESD------
CARA_PSEST      ---------TEEKALELARSFPG--LKGMDLAKEVSVK-ERYEWRYSLWNLETD------
CARA_PSESM      ---------SEEAAIAAARGFPG--LKGMDLAKEVSTK-DTYEWRHSVWNLQTD------
CARA_PSEPK      ---------SEEAAIAAARGFPG--LKGMDLAKVVSTK-ERYEWRSSVWELKTD------
CARA_HALER      EG-ED----AEARALEAARAFPG--LKGMDLAKVVSCA-EPYEWSEGEWTLGS-------
CARA_ACIAD      ---------TEEEALAKARAFGG--LNGLDLAKECCDP-NGFEWTEGSWELGKG------
CARA_NEIMB      T---------IEKAQELIAAFGS--MVGKDLAKEVSCT-ETYEWTEGEWAL---------
CARA_NEIMA      T---------IEKAQELIAAFGS--MVGKDLAKEVSCT-ETYEWTEGEWAL---------
CARA_NEIGO      T---------VEKAQELIAAFGS--MVGKDLAKEVSCT-ETYEWTEGEWEL---------
CARA_PASMU      E----------AKALELAKSFGS--MAGKDLAQEVSTG-EIFTWTSGQWQL---------
CARA_HAEDU      ESLAQ----AVEKAQDLAKSFGS--MAGKDLAKEVTCQ-HRYEWQEGIWHLPTNN----A
CARA_RALSO      P----------QKAIDLARSFPG--LSGMDLAKVVSVT-QPYEWNQTEWALGRG------
CARA_RUBGI      I----------AAAVAAAKAAPS--MAGLDLAQVVSAD-APYEWTETSWQLGRG------
CARA_XANAC      V----------EKALEAARKFPG--LKGMDLAKVVSTE-STYNWKEGSLDLNSD------
CARA_XANCP      V----------EKALEAARKFPG--LKGMDLAKVVSTE-TTYQWQEGQLDLNAN------
CARA_XYLFA      V----------DRAQDAARQFTG--IKGMDLAKVVSTK-QAYSWYEGQLDLDRN------
CARA_XYLFT      V----------GKAQDAAHQFAG--IKGMDLAKVVSTK-QGYSWYEGQLDLDRN------
CARA_BUCAI      N---------YSIAYNKAKNFIS--LQDLDLAKKVSTK-SIYNWDQGSFTFKKNNFFSI-
CARA_BUCAP      N---------YSVAYQKAKKFLS--LQGLDLAKKVSTK-FIYNWDKGSFFINKSKSKLE-
CARA_BUCBP      H---------SIINVLKHINILDNPITNKDLVKQVSTK-KFYIWKKNVNKQKNNNITNA-
CARA_WIGBR      N---------FKEIKSKIKIFLE--KKNLDLVKLVTTK-RKIIYKKKYI-----------
CARA_RHIME      V---F----DVEALKAEAKAWSG--LEGLDLAKVATSG-QSYRWNEKPWVWNEG------
CARA_AGRFC      V---F----DIEALKAEAKAWSG--LVGLDLAIEATSG-QSSTWTETPWVWNKG------
CARA_RHILO      V---F----DLDDLKQRAAAWSG--LIGLDLAKEVTSG-QSSVWRETPWVWNEG------
CARA_BRUSU      N---F----DLDALKARAANWCG--LENLDLAKDVTIG-QSLVWKELPWTLQDG------
CARA_BRUME      N---F----DLDALKARAANWCG--LENLDLAKDVTIG-QSLVWKELPWTLQDG------
CARA_BRADU      E---F----DLHGLKEEAREWPG--LEGMDLVPMVTSG-QRFTWDETPWLWDKG------
CARA_CAUVC      Q---F----DLAALVAKAKAWAG--LEGLDLAKDASTT-QTFTWDEGLWSWPEG------
CARA_ZYMMO      Q---F----DIPALIETARSWAG--LQGMDLARSVSTH-QSYNWQEGIWSLQNG------
CARA_STRAW      PDEGT--------MLAEVRQAPE--MKGANLAAEVATK-ETYVVPAIGAKR---------
CARA_STRCO      PDEGT--------MLAEVRQTPE--MSGADLSAEVATT-EAYVVPAIGEKK---------
CARA_BIFLO      TDQATGALKTIEQLLEDVKNTPQ--MQGLSLYDEVSTK-ETYTIEPCGEYEGKE------
CARA_MYCTU      AEP--------ADLIARVRAQQS--MLGADLAGEVSTA-EPYVVEPDGPPG--V------
CARA_MYCBO      AEP--------ADLIARVRAQQS--MLGADLAGEVSTA-EPYVVEPDGPPG--V------
CARA_MYCPA      ADP--------DELVQRVRGQQS--MLGADLAGEVSTP-DAYIVEPEGPP----------
CARA_MYCLE      IEPLN-----IEALVQHVRTQQS--MLGADLVGEASTL-DAYVVEPKGKE----------
CARA_CORGL      QRP-------VEELVEIVKNQPA--MTGANLSVEVSAD-ETYVIEAEGEE----------
CARA_COREF      ERP-------IEELVEIVKSQPS--MVGANLAVEVSVD-KPYVIEAEGEA----------
CARA_CORDI      KQP-------HDELIEIVKSQPS--MAGADLASEVSTQ-EAYVVEPDGEA----------
CARA_NOSS1      A-----------ELLEQVQAAPN--MAGLNLVREVTTS-TVYEWSDPTTAVWEFNPD---
CARA_SYNY3      E-----------ALLHHIQAAPS--MAGLNLVKEVTTH-EVYEWTDSTNDHWQFGPV---
CARA_THEVB      V-----------ELLQKVLAAPS--MQGQNLAKVVTTR-TPYEWTEPTPAAWEFRPQ---
CARA_PARMW      A-----------DLLAEVRHAPS--MEGLNLASQVSTT-EPYEWSSPCRVGFDQRL----
CARA_PORPU      A-----------YLQRKISEVPH--MTGLDLIPNVTTN-IMYDWDEKSLPSW-YLADR--
CARA_NEOYE      S-----------YLKQKICEIPS--MQGLDLIPHVTTR-NVYPWDEKSFPNW-YLTDN--
CARA_GRATL      Y-----------LLSTKFKDRLS--IESSDLVKQVTTS-KNYEFQGYSHKHFSYLQYK--
CARA_CYACA      K-----------EAKATIKYGKH--TLNSNLASRVSTSLDYYQWMQPLNRKLKFGYSIIR
CARA_LEPIN      P-----------SFLEKVKSFPG--IINADLAKVVTTS-SKYIF----------------
CARA_LEPIC      P-----------SFLEKVKSFPG--IINADLAEVVTTS-SKYIF----------------
CARA_HELPJ      N-----------KLEEVLKNAPK--ISHSPLVSSVSTP-KIITHQRATFDFNTLDYKP--
CARA_HELPY      N-----------KLEEILKNAPK--ISHSPLVSSVSTP-KITTHQRATFDFKTLDYKP--
CARA_CAMJE      E-----------DLKIALEKSAK--IDEVNFVKEVSTK-KNYSHKQGVWNASFQKFN---
CARA_HELHP      S-----------ELKASLSRTPP--IQDINFIKEVSTK-TSYVHTDSTFDFTHFAYG---
CARA_CHLTE      --------DDVAALKAQAAAIPE--MTGLDLVQRV--TTGERYTVD--------------
CARA_RHOBA      --------LDDASLVAKAKASPG--LVGRDLVQEVMPTQLEKWTNELDDWTIREIREAA-
CARA_AQUAE      --------KDPKKLVQKARELPD--ISEQNLVEEVSAKDIYYWNQGDYD----PRR----
CARA_DESVM      --------DDRDELVRRARALPT--MEGQNLVTRVAPATPYRWDGTRPQ----PVQLAA-
CARA_DEIRA      DPYGEFTPAEEQIYVQRARDHQD--IDGFDMTKEVTTALPYAFPTLR-------------
CARA_THET2      D--HAFTQEELEALRREAQAWTD--IDGRDMTPEVSTPLPYAWPTLK-------------
CARA_BACCL      -----------------AAAKLRAMEWPRDQVRRVSTKSAYPSPGR--------------
CARA_BACSU      -----------------VLKRLNETELPRNQVSQVSAKTAYPSPGR--------------
CARA_BACHK      -----------------IVSQLKATVFT-DHVKRVSTKDPYPSPGR--------------
CARA_BACAN      -----------------IVSQLKATVFT-DHVKRVSTKDPYPSPGR--------------
CARA_BACCZ      -----------------IVSQLKATVFT-DHVKRVSTKDPYPSPGR--------------
CARA_BACC1      -----------------IVSQLKATVFT-DHVKRVSTKDPYPSPGR--------------
CARA_BACCR      -----------------IVSQLKATVFT-DHVKRVSTKDPYPSPGR--------------
CARA_ALKHC      -----------------IVQELKATPTPTDQVSRVSTRDPYHVPGP--------------
CARA_OCEIH      -----------------VIEQLRLAEMPRDQVKRTSTIKPYVVPGR--------------
CARA_FUSNN      -----------------VVAELKKTVLPTNQIEQVSSKSISPALGR--------------
CARA_LISMF      -----------------LLHHLRSVRLPVDQVHEVSSAKAFASPGD--------------
CARA_LISMO      -----------------LLHHLRSVRLPVDQVHEVSSAKAFASPGD--------------
CARA_LISIN      -----------------LLHHLRSVRLPVDQVHEVSSAKAFASPGD--------------
CARA_STAEQ      -----------------LVEQLKTAELPRDEVQTVSTKTPYVSTGS--------------
CARA_STAES      -----------------LVEQLKTAELPRDEVQTVSTKTPYVSTGS--------------
CARA_STAHJ      -----------------LINTLKSTELPRDEVETVSTKTPYVSTGS--------------
CARA_STAS1      -----------------MIAKLQSVELPRNEVTTVSTKSPYVSTGY--------------
CARA_STAAN      -----------------LVKHLQQVELPKNEVEIVSTKTPYVSTGK--------------
CARA_STAAM      -----------------LVKHLQQVELPKNEVEIVSTKTPYVSTGK--------------
CARA_STAAS      -----------------LVKHLQQVELPKNEVEIVSTKTPYVSTGK--------------
CARA_STAAC      -----------------LVKHLQQVELPKNEVEIVSTKTPYVSTGK--------------
CARA_STAAW      -----------------LVKHLQQVELPKNEVEIVSTKTPYVSTGK--------------
CARA_STAAR      -----------------LVKHLQQVELPKNEVEIVSTKTPYVSTGK--------------
CARA_STRP1      -----------------LKDQLRATVLPTNTIEQVSTKTAYPAPGI--------------
CARA_STRP6      -----------------LKDQLRATVLPTNTIEQVSTKTAYPAPGI--------------
CARA_STRP3      -----------------LKDQLRATVLPTNTIEQVSTKTAYPAPGI--------------
CARA_STRP8      -----------------LKDQLRATVLPTNTIEQVSTKTAYPAPGI--------------
CARA_STRMU      -----------------LQDQLRATVLPTNNIEQVSTKTAYPAPGV--------------
CARA_STRPN      -----------------VTDQLQATVLPTDNIKQVSTKTSYPAPGV--------------
CARA_STRR6      -----------------VTDQLQATVLPTDNIKQVSTKTSYPAPGV--------------
CARA_STRA3      -----------------ALENLQKSVLLNDQIEQVSTKLAYASPGV--------------
CARA_STRA5      -----------------ALENLQKSVLLNDQIEQVSTKLAYASPGV--------------
CARA_LACLA      -----------------QMSQLQATVLPTNQVETSSTTTAYPSPNT--------------
CARA_LACLM      -----------------QMSQLQATVLPTNQVETSSTATAYPSPNT--------------
CARA_LACPL      -----------------TVDRLKVTELNRAVVAQSSTNNAYPNPAT--------------
CARA_SYMTH      ---------------VAAWVETARAFRLEGAVRSVATAAPYRIPGP--------------
CARA_CALS4      -----------------DNIEFDQTNLLEE----VSTKKPYRIAGI--------------
CARA_CLOAB      -----------------LKKMMDASNIVDDYVNTVSTKEIIHIAGN--------------
CARA_CLOPE      -----------------VKDKLEAFSNRDA-VSIVSTNEKYEISGE--------------
CARX_BACSU      ------------------KEGAEIALQPENVAEQASAQEISTFGDG--------------
CARX_GEOSE      ------------------PISAVGGVEAVFPVRAVSTRTIETYGEG--------------
CARX_ALKHC      -----------------VSFEEWVPLSERALVDEVSTKKVETFEGN--------------
CARX_LACPL      ------------------PITDFEAQLATFAPQVLTATPLPVATTTI-------------
CARA_ARCFU      -----------EKLVRKAVEQPF--ISDIDLVDKVCVKEAKRFESDGDLE----------
CARA_METKA      ----------DEELLERVREVPH--ISEMDLVPQVSVREEYRF-SDGKPE----------
CARA_METAC      ------------EAVKVARNFPQ--ITDEELIARVTCKEPHFIPGAECAWKGSG------
CARA_METTH      ------------ELLEMAVKQPD--ITEIDLVDMVCVREPVILNEDASGR----------
CARA_METJA      ----------ISELLERVKRYSD--ISDIDLVPLVSTKEPKIHKTANPKAR---------
CARA_HALSA      ------------DASPATARAQLADCPRLSARTEIGAHVSVDTAETHG------------
CARA_THEAC      ---------------PQGHSDFPDPMSENLVARAVDARGVKNIRGKG-------------
CARA_THEVO      ---------------PSHSLDFPDPMNDDLVSKAVPHHDPVFVKGEE-------------
                                                                            

CARA_SACS2      -----------------------NTGDMIVVVDCGIKHGILYGLYKRGFSIVRVPCSFSA
CARA_SULTO      -----------------------NTGETIVVVDCGVKHGILYQLHQRGFTIVRVPCKFNV
CARA_PYRFU      -----------------------NVKFRVVVLDLGVKFGILRELLKRGIEVVRIPWNWDI
CARA_PYRAE      -----------------------EGRLCIGVVDCGVKRSIVREFLKRGVRVKLVPCRRTE
CARA_SALTY      LPEAK---------------SEDDLPFHVVAYDFGAKRNILRMLVDRGCRLTVVPAQTSA
CARA_SALTI      LPEAK---------------SEDDLPFHVVAYDFGAKRNILRMLVDRGCRLTVVPAQTSA
CARA_ECOLI      LPEAK---------------KEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSA
CARA_ECO57      LPEAK---------------KEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSA
CARA_ECOL6      LPEAK---------------KEDELPYHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSA
CARA_YERPE      LPAAK---------------QPEDLPFHVVAYDYGVKRNILRMLVDRGCRLTVVPAQTPA
CARA_YERPS      LPAAK---------------QPEDLPFHVVAYDYGVKRNILRMLVDRGCRLTVVPAQTPA
CARA_PECAS      LPAAK---------------NESELPYHVVAYDYGVKRNILRMLVDRGCRLTVVPAQTPA
CARA_PHOLL      LPEDK---------------QEQDLPYHVVAYDFGAKRNILRMLVDRGCRLTVVPAQTSA
CARA_VIBVU      LPEAK---------------DDSELPYHVVAYDFGAKRNILRMLVDRGCRLTVVPAETSA
CARA_VIBVY      LPEAK---------------DDSELPYHVVAYDFGAKRNILRMLVDRGCRLTVVPAETSA
CARA_VIBPA      LPEAK---------------DDSELPYHVVAYDFGAKRNILRMLVDRGCRLTVVPAETSA
CARA_VIBCH      LPEAK---------------ADSELPYHVVAYDFGAKRNILRMLVDRGCRLTVVPAQTSA
CARA_PHOPR      LPEAK---------------DDSELPYHVVAYDFGAKRNILRMLVDRGCRLTVVPAQTSA
CARA_SHEON      LPADT---------------PAEALKYKVVAYDYGVKQNILRMLVDRGCDVTVVPAKTPA
CARA_PSEAE      SHPEI---------------PAGELPYHVVAYDYGVKLNILRMLVARGCRLTVVPAQTPA
CARA_PSEST      SHPEI---------------PASELPYHVVAYDYGVKYNILRMLVARGCRVTVLPAQTPA
CARA_PSESM      SHPEI---------------AASELPYHVVAYDYGVKVNILRMLVERGCRVTVVPAQTPA
CARA_PSEPK      SHPTI---------------DAADLPYHVVAFDYGVKLNILRMLVARGCRVTVVPAQTPA
CARA_HALER      GYADV---------------SQGDRPYHVVAYDYGMKRNILRMLAARGCRLTVVPAQTPA
CARA_ACIAD      FTQP-------------------ELKYHVVAYDYGVKTNILRMLADRGCKLTVVPAQTPA
CARA_NEIMB      GKGFV---------------TPDEQPYHVVAYDFGVKTNILRMLASRGCRLTVVPAQTSA
CARA_NEIMA      GKGFV---------------TPDEQPYHVVAYDFGVKTNILRMLASRGCRLTVVPAQTSA
CARA_NEIGO      GKGFV---------------TPDKQPYHVVAYDFGVKTNILRMLASRGCRLTVVPAQTSA
CARA_PASMU      GKGFI---------------EQTQAEFNVVAYDFGVKHNILRMLAERGCKITVVPAKTSA
CARA_HAEDU      GKPFN---------------LQTTPTFHVVAYDFGIKQNILRMLAERGCKITVVPAQTSA
CARA_RALSO      -YGVQ-----------------DKPQFHVVAYDFGVKYNILRMLAERGCRVTVVPAQTSA
CARA_RUBGI      -HGTL-----------------ADAEFHVVAYDFGVKRNILRLLADRGCRVTVVPARTPA
CARA_XANAC      -SFLGLGALNIGKSAHASAGSGEELAFKVVAYDYGVKLNILRMLAERGCDVTVVPARTPV
CARA_XANCP      -AFVQ-----------------AELKFKVVAYDYGVKINILRMLAERGCDVTVVPARTPV
CARA_XYLFA      -EWKR-----------------AAPQYKVVAYDYGVKLNILRMLAERGCDLTVVPAQTPV
CARA_XYLFT      -ECKR-----------------AAPQYKVVAYDYGVKLNILRMLAERGCDLTVVPAQTPA
CARA_BUCAI      --------------------NKQKFLFHVVVYDFGVKRNILRMLVDRGCYLTVVPAITDP
CARA_BUCAP      --------------------KKKKFLFHIVVYDFGVKRNILRMLVDRGCYLTVVPAKTDP
CARA_BUCBP      --------------------KLKEKIWHVVVYDFGVKKNILNMLTHRNCYLTVIPADTSA
CARA_WIGBR      ---------------------EKNFFYNIVAYDFGIKFSIIKNLINLGCRITLVPATTKS
CARA_RHIME      -YSTLG---------------ETDAAYHVVALDYGVKRNILRLFAGLNCRVTVVPAQTSA
CARA_AGRFC      -YGTLG---------------EADAKYHVVCVDFGVKRNILRLFAGLDCKVTVVPAQTSA
CARA_RHILO      -FGE-----------------QAEPSLHVVAIDYGVKRNILRLLAGLGAKVTVVPANTGS
CARA_BRUSU      -YGE-----------------QDAPQYHVVALDFGVKRNILRLLTGLGAKVTVLPATATA
CARA_BRUME      -YGE-----------------QDAPQYHVVALDFGVKRNILRLLTGLGAKVTVLPATATA
CARA_BRADU      -FGQ-----------------QDKTEFNVVAIDYGIKRNILRLLAGVGCKVTVVPATTSA
CARA_CAUVC      -YAK-----------------LDKPKYEVVVIDYGVKRNILRALAHVGARATVVPASTSA
CARA_ZYMMO      -YSVV----------------DNQKGPHVVAIDYGLKHNILRNLVEAGARVTVVKATASF
CARA_STRAW      --------------------------FTVAAVDLGIKGMTPHRMAERGIEVHVLPATATA
CARA_STRCO      --------------------------FTVAAVDLGIKGMTPHRMAERGIEVHVLPATATV
CARA_BIFLO      ------------------------PLYTVAAVDLGIKGMTPHRMAERGCRVHVVPSTITF
CARA_MYCTU      ------------------------SRFTVAALDLGIKTNTPRNFARRGIRCHVLPASTTF
CARA_MYCBO      ------------------------SRFTVAALDLGIKTNTPRNFARRGIRCHVLPASTTF
CARA_MYCPA      -------------------------RFTVAALDLGIKTNTPRNFARRGIRSHVLPSSATF
CARA_MYCLE      -------------------------RFTVAALDLGIKTNTPRNFARRGIRSYVLPASATF
CARA_CORGL      -------------------------RHTVVAYDLGIKQNTPRRFSARGVRTVIVPAETPF
CARA_COREF      -------------------------RHTVVAYDLGIKQNTPRRFAARGVRTVIVPAETPF
CARA_CORDI      -------------------------LYTVVAYDMGIKTNTPRNFSRRGIRTVVVPANTPA
CARA_NOSS1      ------------------GTVKNGESLTVVALDFGVKRNILRRLASYGCRVIVVPADTSP
CARA_SYNY3      ------------------AEQQGQPPLTVVALDFGVKRNILRRLASYGCRVIVVPASTSA
CARA_THEVB      ------------------TATE-EPPLTVVAIDFGVKRNILRRLASYGCRVIVVPADTPA
CARA_PARMW      -------------------KQHPDLPYRVVAIDFGIKRAILDRLVAHGCAVTVLPSDADL
CARA_PORPU      ------------------NREKIYSQLKVIVIDFGVKLNILRRLATLGCQITVMPASTPT
CARA_NEOYE      ------------------IRVHRVIQLKVIVIDFGVKLNILRRLATLGCQITVVPAHTPL
CARA_GRATL      ------------------TDKMYGYGLKIILIDFGVKYNILSRLDNYGCSIQILPATSSY
CARA_CYACA      SFNSAIN-----------KKLHTSKKLRIIVLDLGVKFNILRYLKSFECEVIIVNYKSTY
CARA_LEPIN      -------------------GTHTGKKFKLAVYDYGVKTNILRLLDANGFAVTVYPAKTPS
CARA_LEPIC      -------------------GTHTGKKFKLAVYDYGVKTNILRLLDANGFAVTVYPAKTPS
CARA_HELPJ      -------------------FDEKIPHKIIAVLDFGAKGNILNELQNVGLKALIYPHHTKA
CARA_HELPY      -------------------FDEKTSHKIIAVLDFGAKGNILNELQNVGLKALIYPHHTKA
CARA_CAMJE      --------------------DAKRSEKKVAVIDYGVKTNILNELVEVGFEVEVYPYNVKA
CARA_HELHP      --------------------TSPNFKAKVVAIDFGAKRNILNELVAVGLEVEVIPHSFSA
CARA_CHLTE      ---------------------NPDAKYHVVAFDYGIKTNIIRQLNAEGCKVTVVNAKTTA
CARA_RHOBA      ----------------KDASIGDDSRPHVVCMDFGMKWNIPRHLRSRGNRVTIVPGNASA
CARA_AQUAE      -----------------GFLYRENEKPLVAVIDFGVKFNILRRLVSEGAKVVVVPPENAK
CARA_DESVM      ----------------DGAYAWPGTGPRLVVYDYGIKWNILRLLTDQGFDLLVVPPSFTA
CARA_DEIRA      ------------------------QGKRVVLMDFGIKHTIIERLAEVGIEPIVVPAHTTP
CARA_THET2      ------------------------SGRRIVVMDFGIKHAIVENLAALGFEVIVVPGKTPA
CARA_BACCL      -------------------------GERIVLIDFGMKHGILRELNKRNCDVIVLPYNATA
CARA_BACSU      -------------------------GKRIVLVDFGMKHGILRELNKRKCDVIVVPYNITA
CARA_BACHK      -------------------------GHRVVLVDFGMKHGILRELNKRDCDVIVVPYNTTA
CARA_BACAN      -------------------------GHRVVLVDFGMKHGILRELNKRDCDVIVVPYNTTA
CARA_BACCZ      -------------------------GHRVVLVDFGMKHGILRELNKRDCDVIVVPYNTTA
CARA_BACC1      -------------------------GHRVVLVDFGMKHGILRELNKRDCDVIVVPYNTTA
CARA_BACCR      -------------------------GHRVVLVDFGMKHGILRELNKRDCDVIVVPYNTTA
CARA_ALKHC      -------------------------GKRVVLVDYGMKHNILQELIRRNCEVFVVPYHTSA
CARA_OCEIH      -------------------------GLRVVMVDFGAKHGILRELTRRDCHITVVPHNYSA
CARA_FUSNN      -------------------------GRRVVLVDLGMKIGIVRELVSRGCDVIVVPYNTTA
CARA_LISMF      -------------------------GKRVVLVDYGVKSSILRELNKRNCYVTVVPYNTTA
CARA_LISMO      -------------------------GKRVVLVDYGVKSSILRELNKRNCYVTVVPYNTSA
CARA_LISIN      -------------------------GKRVVLVDYGVKSSILRELNKRNCYVTVVPYNTTA
CARA_STAEQ      -------------------------DLSVVLLDFGKKQNIVRELNLRGCNVTVVPYDTSA
CARA_STAES      -------------------------DLSVVLLDFGKKQNIVRELNLRGCNVTVVPYDTSA
CARA_STAHJ      -------------------------DLSVVLLDFGKKQNIVRELNMRGCNVTVVPYNTTA
CARA_STAS1      -------------------------GLSVVLVDFGKKQNIVRELNARGCNVTVVPYDTSA
CARA_STAAN      -------------------------DLSVVLVDFGKKQNIVRELNVRGCNVTVVPYTTTA
CARA_STAAM      -------------------------DLSVVLVDFGKKQNIVRELNVRGCNVTVVPYTTTA
CARA_STAAS      -------------------------DLSVVLVDFGKKQNIVRELNVRGCNVTVVPYTTTA
CARA_STAAC      -------------------------DLSVVLVDFGKKQNIVRELNVRGCNVTVVPYTTTA
CARA_STAAW      -------------------------DLSVVLVDFGKKQNIVRELNVRGCNVTVVPYTTTA
CARA_STAAR      -------------------------DLSVVLVDFGKKQNIVRELNVRGCNVTVVPYTTTA
CARA_STRP1      -------------------------GKNIVLVDFGLKHSILREFSKRQCNITVVPFNITA
CARA_STRP6      -------------------------GKNIVLVDFGLKHSILREFSKRQCNITVVPFNITA
CARA_STRP3      -------------------------GKNIVLVDFGLKHSILREFSKRQCNITVVPFNITA
CARA_STRP8      -------------------------GKNIVLVDFGLKHSILREFSKRQCNITVVPFNITA
CARA_STRMU      -------------------------GKNIVLVDFGLKHSILREFSKRNCNVTVVPYNTTA
CARA_STRPN      -------------------------GLSVVLVDFGLKHSILRELSKRNCNVTVVPYSTTA
CARA_STRR6      -------------------------GLSVVLVDFGLKHSILRELSKRNCNVTVVPYSTTA
CARA_STRA3      -------------------------GKNIVLVDFGLKHSILRELSQRQCHITVVPHTTTA
CARA_STRA5      -------------------------GKNIVLVDFGLKHSILRELSQRQCHITVVPHTTTA
CARA_LACLA      -------------------------GRKVVVVDFGLKHSILRELSKRECNLTVVPYNTSA
CARA_LACLM      -------------------------GRKVVVVDFGLKHSILRELSKRECNLTVVPYNTSA
CARA_LACPL      -------------------------GPNVVVVDFGLKHSILRELAKRQCNLTVLPYNTTA
CARA_SYMTH      -------------------------GPRVVAVDFGAKENILRELTARGCDVTVVPATASA
CARA_CALS4      -------------------------GPKLAFIDLGTKKGILKMLNSVGFDIYVFPYNASY
CARA_CLOAB      -------------------------GNKVAVMDFGIKNDIIENLKERQCDITIFPYDTDY
CARA_CLOPE      -------------------------GKKVAIIDFGIKQNIIRNFVKRGCNVTVFPYDFKA
CARX_BACSU      -------------------------NKHIALIDFGYKKSIASSLVKRGCKVTVVPYQQM-
CARX_GEOSE      -------------------------GPHLVLVDFGYKKSILQSLLARGCRVTVVPHDTAP
CARX_ALKHC      -------------------------GPHIVLIDYGFKQSILNSLLKRDCQVTIVPYDVSF
CARX_LACPL      -------------------------RPRVAILNFGEKAAITAELQARGADVVVLPPTASL
CARA_ARCFU      ----------------------------VVLVDCGVKMSIVRQLLKRGVNLTVVPYDFPA
CARA_METKA      ----------------------------IVVIDCGVKRSILRELAKRGAGVTVVPYDTSA
CARA_METAC      ------------------------KPKHAVVVDLGIKRNIINNLHKRGIDLTLVPATTKP
CARA_METTH      ----------------------------VVIVDCGIKRNSIDALLEKDLGVVIVPYTTSP
CARA_METJA      ----------------------------CVLIDCGVKLNIIRSLVQRNCEVIQVPYNTKY
CARA_HALSA      -----------------------NGDTTVALVDCGAKRSIIDAFVARGATVHRLPYDATP
CARA_THEAC      -------------------------ERRILFIDLGSK-KTLRDMMLEHFSLIMASADSDL
CARA_THEVO      -------------------------GGTVLFIDLGSK-NTLKELMLQNFSLIVVDKQTNL
                                                : * *      :                

CARA_SACS2      -SKIIEYNP----KGIVFSNGPGNP-NLLENQIKTFSELVEY--KIPILGICLGHQIATL
CARA_SULTO      -SKIMDYYP----KGVVFGNGPGNP-NLLQEVIENFKELTEY--KIPILGICLGHQVATL
CARA_PYRFU      LEAYYSYNA----DGIFISNGPGNP-TLLKEVAKRIRKAFNE--EIPMMGICLGQQLLAL
CARA_PYRAE      ----LAFDC----DALFISNGPGNP-KLLDFLSAKVSEYVEY--KKPLMGICLGHQVIAM
CARA_SALTY      -EEVLKMNP----DGIFLSNGPGDP-APCDYAITAIQKFLET--DIPLFGICLGHQLLAL
CARA_SALTI      -EEVLKMNP----DGIFLSNGPSDP-APCDYAIEAIKKFLQT--DIPVFGICLGHQLLAL
CARA_ECOLI      -EDVLKMNP----DGIFLSNGPGDP-APCDYAITAIQKFLET--DIPVFGICLGHQLLAL
CARA_ECO57      -EDVLKMNP----DGIFLSNGPGDP-APCDYAITAIQKFLET--DIPVFGICLGHQLLAL
CARA_ECOL6      -EDVLKMNP----DGIFLSNGPGDP-APCDYAITAIQKFLET--DIPVFGICLGHQLLAL
CARA_YERPE      -EDVLKLNP----DGIFLSNGPGDP-EPCDYAITAIKRFLET--DIPVFGICLGHQLLAL
CARA_YERPS      -EDVLKLNP----DGIFLSNGPGDP-EPCDYAITAIKRFLET--DIPVFGICLGHQLLAL
CARA_PECAS      -EDVLKLNP----DGIFLSNGPGDP-EPCDYAIRAIKTFLET--GIPVFGICLGHQLLAL
CARA_PHOLL      -EDVLKLNP----DGIFLSNGPGDP-APCGYAIDAVKTLLET--EIPIFGICLGHQLLAL
CARA_VIBVU      -EDVLALNP----DGVFLSNGPGDP-APCTYAIEATKVFLEN--GLPVFGICLGHQILAL
CARA_VIBVY      -EDVLALNP----DGVFLSNGPGDP-APCTYAIEATKVFLEK--GLPVFGICLGHQILAL
CARA_VIBPA      -EEVLALNP----DGVFLSNGPGDP-EPCTYAIEATKVFLEK--GLPIFGICLGHQILAL
CARA_VIBCH      -EDVLALNP----DGVFLSNGPGDP-EPCTYAIEATRVFLEK--NIPVFGICLGHQILAL
CARA_PHOPR      -EDVLAMNP----DGVFLSNGPGDP-EPCTYAIEATKTFLDI--GLPIFGICLGHQILAL
CARA_SHEON      -SEVLAMNP----DGVFLSNGPGDP-EPCDYAIEAIQQILKT--DTPIFGICLGHQLLAL
CARA_PSEAE      -SEVLALNP----DGIFLSNGPGDP-EPCDYAIQAIREFLDT--EIPVFGICLGHQLLAL
CARA_PSEST      -SEALALNP----DGIFLANGPGDP-EPCDYAIRAIQEVLET--DIPVFGICLGHQLLAL
CARA_PSESM      -SEVLAYKP----DGVFLSNGPGDP-EPCDYAIKAIKQVLET--EVPVFGICLGHQLLAL
CARA_PSEPK      -SEVLALNP----DGVFLSNGPGDP-EPCDYAIQAIKEILET--EIPVFGICLGHQLLAL
CARA_HALER      -EEVLAMNP----DGIFLSNGPGDP-EPCDYAISAIQAFLET--EIPVFGICLGHQLLAL
CARA_ACIAD      -EQVLALNP----DGVFLSNGPGDP-AACDYAIEAVKTIVETT-NLPVFGICLGHQILAL
CARA_NEIMB      -EDVLALNP----DGVFLSNGPGDP-EPCTYAIKAVQKLIES--GKPIFGICLGHQLISL
CARA_NEIMA      -QDVLALNP----DGVFLSNGPGDP-EPCTYAIEAVQKLMES--GKPIFGICLGHQLISL
CARA_NEIGO      -EDVLALNP----DGVFLSNGPGDP-EPCTYGIEAVQKLMES--GKPIFGICLGHQLISL
CARA_PASMU      -EQVLALNP----DGIFLSNGPGDP-EPCDYAISAIQTLLAS--KKPIFGICLGHQLLGL
CARA_HAEDU      -EDILALNP----DGIFLSNGPGDP-EPCTYAIQSIRQLLNT--QKPIFGICLGHQLLGL
CARA_RALSO      -ADALAYNP----DGVFLSNGPGDP-QPCDYAIAATKDFIER--RIPTFGICLGHQIMGL
CARA_RUBGI      -AEVFKLKP----DGVFLSNGPGDP-EPCDYAIAAAREIIDA--GVPTFGICLGHQIMAL
CARA_XANAC      -AEVLALQP----DGVFLSNGPGDP-EPCDYAIDAIKELIAQ--KVPTFGICLGHQLLAL
CARA_XANCP      -AEVLAMQP----DGVFLSNGPGDP-EPCDYAISAIQELIAK--KVPTFGICLGHQLLAL
CARA_XYLFA      -DEVLALCP----DGVFLSNGPGDP-EPCDYAVAAIKTFIMR--RVPIFGICLGHQLLAQ
CARA_XYLFT      -DEVLALCP----DGVFLSNGPGDP-EPCDYAVAAIKTFIMR--RVPIFGICLGHQLLAQ
CARA_BUCAI      -KTVLNLSP----DGIFLSNGPGDP-RPCDYAIHAIQYFLKT--NIPIFGICLGHQLLAL
CARA_BUCAP      -KIALNLNP----DGIFLSNGPGDP-RPCDYAIHAIQCFLKK--NIPIFGICLGHQLLAL
CARA_BUCBP      -EKVLQILP----DGIFLSNGPGDP-RSCTYALNAINAFLKI--NIPIFGICLGHQLLAL
CARA_WIGBR      -KYVISLNP----DGILLSNGPGNP-EIYKYAIRNIQCLLET--KIPIFGICLGHQLLAI
CARA_RHIME      -EEVLALKP----DGIFLSNGPGDPAATGEYAVPVIQDLLKT--DIPVFGICLGHQMLAL
CARA_AGRFC      -EDILALKP----DGVFLSNGPGDPAATGEYAVPVIQNLIKS--ELPIFGICLGHQMLGL
CARA_RHILO      -EEILAMQP----DGIFLSNGPGDPEATGDYAVPVIQDLLKT--DIPVFGICLGHQMLAL
CARA_BRUSU      -EDVLAHNP----DGVFLSNGPGDPAATGEYAVPTIGKLVET--GIPLFGICLGHQMLAL
CARA_BRUME      -EDVLAHNP----DGVFLSNGPGDPAATGEYAVPTIGKLVET--GIPLFGICLGHQMLAL
CARA_BRADU      -EDILAMKP----DGVFLSNGPGDPAATGKYAVPVIRDVIKS--GTPTFGICLGHQMLGL
CARA_CAUVC      -EDILARNP----DGVMLSNGPGDPAATGQYAVPEIQKLVAS--GKPVFGICLGHQMLAL
CARA_ZYMMO      -DEVMAHKP----DGVFLSNGPGDPAATAEYAVPVIRQLLDI--KMPIFGICLGHQLLAL
CARA_STRAW      -EDVYAVNP----DGVFFSNGPGDP-ATADGPVAVMREVLAR--KTPLFGICFGNQILGR
CARA_STRCO      -DDVYAVEP----DGVFFSNGPGDP-ATADHPVSVMQGVLER--GTPLFGICFGNQILGR
CARA_BIFLO      -AEIENLNP----DGVFFSNGPGDP-EQAGPEIELLRQVLDA--GYPFFGICFGNQLLGR
CARA_MYCTU      -EQIAELNP----HGVFLSNGPGDP-ATADHVVALTREVLGA--GIPLFGICFGNQILGR
CARA_MYCBO      -EQIAELNP----HGVFLSNGPGDP-ATADHVVALTREVLGA--GIPLFGICFGNQILGR
CARA_MYCPA      -EQIADLRP----DGVFLSNGPGDP-ATADHIVAVTREVLGA--GIPLFGICFGNQILGR
CARA_MYCLE      -NQIADIKP----HGLFLSNGPGDP-ATADHVVALTREVLNA--GIPLFGICFGNQILGR
CARA_CORGL      -EDIKQYNP----SGVFISNGPGDP-AAADVMVDIVREVLEA--DIPFFGICFGNQILGR
CARA_COREF      -EEIKQYNP----SGVFISNGPGDP-AAADIMVNIVREVLAA--DIPFFGICFGNQILGR
CARA_CORDI      -EDIAQYNP----DGVFVSNGPGDP-ATADVMVGIVQEILAQ--KIPFFGICFGNQILGR
CARA_NOSS1      -EEILKYNP----DGIFLSNGPGDP-SAVTEGITTAKALLE-S-EKPIFGICMGHQILGH
CARA_SYNY3      -AEILQYNP----DGIFLSNGPGDP-SAVEEGIVTTKELLA-A-KKPMFGICMGHQVLGL
CARA_THEVB      -ETILSYDP----DGIFLSNGPGDP-AAVQEGIETTRKLLG-A-QRPMFGICLGHQLLGL
CARA_PARMW      -DTVMSHQP----EGVFLSNGPGDP-AAVDSGIDLARSLLERA-NLPLFGICLGHQILGL
CARA_PORPU      -QDILSCKP----DGILLSNGPGDP-SAVNYGIKTVKELLNQ--NIPIFGICMGHQILNL
CARA_NEOYE      -KDILAYQP----DGILLSNGPGDP-SAVHYGIQTVTNLLDY--NVPIFGICMGHQILNL
CARA_GRATL      -ETINAYNP----DGIILSNGPGDP-SIITYAIKTVKKIIKYT-NIPIFGICMGHQIISL
CARA_CYACA      -QQVMKFHP----DGIVISNGPGDP-AKINRVVVRVNKFIN-K-KIPILGICLGHQILAR
CARA_LEPIN      -EEIMKEGT----DAFFLSNGPGDP-APLDYAIASTQKIME-K-RYPLFGICLGHQIIGL
CARA_LEPIC      -EEIMKEGT----DAFFLSNGPGDP-APLDYAIASTQKIME-K-RYPLFGICLGHQIIGL
CARA_HELPJ      -NELIKAYEKKEISGIFLSNGPGDP-LSLQQEIGEIKRLIN-A-KIPMFGICLGHQLLSI
CARA_HELPY      -SELIKAYEKKEISGIFLSNGPGDP-LSLQQEIGEIKQLIN-A-KIPMLGICLGHQLLSI
CARA_CAMJE      -DELITLYKKGEIQGVFLSNGPGEP-RILKQEIAEIKKLAE-A-KIPMLGICLGHQLLSN
CARA_HELHP      -AEILSRFKAGEIQGVFLSNGPGDP-LVLHNEIEQIKQLIQ-S-DIPIFGICLGHQLLSI
CARA_CHLTE      -DEVLAMNP----DGIFLSNGPGDP-FAVTYAIDTIRELAARNSTLPIFGICLGHQLLSL
CARA_RHOBA      -DDILKMDP----DGVFLSNGPGDP-EPLTYAHKAIGELLGQ---VPVFGICLGHQLLSV
CARA_AQUAE      -EAIEKINP----DAIFLSNGPGDP-ERVISGIRLTREYMEK---KPIMGICLGCQIIGL
CARA_DESVM      -MQVAASGA----EAVFLSNGPGDP-ATLTDEVREIRVMTER---MPVAGICLGHQLLGH
CARA_DEIRA      -AQIMALQP----HGLFLSNGPGDP-APLEYAHKTAWEMMGL---LPTFGICLGHQILGL
CARA_THET2      -HQIMALEP----HGLLISNGPGDP-TMPRYAHETIWKLMGL---LPTFGICLGHQLLAL
CARA_BACCL      -EEVLGWHP----DGVMLSNGPGDP-KDVPEAIEMIRGIL---GKVPLFGICLGHQLFAL
CARA_BACSU      -EEVLQLKP----DGIMLSNGPGDP-KDVPEAIEMIKGVL---GKVPLFGICLGHQLFAL
CARA_BACHK      -EEILRLSP----DGIMLSNGPGDP-KDVPEAIEMLKDII---GKVPLFGICLGHQLFAL
CARA_BACAN      -EEILRLSP----DGIMLSNGPGDP-KDVPEAIEMLKDII---GKVPLFGICLGHQLFAL
CARA_BACCZ      -EEILRLSP----DGIMLSNGPGDP-KDVPEAIEMLKDII---GKVPLFGICLGHQLFAL
CARA_BACC1      -EEILRLSP----DGIMLSNGPGDP-KDVPEAIEMLKDII---GKVPLFGICLGHQLFAL
CARA_BACCR      -EEILRLSP----DGIMLSNGPGDP-KDVPEAIEMLKDII---GKVPLFGICLGHQLFAL
CARA_ALKHC      -EEVLRLGP----DGVLLSNGPGNP-EDVSEGVEMIRNLL---GKVPLFGICLGHQLFAL
CARA_OCEIH      -EAILRLKP----DGIMLTNGPGDP-KDVPEAIEMIKQLL---GQIPIFGICLGHQLLAL
CARA_FUSNN      -EEVLRLEP----DGVMLTNGPGDP-EDAKESIEMIKGII---NKVTIFGICMGHQLVSL
CARA_LISMF      -EEILAMHP----DGVMLSNGPGDP-KDVPEALEMIRGIQ---GKLPLFGICLGHQLFAL
CARA_LISMO      -EEILAMHP----DGVMLSNGPGDP-KDVPEALEMIRGIQ---GKLPLFGICLGHQLFAL
CARA_LISIN      -EEILAMHP----DGVMLSNGPGDP-KDVPEALEMIRGIQ---GKLPLFGICLGHQLFAL
CARA_STAEQ      -EEILSMSP----DGVMLSNGPGDP-DEVDVALDMIRGIL---GKIPFFGICLGHQLFAL
CARA_STAES      -EEILGMSP----DGVMLSNGPGDP-DEVDVALDMIRGIL---GKIPFFGICLGHQLFAL
CARA_STAHJ      -EEILAMSP----DGVMLSNGPGDP-DVVEVAIEMIKGIL---GKIPFFGICLGHQLFAL
CARA_STAS1      -EAIIRMSP----DGVMLSNGPGDP-EEVHVAVEMIKGIL---GKIPFFGICLGHQLFAL
CARA_STAAN      -EEILAMAP----DGVMLSNGPGNP-EVVECAIPMIQGIL---GKIPFFGICLGHQLFAL
CARA_STAAM      -EEILAMAP----DGVMLSNGPGNP-EVVECAIPMIQGIL---GKIPFFGICLGHQLFAL
CARA_STAAS      -EEILAMAP----DGVMLSNGPGNP-EVVECAIPMIQGIL---GKIPFFGICLGHQLFAL
CARA_STAAC      -EEILAMAP----DGVMLSNGPGNP-EVVECAIPMIQGIL---GKIPFFGICLGHQLFAL
CARA_STAAW      -EEILAMAP----DGVMLSNGPGNP-EVVECAIPMIQGIL---GKIPFFGICLGHQLFAL
CARA_STAAR      -EEILAMAP----DGVMLSNGPGNP-EVVECAILMIQGIL---GKIPFFGICLGHQLFAL
CARA_STRP1      -EEVLQLNP----DGLMLSNGPGNP-EDLPEALDMIRGVQ---GKIPIFGICMGHQLFSL
CARA_STRP6      -EEVLQLNP----DGLMLSNGPGNP-EDLPEALDMIRGVQ---GKIPIFGICMGHQLFSL
CARA_STRP3      -EEVLQLNP----DGLMLSNGPGNP-EDLPEALDMIRGVQ---GKIPIFGICMGHQLFSL
CARA_STRP8      -EEVFQLNP----DGLMLSNGPGNP-EDLPEALDMIRGVQ---GKIPIFGICMGHQLFSL
CARA_STRMU      -QEILNLNP----DGIMLSNGPGNP-QDVPEALEMIRGVQ---GKIPIFGICMGHQLFSL
CARA_STRPN      -EEILHLNP----DGVMLSNGPGNP-EDVPQALDMIRGVQ---GKIPIFGICMGHQLFAM
CARA_STRR6      -EEILHLNP----DGVMLSNGPGNP-EDVPQALDMIRGVQ---GKIPIFGICMGHQLFAM
CARA_STRA3      -QEILNLNP----DGVLLSNGPGNP-EQLPNALQMIQEIQ---GKIPIFGICMGHQLFAK
CARA_STRA5      -QEILNLNP----DGVLLSNGPGNP-EQLPNALQMIQEIQ---GKIPIFGICMGHQLFAK
CARA_LACLA      -QEILEMEP----DGVMLTNGPGDP-TDVPEAIEMIKEIQ---GKIPIFGICLGHQLFSL
CARA_LACLM      -KEILEMEP----DGVMLTNGPGDP-TDVPEAIEMIKEVQ---GKIPIFGICLGHQLFSL
CARA_LACPL      -SEIMALNP----DGVMLTNGPGDP-KDVPGALEMIREVE---KHVPLFGICLGHQLFAL
CARA_SYMTH      -EEVLSLRP----EGVVLTNGPGAP-TDVPEAVEMVRGLLSQ-GDLPIFGICLGHQIAAL
CARA_CALS4      -DDVMQINP----DAIFLSNGPGDP-KDAVDAIELTKHFI---GMKPVLGICLGHQIIAL
CARA_CLOAB      -NEILNINP----DGIFLSNGPGDP-KSIPEAIENVKKLI---GKRPMFGICLGHQIIAL
CARA_CLOPE      -EEVLEINP----DLVFLSNGPGDP-EDMGEAVNEIKKIV---GKKPIVGICLGHQLLAL
CARX_BACSU      -EAVYNIKP----DGIVLSNGPGDP-KAIQPYLGKIKSII---SRFPTLGICLGHQLIAL
CARX_GEOSE      -EAIDALKP----DGLVLSNGPGDP-KQLRHQLPAIRQLI---DRYPTLAICLGHQLVAL
CARX_ALKHC      -EVVQELNP----DGLLFSNGPGDP-KQIEDRLPTIYRLA---STYPSLGICLGHQLLAL
CARX_LACPL      -KAVAAYHP----DGILLSNGPGDP-TDYHTYLATIRQLA---QRYPLAGICLGHQLIAL
CARA_ARCFU      -EKIKEMNP----DGVFISNGPGDP-ARVKPTIETIRKLAGQ---IPMAGICLGHQLTAL
CARA_METKA      -QEIMDIDP----DGVVVSNGPGDP-KRVRETVETVRELIGQ---VPLMGICLGNQILGL
CARA_METAC      -KEIAGFEP----DLLFISNGPGDP-EKATDAINAVKAFAGT---IPVAGICFGHQIISL
CARA_METTH      -AEIMDYEP----DGLLISSGPGDP-TRVRDAIDTVKALSER---LPIFGICLGQQIIAL
CARA_METJA      -DEILEYKP----DFVLISNGPGDP-ARLKEVIKNIKNLIGV---VPITGICLGNQLLSL
CARA_HALSA      -ADIAAVDP----DLLFISNGPGDP-ANFDAAEHLVDEYIGT---VPIAGICLGQQIVAR
CARA_THEAC      -DAIDKYDA------IFVSNGPGDP--DHPSLRPVVNFLKRNIGVKPIFGICFGLQIIAL
CARA_THEVO      -DEIEGYDA------IFVSNGPGDP--SHPSLSNVIKFLSHNIGVKPLFGICFGLQAISL
                               ... .**. *                     .  .**:* *    

CARA_SACS2      ALGGKIKKMKFGHRAINKPVIESN-SNKCYISTHNHGYGIISKNDIP----------PNT
CARA_SULTO      AMGGKVNKMKFGHRAINKPVIDIS-SNKCYITTHNHGYGILSKEDLP----------PNS
CARA_PYRFU      ADGAEIYKLKYGHRGINKPVKDLE-SGKAFVTTQNHGYAIVPES--L----------NEF
CARA_PYRAE      ALGAGIYKLKFGHRASNKPVRDIRFTGRTYITTHNHGYAVDPRG-------------TDL
CARA_SALTY      ASGAKTVKMKFGHHGGNHPVKDMD-RNVVMITAQNHGFAVDEDSLP-----------ANL
CARA_SALTI      ASGAKTVKMKFGHHGGNHPVKDMD-RNVVMITAQNHGFAVDEDSLP-----------ANL
CARA_ECOLI      ASGAKTVKMKFGHHGGNHPVKDVE-KNVVMITAQNHGFAVDEATLP-----------ANL
CARA_ECO57      ASGAKTVKMKFGHHGGNHPVKDVE-KNVVMITAQNHGFAVDEATLP-----------ANL
CARA_ECOL6      ASGAKTVKMKFGHHGGNHPVKDVE-KNVVMITAQNHGFAVDEATLP-----------ANL
CARA_YERPE      ASGAKTVKMKFGHHGGNHPVKDLD-ASCVMITAQNHGFAVDETSLP-----------SNL
CARA_YERPS      ASGAKTVKMKFGHHGGNHPVKDLD-ASCVMITAQNHGFAVDETSLP-----------SNL
CARA_PECAS      ASGAKTTKMKLGHHGGNHPVKDLD-NNCVMITAQNHGFAVDEDNLP-----------DTL
CARA_PHOLL      ASGAETMKMKFGHHGGNHPVKDLE-CNVVMITAQNHGFAVDEKSLP-----------SNL
CARA_VIBVU      ASGAKTVKMKFGHHGANHPVKDLD-RNVVMITSQNHGFAADEATLP-----------DNL
CARA_VIBVY      ASGAKTVKMKFGHHGANHPVKDLD-RNVVMITSQNHGFAADEATLP-----------DNL
CARA_VIBPA      ASGAQTVKMKFGHHGANHPVKDLE-RNVVMITSQNHGFAADEATLP-----------ENL
CARA_VIBCH      ASGAKTVKMKFGHHGANHPVKDLD-RGVVMITSQNHGFAADEATLP-----------DNL
CARA_PHOPR      ASGAKTVKMKFGHHGANHPVKDID-RDVVMITSQNHGFAADEATLP-----------DTL
CARA_SHEON      ASGAKTLKMKFGHHGANHPVSNIE-KGNVMITSQNHGFAADEATLP-----------ANI
CARA_PSEAE      ASGAKTLKMGHGHHGANHPVQDLD-SGVVMITSQNHGFAVDESTLP-----------DNL
CARA_PSEST      ASGAITVKMPSGHHGANHPVQDLE-TGVVMITSQNHGFCADEASLP-----------ANL
CARA_PSESM      AAGAKTVKMGHGHHGANHPVQDLD-TGVVMITSQNHGFAVDESTLP-----------GNV
CARA_PSEPK      ASGAKTVKMGHGHHGANHPVQDLD-TGVVMITSQNHGFAVDEATLP-----------GNV
CARA_HALER      ASGAQTVKMNHGHHGANHPVQDLD-SGRVMITSQNHGFAVEESTLP-----------DNL
CARA_ACIAD      ASGAKTMKMNHGHHGANHPVQNLE-QGTVMITSQNHGFAVDESTLP-----------ANL
CARA_NEIMB      AIGAKTLKMRFSHHGANHPVQDLD-SGKVVITSQNHGFAVDADTLP-----------ANA
CARA_NEIMA      AIGAKTLKMRFSHHGANHPVQDLD-SGKVVITSQNHGFAVDADTLP-----------ANA
CARA_NEIGO      AIGAKTLKMRFSHHGANHPVQDLD-SGKVVITSQNHGFAVDADTLP-----------ANA
CARA_PASMU      AAGGKTKKMAFGHHGANHPVQDLN-TQKVFITSQNHGFEVDEASLP-----------SHV
CARA_HAEDU      AVGAKTRKMAFGHHGANHPVQDLK-TEHVLITSQNHGFEIDEYSLP-----------ENV
CARA_RALSO      AVGGKTLKMKTGHHGANHPVKDLQ-DGRVIITSQNHGFAVDPESLP-----------ANA
CARA_RUBGI      ASGAKTFKMKFGHHGANHPVKDLD-SGRVSITSQNHGFAVDEKTLG-----------ANL
CARA_XANAC      AAGAKTLKMTTGHHGANHPVQDLD-GGRVMITSQNHGFAVDESTLP-----------ANV
CARA_XANCP      AAGAKTVKMATGHHGANHPVQDLD-GGRVMITSQNHGFAVDETTLP-----------ANV
CARA_XYLFA      TVGAKVVKMRHGHHGANHPVQDLR-SGRVMITSQNHGFAVDEATLP-----------SNV
CARA_XYLFT      AVGARVVKMSHGHHGANHPVQDLR-SGRVMITSQNHGFAVDEATLP-----------NNV
CARA_BUCAI      ASGAKIVKMKFGHHGGNHPVKDIK-NNRVIITSQNHSFTVDTENLP-----------NNI
CARA_BUCAP      ASGANIIKMKFGHHGGNHPVKEIK-TNRVIITSQNHSFTVDAKNMP-----------NNI
CARA_BUCBP      ASGAKIIKMKFGHHGSNHPVKELK-SNTVMITSQNHNYTVDTNNLP-----------KNI
CARA_WIGBR      ANGAKILKMKFGHHGSNHPVKDLE-TNKIIITSQNHDFAIDKSTLS-----------KNI
CARA_RHIME      ALGARTEKMHQGHHGANHPVKDHT-TGKVEIVSMNHGFAVDANSLP-----------QGV
CARA_AGRFC      AVGAKTEKMHQGHHGANHPVKDFT-TGKVEIVSMNHGFAVDTKSLP-----------EGV
CARA_RHILO      ALGGRTAKMHQGHHGANHPVKDHT-TGKVEIVSMNHGFAVDADSLP-----------EGV
CARA_BRUSU      ALGGRTEKMHQGHHGANHPVKDYT-TGKVEIVSMNHGFAVDSDSLP-----------ENV
CARA_BRUME      ALGGRTEKMHQGHHGANHPVKDYT-TGKVEIVSMNHGFAVDSDSLP-----------ENV
CARA_BRADU      AVGAKTKKMHQGHHGANHPVKDET-TGKVEITSMNHGFAVDEKTLP-----------KGA
CARA_CAUVC      ALGAKTVKMEQGHHGANHPVKDLT-TGKVEIVSMNHGFTVDTASLP-----------APV
CARA_ZYMMO      AVGATTYKMHQGHRGANHPVKRLD-DSKVEITSMNHGFAVATDSLP-----------EQA
CARA_STRAW      ALGFGTYKLKYGHRGINQPVQDRT-TGKVEVTAHNHGFAVDAPLDQVSDTPY-----GRA
CARA_STRCO      ALGFGTFKLKYGHRGINQPVQDRT-TGKVEVTAHNHGFAVDAPLDQVSDTPY-----GRA
CARA_BIFLO      ALGFGTYKLKFGHRGINQPVKDLT-TGKVEVTAHNHGFAVDAPIGKQVDAPFENGKYGKV
CARA_MYCTU      ALGLSTYKMVFGHRGINIPVVDHA-TGRVAVTAQNHGFALQGEAGQSFATPF-----GPA
CARA_MYCBO      ALGLSTYKMVFGHRGINIPVVDHA-TGRVAVTAQNHGFALQGEAGQSFATPF-----GPA
CARA_MYCPA      ALGLSTYKMVFGHRGINIPVIDHA-TGRVAVTAQNHGFALQGEAGQSFDTPF-----GAA
CARA_MYCLE      ALGLSTYKMVFGHRGINIPVIDHA-TGRVAVTAQNHGFALEGEAGQSFDTPF-----GSA
CARA_CORGL      AFGMETYKLKFGHRGINVPVKNHI-TGKIDITAQNHGFALKGEAGQEFETDF-----GTA
CARA_COREF      AFGMETYKLKFGHRGINVPVKNHI-TGKIDITAQNHGFALKGEAGQEFETDF-----GTA
CARA_CORDI      ALGMNTYKMKFGHRGINVPVLNHL-TGKIDITAQNHGFALEGTALEQFDTPF-----GPA
CARA_NOSS1      ALGAETFKLKFGHRGLNQPAGL---TQRVEITSQNHSFAIDPDSLPE----------AVV
CARA_SYNY3      SLGAETFKLKFGHRGLNQPCGL---EQQVEITSQNHGFAVTEGSLAE----------EV-
CARA_THEVB      SLGAETFKLKFGHRGLNQPAGL---TQEVEITSQNHGFAITAESLAQ----------TPV
CARA_PARMW      ALGGKTFKLGYGHRGLNHPCGT---SGQVEITSQNHGFAISADSLPE----------PMV
CARA_PORPU      ALEAKTFKLKFGHRGINHPSGL---KQQVEITSQNHGFAVDLQSVLK----------LSL
CARA_NEOYE      ALKAKTFKLKFGHRGINHPSGL---NQQVEITSQNHGFAVELTSVFE----------SPV
CARA_GRATL      ALEGTTFKLKFGHRGLNHPAGM---KQKAEVTSQNHGFAVNQESLYK----------DTI
CARA_CYACA      CFEAKTFKLKFGHRGLNHPVGI---NKRMEITSQNHGFAVNFEFLKS----------NKF
CARA_LEPIN      SLGKKTEKMKFGHRGGNQPVKNLE-TGQVEITSQNHGFAVIDDQKQD----------EP-
CARA_LEPIC      SLGKKTEKMKFGHRGGNQPVKNLE-TGQVEITSQNHGFAVIDDQKQD----------EP-
CARA_HELPJ      AQGYPTYKLKFGHHGSNHPVKNLE-TNAVEITAQNHNYCVPEE--IE----------EIA
CARA_HELPY      AQGYPTYKLKFGHHGSNHPVKNLK-TNAVEITAQNHNYCVPED--IE----------EIA
CARA_CAMJE      AFGYETYKMKFGQHGANHPVINLD-TKTVEITAQNHNYNVPEE--LA----------QVA
CARA_HELHP      AHGFPTYKLKFGHHGSNHPIKNLQ-SGAVEITAQNHNYCVPES--IA----------QIA
CARA_CHLTE      AFGAKTYKLKFGHHGANHPVKNLL-SNTIEITSQNHGFAVEMESLPG-----------EL
CARA_RHOBA      ACGAKTFKLKFGHRGANQPVLDLE-TGKVEITSQNHGFAVDDQGLPD-----------CL
CARA_AQUAE      ALGGKTYKLKFGHHGGNHPVKDLR-TGKIEITAQNHNFAIDPESLPE-----------DV
CARA_DESVM      ALGGTTHKLKFGHHGCNHPVKDLV-TGHIEISSQNHGFCVDIESVP------------DV
CARA_DEIRA      AAGGQTFKMKFGHRGGNQPVKNLL-TGNVEITSQNHGYAVDLDSIPNG----------AF
CARA_THET2      AAGGRTFKMKFGHRGANHPVKNLQ-TGKIEITSQNHGYAVDIDSLKD------------F
CARA_BACCL      ACGANTEKMKFGHRGSNHPVKDLR-TGKVAITSQNHGYTVTHESLSGT----------RL
CARA_BACSU      ACGANTEKMKFGHRGSNHPVKELA-TGKVALTSQNHGYTVS--SISKT----------EL
CARA_BACHK      ASGANTSKLKFGHRGLNHPVKNIA-TGKVAITSQNHGYAVEEESVENT----------EL
CARA_BACAN      ASGANTSKLKFGHRGLNHPVKNIA-TGKVAITSQNHGYAVEEESVENT----------EL
CARA_BACCZ      ASGANTSKLKFGHRGLNHPVKNIA-TGKVAITSQNHGYAVEEESVENT----------EL
CARA_BACC1      ASGANTSKLKFGHRGLNHPVKNLA-TGKVAITSQNHGYAVEEESVENT----------EL
CARA_BACCR      ASGANTSKLKFGHRGLNHPVKNLA-TGKVAITSQNHGYAVEEESVENT----------DL
CARA_ALKHC      ACGAKTEKLRFGHRGSNHPVRERS-TGLIEITAQNHGYTVTEGSLVNT----------DL
CARA_OCEIH      ACGADTEKMKFGHRGANHPVKDLL-AGKTYLTSQNHSYAVNVSSLVNT----------DL
CARA_FUSNN      ACGAKTYKLKFGHRGGNHPVKNIL-TGRVDITSQNHGYAVDIDSLNDT----------DL
CARA_LISMF      ANGADTFKLKFGHRGANHPVKELA-TGRVDFTAQNHGYAVEKDSLIGT----------DL
CARA_LISMO      ANGADTFKLKFGHRGANHPVKELA-TGRVDFTAQNHGYAVEKDSLIGT----------DL
CARA_LISIN      ANGADTFKLKFGHRGANHPVKELA-TGRVDFTAQNHGYAVEKESLIGT----------DL
CARA_STAEQ      SQGATSFKMKFGHRGANHPVKDLR-TGKIDITSQNHGYSIDRDSLKNT----------DL
CARA_STAES      SQGATSFKMKFGHRGANHPVKDLR-TGKIDITSQNHGYSIDCDSLKNT----------DL
CARA_STAHJ      SQGGTSFKMKFGHRGANHPVKDLR-SGKVDITSQNHGYAIDKNSLVNT----------DL
CARA_STAS1      SQGATSFKMKFGHRGANHPVKDLK-TGKIALTSQNHGYAIDKASLKNT----------DL
CARA_STAAN      SQGASSFKMKFGHRGANHPVKNLE-TGKVDITSQNHGYAIDIDSLKST----------DL
CARA_STAAM      SQGASSFKMKFGHRGANHPVKNLE-TGKVDITSQNHGYAIDIDSLKST----------DL
CARA_STAAS      SQGASSFKMKFGHRGANHPVKNLE-TGKVDITSQNHGYAIDIDSLKST----------DL
CARA_STAAC      SQGASSFKMKFGHRGANHPVKNLE-TGKVDITSQNHGYAIDIDSLKST----------DL
CARA_STAAW      SQGASSFKMKFGHRGANHPVKNLE-TGKVDITSQNHGYAIDIDSLKST----------DL
CARA_STAAR      SQGASSFKMKFGHRGANHPVKNLE-TGKVDITSQNHGYAIDIDSLKST----------DL
CARA_STRP1      ANGAKTCKMTFGHRGFNHAVREIA-TGRIDFTSQNHGYAVERSSLPD-----------TL
CARA_STRP6      ANGAKTCKMTFGHRGFNHAVREIA-TGRIDFTSQNHGYAVERSSLPD-----------TL
CARA_STRP3      ANGAKTCKMTFGHRGFNHAVREIA-TGRIDFTSQNHGYAVERSSLPD-----------TL
CARA_STRP8      ANGAKTCKMTFGHRGFNHAVREIA-TGRIDFTSQNHGYAVERSSLPD-----------TL
CARA_STRMU      ANGASTYKMKFGHRGFNHAVREIA-TGRIDFTSQNHGYAVSRDNLPE-----------EL
CARA_STRPN      ANGAKTYKMKFGHRGFNHAVREIA-TGRVDFTSQNHGYAVSREDLPE-----------HL
CARA_STRR6      ANGAKTYKMKFGHRGFNHAVREIA-TGRVDFTSQNHGYAVSREDLPE-----------HL
CARA_STRA3      ANGAKTYKMTFGHRGFNHAVRHLQ-TGQVDFTSQNHGYAVSREDFPE-----------AL
CARA_STRA5      ANGAKTYKMTFGHRGFNHAVRHLQ-TGQVDFTSQNHGYAVSREDFPE-----------AL
CARA_LACLA      ANGAKTYKMKFGHRGFNHAVREIA-TGRIDFTSQNHGYAVSSENLPE-----------DL
CARA_LACLM      ANGATTYKMKFGHRGFNHAVREVA-TGRIDFTSQNHGYAVSSENLPE-----------DL
CARA_LACPL      ANGADTFKMKFGHRGFNHPVREIA-TGRIDFTSQNHGYAVDRDSLAQT----------DL
CARA_SYMTH      ALGATTYKLPYGHRGANHPVKELA-TGRIHITSQNHGYAVAAESLPP-----------EV
CARA_CALS4      ALGCNTVKMKFGHRGANQPVKDLL-TNKDYITSQNHGYAVEEESIDKD----------KI
CARA_CLOAB      ASGGNTYKLKYGHRGGNHGIYDVQ-RDKAYITAQNHGYAVDEESVLEN----------GM
CARA_CLOPE      TLGGETKKLKFGHRGCNHPVKDLI-NNRVHITSQNHGYYV---ATLPE----------NM
CARX_BACSU      AFGGNTFKLPFGHRGANHPVIDRK-TKRVFMTSQNHSYVVDEQSINEE----------EL
CARX_GEOSE      ATGRIRKKLRFGHRGANQPVWDAV-KQNVMMTSQNHSYVVKEGSLVGK----------PF
CARX_ALKHC      AFGADTEKLRFGHRGANQPVINLK-SNRVYMTSQNHSYVVKEDSLQRT----------DW
CARX_LACPL      AYGAQTYQLSFGHHGLNHPVQACA-DGRIIMTSQNHDYAVDPASIKGT----------PL
CARA_ARCFU      ALGAKTFKLKFGHHGSNQPVKDFE-TGRVFISSQNHNFAVDTKTL-P----------KEF
CARA_METKA      AEGGDTFKLKFGHRGANQPVKDLD-KDRVYITSQNHGFALDPDSLRD----------TPL
CARA_METAC      AMGARTYKLKFGHRGGNQPVKDLI-ENKIFISSQNHGYAVDADSLEG----------TGL
CARA_METTH      AFGARIYKMKFGHRGVNQPVKDLR-SGTVSITSQNHGFTVDPDSVKG----------TDI
CARA_METJA      AFGGETYKMKFGHRGGNQPVKDLK-TQKVYITSQNHGFAVRKESLP-----------DDV
CARA_HALSA      ALGGDTEKMDFGHRGVNQPVLDHD-SGRVVMTTQNHGYTVADPG--------------DL
CARA_THEAC      AYGSKTYKMKFGHRGSNHAVTDGN---RIYVTTHNHGYAVDPDTVRD------------F
CARA_THEVO      AYGAKTYKMKFGHRGSNHAVTDGT---HSYVTTHNHGYAVDGSTVKD------------F
                       ::  .::. *             . : **.:                      

CARA_SACS2      KIWFYNPDDYTIEGLIHEKLPIITTQFHPEARPGPWDTTWVFDKFRTMVTGK--------
CARA_SULTO      KLWFINPDDGTIEGWIHEKLPIITTQFHPEARPGPWDVTWVFDKFKKMVSRNA-------
CARA_PYRFU      KVWMVNLDDNSVEGIKHESLPIIATQYHPEASPGPWDSLWVFDEFVKILEGRK-------
CARA_PYRAE      KVWAVQPDDGTVEGLYHERLPILTTQWHPEASPGPQDTRWVFDKFLKLVERHGH------
CARA_SALTY      RVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRQSAK---
CARA_SALTI      RVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIKHYRSSAK---
CARA_ECOLI      RVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRKTAK---
CARA_ECO57      RVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRKTAK---
CARA_ECOL6      RVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIALIEQYRKTAK---
CARA_YERPE      RTTHVSLFDGSLQGLHRTDKAAFSFQGHPEASPGPHDAAPLFDHFIELIEAYRASSVSLN
CARA_YERPS      RTTHVSLFDGSLQGLHRTDKAAFSFQGHPEASPGPHDAAPLFDHFIELIEAYRASSVSLN
CARA_PECAS      RVTHKSLFDHTVQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIDLIQTYRSSAK---
CARA_PHOLL      RVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHETASLFDHFIELIEQYCQKNNRHN
CARA_VIBVU      RATHVSLFDGSLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIKQHSA------
CARA_VIBVY      RATHVSLFDGSLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIKQHSA------
CARA_VIBPA      RATHVSLFDGSLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIKKHSA------
CARA_VIBCH      RATHKSLFDGSLQGIHRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIKQFRA------
CARA_PHOPR      RATHKSLFDGSLQGIHRTDKPAFSFQGHPEASPGPTDAAPLFDHFIELIKLSVNEARSA-
CARA_SHEON      KVTHKSLFDGSLQGIHLTDKPAFSFQGHPEASPGPNDAAPLFDHFIELIEHYRQNAK---
CARA_PSEAE      RATHKSLFDGTLQGIERTDKVAFSFQGHPEASPGPHDVAPLFDRFISAMAERR-------
CARA_PSEST      RATHKSLFDGTLQGIERTDKVAFGFQGHPEASPGPCDVAPLFDRFISAMAPVVDR-----
CARA_PSESM      RAIHKSLFDGTLQGIELTDKSAFSFQGHPEASPGPNDVAPLFDRFIDAMAKRR-------
CARA_PSEPK      RAIHKSLFDGTLQGIERTDKSAFSFQGHPEASPGPTDVAPLFDRFTDAMAKRR-------
CARA_HALER      RAIHRSLFDGTLQGIERTDRPAFSFQGHPEASPGPRDVAPLFDRFVEMMRHRR-------
CARA_ACIAD      KVTHRSLFDGTNQGIHRTDKPAFSFQGHPEASPGPHDCAPLFDHFIELIEAAKK------
CARA_NEIMB      RITHKSLFDNTLQGIELTDKPVFCFQGHPEASPGPQDVGYLFDKFIGNMKAAKRA-----
CARA_NEIMA      RITHKSLFDNTLQGIELTDKPVFCFQGHPEASPGPQDVGYLFDKFIGNMKAAKRA-----
CARA_NEIGO      RITHKSLFDNTLQGIELTDKPVSCFQGHPEASPGPQDVGYLSDKFIGNMKAAKQA-----
CARA_PASMU      RVTHRSLFDNSVQGIELSDQSAFSFQGHPEASPGPNDVAYLFDKFINEMRKANLSQLSTY
CARA_HAEDU      IVTHRSLFDNSVQGIELTNQVAFSFQGHPEANPGPQDVAYLFDKFINAVQATKA------
CARA_RALSO      RVTHVSLFDGTLQGFELTDRPAFCFQGHPEASPGPHDIGYLFDRFTAAMAERKQ------
CARA_RUBGI      RPTHVSLFDGTLQGLARTDRPAFCFQGHPEASPGPHDIGYLFDRFVALMQERA-------
CARA_XANAC      RVTHRSLFDGTNQGIALTDAPAFSFQGHPEASPGPRDVGPLFDRFVDLMAARA-------
CARA_XANCP      RVTHRSLFDGTNQGIALTDAPAFSFQGHPEASPGPRDVGPLFDRFVASMAEAKS------
CARA_XYLFA      RVTHRSLFDGTNQGIELLDVPAFSFQGHPEASPGPHDVDVLFDRFITMMAAQS-------
CARA_XYLFT      RVTHRSLFDGTNQGIELLDVPAFSFQGHPEASPGPHDVDVLFDRFITMMAAQS-------
CARA_BUCAI      EITHSSLFDGTLQGLSLTNKSAFSFQGHPEASPGPHDASYLFDYFIKLIVSQKTTLSN--
CARA_BUCAP      AITHSSLFDGTLQGLCLTDKLAFSFQGHPEASPGPHDASSLFDHFIKLLNQVKFSN----
CARA_BUCBP      NITHISLFDGSIQGLQRNDKHAFSFQGHPEASPGPHDSMILFDKFIKLMKKSYNSQQKTI
CARA_WIGBR      IITHISMFDQTLQGIKLINKPVFSFQGHPESSPGPKDALFLFKNFINLVKDYRLNKK---
CARA_RHIME      EQTHISLFDGTNCGLRVDGRPVFSVQHHPEASPGPQDSHYLFRRFLNLIREKKGEPALAE
CARA_AGRFC      EETHTSLFDGTNCGLRIVGKPVFSVQHHPEASPGPQDSHYLFRRFVNLLRENKGEAALAE
CARA_RHILO      EETHVSLFDGSNCGIALTGRPVFSVQHHPEASPGPQDSHYLFRRFVNLIREKRGEEQLAE
CARA_BRUSU      EETHVSLFDGTNCGLRVVGKPVFSVQHHPEASPGPQDSHYLFRRFINLIRERKGQAPLPE
CARA_BRUME      EETHVSLFDGTNCGLRVVGKPVFSVQHHPEASPGPQDSHYLFRRFINLIRERKGQAPLPE
CARA_BRADU      TQTHISLFDGSNCGIQLDGKPVFSVQYHPEASPGPRDSHYLFQRFAELMRQKKSA-----
CARA_CAUVC      KETHVSLFDGTNAGIALDGKPVFSVQHHPEASPGPTDSLYLFERFAGLMDAAK-------
CARA_ZYMMO      RPTHLSLFDGSLAGLELTDRPAFSVQYHPEASPGPQDSYYLFTKFIDLIAKERP------
CARA_STRAW      EVSHVCLNDNVVEGLQLLDQPAFSVQYHPEAAAGPHDAAYLFDRFVSLMEGQRA------
CARA_STRCO      EVSHVCLNDNVVEGLQLLDRPAFSVQYHPEAAAGPHDAAYLFDRFVNLMEGQRA------
CARA_BIFLO      FVSHIDLNDDVVEGLQCVDIPAFSVQYHPEAAAGPHDAAYLFDRFCELMKNNSKEGK---
CARA_MYCTU      VVSHTCANDGVVEGVKLVDGRAFSVQYHPEAAAGPHDAEYLFDQFVELMAGEGR------
CARA_MYCBO      VVSHTCANDGVVEGVKLVDGRAFSVQYHPEAAAGPHDAEYLFDQFVELMAGEGR------
CARA_MYCPA      VVSHTCANDGVVEGVKLADGRAFSVQYHPEAAAGPHDANYLFDQFIELMEGDR-------
CARA_MYCLE      VVSHTCANDGVVEGVKLADGRAFSVQYHPEAAAGPHDAEYLFDSFVELMAAQR-------
CARA_CORGL      IVTHTCLNDGVVEGIALKSGRAYSVQYHPEAAAGPNDASPLFDQFVELMDADAQKKGA--
CARA_COREF      VVTHTCLNDGVVEGVALKSGRAYSVQYHPEAAAGPNDASPLFDQFVALMDEDSENQKEEA
CARA_CORDI      HVTHTCLNDDTVEGVALVNGLAYSVQYHPEAAAGPHDANPLFDQFVELIQANKK------
CARA_NOSS1      EISHLNLNDRTVAGLRHKSLPIFSVQYHPEASPGPHDADYLFAQFVHQMRTTKQATTAEV
CARA_SYNY3      EITHFNLNDKTVAGLRHKELPFFSVQYHPEASPGPHDADYLFEKFVKLMRQQKAEVAG--
CARA_THEVB      EITHFNLNDKTVAGLKHQTLPIFSVQYHPEASPGPHDADYLFGEFVAQMRAYRQQHPRRQ
CARA_PARMW      EVTHLNLNDRTVAAFQHRHQPVFGIQYHPEASPGPHDADHHFGRFVALMADRRDVGG---
CARA_PORPU      QVTHFNLNDITVAGTGHSRSPYFSVQYHPESSPGPHDADYLFEYFIEIMKQFRKEAN---
CARA_NEOYE      RVTHFNLNDTTIAGTGHNQSPYFSVQYHPESSPGPHDADYLFESFIEIMTKSKNKVS---
CARA_GRATL      NITHFNLNDTTVAGILHNKKPIFSVQYHPEASPGPHDSDYLFKYFINLIKHFKQYKNYKN
CARA_CYACA      YANHLNLNDGTLAGISSQNFPLISVQYHPEGSPGPHDSNYLFKYWVYIIYKSKSS-----
CARA_LEPIN      -ISFLNLNDHTVEGILKSGYPLLTVQYHPESAPGPNDSRYLFQKFYDLVEKTKKG-----
CARA_LEPIC      -ISFLNLNDHTVEGILKSGYPLLTVQYHPESAPGPNDSRYLFQKFYDLVEKTKKG-----
CARA_HELPJ      TITHRNLFDNTIEGVRYKNAPIISVQHHPESSPGPKESHYIFKEFVGLLEGF--------
CARA_HELPY      IITHRNLFDNTIEGVRYKNAPIISVQHHPESSPGPKESHYIFKEFVELLKDF--------
CARA_CAMJE      HITHRNLFGDNVEGVRYKDYPIISVQHHPESSSGPHESKYIFKEFMNLM-----------
CARA_HELHP      TITHRNLFDNTIEGVRYKDKPIFSVQHHPEASPGPREARILFEEFAKLCCK---------
CARA_CHLTE      ELTHKNLYDMTVEGIRHRELPCFSVQYHPEAAPGPHDSHYLFKEFTELMERLKN------
CARA_RHOBA      EVTHRNLNDDTIAGVRHKDTGAFAVQYHPEAAAGPHDSHYLFSRFQEQLNEKCGVTA---
CARA_AQUAE      EVTHLNLLDNTVEGIKHKHLPIFAVQYHPENSPGPHDSYYLFKEFVKMAQG---------
CARA_DESVM      EITHVNLNDGTLEGFAHKTRPILAVQHHPEASPGPTDSRYFFARFRGMVREAVGR-----
CARA_DEIRA      VATHVNLNDGTLEGMAHSRYPVFSVQYHPEASPGPHDSRYLFDRFIEEIDAFDGGNGTPI
CARA_THET2      RPTHVNLNDGTLEGMAHARYPVFSVQYHPEAAPGPHDALYLFRRFLEEVEAFHGATGLPV
CARA_BACCL      EVTHIALNDGTVEGLRHLDVPAFTVQYHPEASPGPEDANPLFDEFLALIREFN-KKGEVI
CARA_BACSU      EVTHIAINDDTIEGLKHKTLPAFTVQYHPEASPGPEDANHLFDRFIEMIETTE-KEGEAV
CARA_BACHK      EITHVALNDGTVEGLRHKKFPAFTVQYHPEASAGPEDANDLFEDFLTMIENFK-KEGEEL
CARA_BACAN      EITHVALNDGTVEGLRHKKFPAFTVQYHPEASAGPEDANDLFEDFLTMIENFK-KEGEEL
CARA_BACCZ      EITHVALNDGTVEGLRHKKFPAFTVQYHPEASAGPEDANDLFEDFLTMIENFK-KEGEEL
CARA_BACC1      EITHVALNDGTVEGLRHKKFPAFTVQYHPEASAGPEDANDLFEDFLTMIENFK-KEGEEL
CARA_BACCR      EITHVALNDGTVEGLRHKKFPAFTVQYHPEASAGPEDANDLFEDFLTMIENFK-KEGEEL
CARA_ALKHC      IVTHEAVNDGTIEGLAHKVHPAFSVQYHPEASPGPEDSNVLFDRFIKLMESNK-HRALTV
CARA_OCEIH      ELTQIALNDDTVEGIRHTAFPAFSVQYHPEASPGPEDTNFLFDEFLNLIKASKVKQGGEV
CARA_FUSNN      ELTHIAINDRSCEGVRHKKYPVFTVQFHPEAAAGPHDTSYLFDEFIKNIDNNM-K-----
CARA_LISMF      KVTHIELNDETVEGLAHKEYPAYTVQYHPEANPGPSDVNYLFDEFMEMMNGKEEGELHA-
CARA_LISMO      KVTHIELNDETVEGLAHKEYPAYTVQYHPEANPGPSDVNYLFDEFMEMMNGKEEGELHA-
CARA_LISIN      KVTHIELNDETVEGLAHKEYQAYTVQYHPEANPGPSDVNYLFDEFMEMMNVKEEGELHA-
CARA_STAEQ      EVTHIALNDGTVEGLRHKELPAFSVQYHPEARPGPSDSNYLFDEFITMMKDFKEKERQIN
CARA_STAES      EVTHIALNDGTVEGLRHKELPAFSVQYHPEARPGPSDSNYLFDEFIAMMKDFKEKERQIN
CARA_STAHJ      EVTHIALNDGTVEGLRHKTLPAFSVQYHPEARPGPSDSNYLFDEFMTMMKEFKEKEQTAN
CARA_STAS1      EVTHIAINDDTVEGLRHKSLPAFSVQYHPEACPGPSDSNYLFDEFIDMINEYKTKELTNN
CARA_STAAN      EVTHLALNDGTVEGLKHKTLPAFSVQYHPEANPGPSDSNYLFDDFVAMMTNFKEKERHIN
CARA_STAAM      EVTHLALNDGTVEGLKHKTLPAFSVQYHPEANPGPSDSNYLFDDFVAMMTNFKEKERHIN
CARA_STAAS      EVTHLALNDGTVEGLKHKTLPAFSVQYHPEANPGPSDSNYLFDDFVAMMTNFKEKERHIN
CARA_STAAC      EVTHLALNDGTVEGLKHKTLPAFSVQYHPEANPGPSDSNYLFDDFVAMMTNFKEKERHIN
CARA_STAAW      EVTHLALNDGTVEGLKHKTLPAFSVQYHPEANPGPSDSNYLFDDFVAMMTNFKEKERHIN
CARA_STAAR      EVTHLALNDGTVEGLKHKTLPAFSVQYHPEANPGPSDSNYLFDDFVAMMTNFKEKERHIN
CARA_STRP1      MVTHEDINDKTVEGVKHRDFPAFSVQFHPDAAPGPHDASYLFDEFLEMIDSWRCTSK---
CARA_STRP6      MVTHEDINDKTVEGVKHRDFPAFSVQFHPDAAPGPHDASYLFDEFLEMIDSWRCTSK---
CARA_STRP3      MVTHEDINDKTVEGVKHRDFPAFSVQFHPDAAPGPHDASYLFDEFLEMIDSWRCTSK---
CARA_STRP8      MVTHEDINDKTVEGVKHRDFPAFSVQFHPDAAPGPHDASYLFDEFLEMIDSWRCTSK---
CARA_STRMU      IITHEEINDKSIEGVRHRYYPAFSVQYHPDAAPGPHDASYLFDEFLELIDAFQLEKASK-
CARA_STRPN      IITHEEINDKSVEGVRHRYQPAFSVQYHPDAAPGPHDASYLFDEFIEMMEVFKQSN----
CARA_STRR6      IITHEEINDKSVEGVRHRYQPAFSVQYHPDAAPGPHDASYLFDEFIEMMEVFKQSN----
CARA_STRA3      FITHEEINDKTVEGVRHKYYPAFSVQFHPDAAPGPHDTSYLFDEFINMIDDFQQKS----
CARA_STRA5      FITHEEINDKTVEGVRHKYYPAFSVQFHPDAAPGPHDTSYLFDEFINMIDDFQQKS----
CARA_LACLA      MITHVEINDDSVEGVRHKHFPAFSVQFHPDAAPGPHDASYLFDDFMDLMDNFKK------
CARA_LACLM      MITHVEINDNSVEGVRHKYFPAFSVQFHPDAAPGPHDASYLFDDFMDLMDNFKK------
CARA_LACPL      LITHEEINDGTVEGLRHRDYAAFSVQYHPDAAPGPHDADHIFDEFIDLMAANQATQKGSQ
CARA_SYMTH      EVTHVSLHDGTVEGLAHRRLPLFTVQYHPEACPGPRENRYLFDRFLALVDRSAVSTRTA-
CARA_CALS4      TVTHINLNDGTVEGIMHKFLPVFSVQYHPEACPGPRDSTDIFDKFMDIVMVYKRRFYFAE
CARA_CLOAB      IITHRNLNDGTVEGMKHKSIPLFSVQFHPEGAPGPTDTTYLFDQFVNL------------
CARA_CLOPE      EITHVSMNDGTVEGMKHKELPIFSVQFHPEACPGPKDSEYIFDEFMKYAL----------
CARX_BACSU      TIRFHHVNDTSVEGLAHKKLPVMSVQFHPEAHPGPAESEWIFDDYLKNVIPARREIAHA-
CARX_GEOSE      DIRFINVNDGSVEGIVHRHKPILSVQYHPEAHPGPHDTGYIFDEFLQTVFKGENVYA---
CARX_ALKHC      DATFKNINDGSIEGLTHKYLPIQTVQFHPEAHPGPSDSDEIFHSFIDDVAAKGREKTYA-
CARX_LACPL      IVTHTELNDGSIEGLRLPHQAVMSVQFHPEAHPGPQEAGQFFDDFLLTIQKEAVVNA---
CARA_ARCFU      EVTQINLNDHTVEGMVHKDFPLITVQYHPEAGPGPHDTYFFFDRYVDMLREYR-------
CARA_METKA      RVRWVNVNDGTVEGVVHTDAPAFSVQFHPEAGPGPWDTKWVFDEFLAMCREH--------
CARA_METAC      YVKYLNANDKTVEGVSHKDLDIFSVQFHPEAQAGPMDTEETFFGKVVKVLGGDL------
CARA_METTH      EITQLNLNDGTPEGIEHRELPVFSVQYHPEAGPGPHDTVNIFDRLWMF------------
CARA_METJA      EVSFINLNDMTVEGIRHKDLPIFSVQFHPEARPGPHDTMFLFDEMIKLKDRK--------
CARA_HALSA      TVTQVNVNDGTPEALDSAPLDVLTRQYHPEANPGPHDTRGFFDDVLAMADASYTPATAD-
CARA_THEAC      HVRERDINDGTIEMIEDGM--MMAVQYHPEASPGPHDTRWFFSEMRRRTEDAAKG-----
CARA_THEVO      KVIGWDANDGTVEIIEGDD--MFAVQFHPEASPGPHDTRWFFGEMKRRIGYA--------
                        .                * **:  .** :                       

CARA_SACS2      ----------
CARA_SULTO      ----------
CARA_PYRFU      ----------
CARA_PYRAE      ----------
CARA_SALTY      ----------
CARA_SALTI      ----------
CARA_ECOLI      ----------
CARA_ECO57      ----------
CARA_ECOL6      ----------
CARA_YERPE      CSNSHK----
CARA_YERPS      CSNSHK----
CARA_PECAS      ----------
CARA_PHOLL      TK--------
CARA_VIBVU      ----------
CARA_VIBVY      ----------
CARA_VIBPA      ----------
CARA_VIBCH      ----------
CARA_PHOPR      ----------
CARA_SHEON      ----------
CARA_PSEAE      ----------
CARA_PSEST      ----------
CARA_PSESM      ----------
CARA_PSEPK      ----------
CARA_HALER      ----------
CARA_ACIAD      ----------
CARA_NEIMB      ----------
CARA_NEIMA      ----------
CARA_NEIGO      ----------
CARA_PASMU      VAHH------
CARA_HAEDU      ----------
CARA_RALSO      ----------
CARA_RUBGI      ----------
CARA_XANAC      ----------
CARA_XANCP      ----------
CARA_XYLFA      ----------
CARA_XYLFT      ----------
CARA_BUCAI      ----------
CARA_BUCAP      ----------
CARA_BUCBP      I---------
CARA_WIGBR      ----------
CARA_RHIME      R---------
CARA_AGRFC      R---------
CARA_RHILO      RV--------
CARA_BRUSU      REQAA-----
CARA_BRUME      REQAA-----
CARA_BRADU      ----------
CARA_CAUVC      ----------
CARA_ZYMMO      ----------
CARA_STRAW      ----------
CARA_STRCO      ----------
CARA_BIFLO      ----------
CARA_MYCTU      ----------
CARA_MYCBO      ----------
CARA_MYCPA      ----------
CARA_MYCLE      ----------
CARA_CORGL      ----------
CARA_COREF      ----------
CARA_CORDI      ----------
CARA_NOSS1      S---------
CARA_SYNY3      ----------
CARA_THEVB      ----------
CARA_PARMW      ----------
CARA_PORPU      ----------
CARA_NEOYE      ----------
CARA_GRATL      SSLAQAR---
CARA_CYACA      ----------
CARA_LEPIN      ----------
CARA_LEPIC      ----------
CARA_HELPJ      ----------
CARA_HELPY      ----------
CARA_CAMJE      ----------
CARA_HELHP      ----------
CARA_CHLTE      ----------
CARA_RHOBA      ----------
CARA_AQUAE      ----------
CARA_DESVM      ----------
CARA_DEIRA      IKANPGRLGV
CARA_THET2      EKQRADQHGI
CARA_BACCL      HA--------
CARA_BACSU      CQNA------
CARA_BACHK      CQNA------
CARA_BACAN      CQNA------
CARA_BACCZ      CQNA------
CARA_BACC1      CQNA------
CARA_BACCR      CQNA------
CARA_ALKHC      ----------
CARA_OCEIH      YA--------
CARA_FUSNN      ----------
CARA_LISMF      ----------
CARA_LISMO      ----------
CARA_LISIN      ----------
CARA_STAEQ      A---------
CARA_STAES      A---------
CARA_STAHJ      A---------
CARA_STAS1      A---------
CARA_STAAN      A---------
CARA_STAAM      A---------
CARA_STAAS      A---------
CARA_STAAC      A---------
CARA_STAAW      A---------
CARA_STAAR      A---------
CARA_STRP1      ----------
CARA_STRP6      ----------
CARA_STRP3      ----------
CARA_STRP8      ----------
CARA_STRMU      ----------
CARA_STRPN      ----------
CARA_STRR6      ----------
CARA_STRA3      ----------
CARA_STRA5      ----------
CARA_LACLA      ----------
CARA_LACLM      ----------
CARA_LACPL      FNA-------
CARA_SYMTH      ----------
CARA_CALS4      V---------
CARA_CLOAB      ----------
CARA_CLOPE      ----------
CARX_BACSU      ----------
CARX_GEOSE      ----------
CARX_ALKHC      ----------
CARX_LACPL      ----------
CARA_ARCFU      ----------
CARA_METKA      ----------
CARA_METAC      ----------
CARA_METTH      ----------
CARA_METJA      ----------
CARA_HALSA      ----------
CARA_THEAC      ----------
CARA_THEVO      ----------